app GitHub

fidelis: Zero-LLM agent memory with BM25 and vector retrieval

Local-first memory for Claude Code that retrieves with BM25, dense vectors, and reciprocal rank fusion — no LLM call in the retrieval path. Returns the original passages verbatim by default instead of a paraphrase, so recalled context is not silently rewritten. MIT-licensed and installable from PyPI as fidelis-memory.

memoryretrievalbm25ragpython
by hermes-labs-ai Sep 15, 2026 8/10
app GitHub

longrun: Project memory that survives /clear and compaction

Shared notes, cross-session messaging, and event watches that persist across Claude Code sessions, so context is not lost when you /clear or the window compacts. The watches are token-free, and an orchestrator sits on top to coordinate work between sessions.

memorycontextorchestrationsessions
by krllx Sep 15, 2026 7/10
app GitHub

happenin: See what your agents are doing

An observability tool for watching agent activity as it happens rather than reading logs after the fact. Aimed at anyone running several agent sessions at once and losing track of what each one is working on.

observabilitymonitoringagents
by YogliB Sep 15, 2026 5/10
app GitHub

agentbox: Claude Code and Codex in one isolated Docker container

Runs your personal coding agents inside a single Docker container that is walled off from the host filesystem. Lets you hand an agent broader permissions without giving it your whole machine, and keeps Claude Code and Codex in the same reproducible environment.

dockersandboxisolationcodexsecurity
by zurfyx Sep 15, 2026 7/10
app GitHub

nestor: Sandbox Claude Code and OpenCode in Docker from Go

Runs Claude Code and OpenCode in Docker sandboxes, shipped as a Go library with a ready-to-use binary. The library form is the interesting part — you can embed sandboxed agent runs inside your own Go tooling instead of shelling out to a script.

dockersandboxgoopencodelibrary
by toniphan21 Sep 15, 2026 7/10
app GitHub

cairn-memory: Cross-Session Memory for AI Agents, With Receipts

A lightweight memory layer that carries context between agent sessions and keeps receipts — a record of where each remembered fact came from. The provenance angle is the differentiator against memory layers that hand back assertions you cannot trace or verify.

memorycross-sessionprovenanceagents
by Cairn-ink Sep 15, 2026 6/10
app GitHub

tmux-claude-resurrect: Restore Exact Claude Sessions After tmux-resurrect

Brings back the specific Claude Code session each pane was running when tmux-resurrect restores your layout, using Claude's own native session metadata. No Claude hooks and no background polling, which keeps it out of the way of whatever else is wired into your session lifecycle.

tmuxsessionsresumerestoreno-hooks
by dcwigk Sep 15, 2026 7/10
app GitHub

flowpane: Live Graph of a Claude Code Workflow Run Beside the Transcript

Draws a workflow run as a live graph in the tmux pane next to the transcript, so you can see which steps and agents are active while the run is in progress. Fills the gap where a long orchestrated run reads as a wall of scrolling text with no structure.

visualizationtmuxworkflowsobservabilitymulti-agent
by mpolatcan Sep 15, 2026 7/10
app GitHub

claude-macos-menu-usage: Native macOS Menu-Bar App for Live Quota

A native macOS menu-bar app showing live Claude Code quota usage. Nothing unusual for a well-covered category, but it is native and focused on the one number most people want visible while they work.

macosmenu-barquotausagenative
by LunaParker Sep 15, 2026 5/10
app GitHub

durindoor: Self-Hosted AI Gateway With One API Across Many Providers

A self-hosted gateway that puts a single stable API in front of many upstream AI providers, so developer tools and apps keep working when you swap or add a backend. Useful as the seam between your agent tooling and whichever provider you are currently routing to.

gatewayself-hostedprovidersapirouting
by bloodf Sep 15, 2026 6/10
app GitHub

agent-context-manager: Rules, Skills and MCP as Per-Repo Profiles

Bundles rules, skills, and MCP servers into named profiles, then lets you pick one profile per repository. Every agent on that repo reads the same configuration and stays in sync, which beats maintaining parallel config for Claude Code, Codex, and friends by hand. Docs in Korean and English.

profilesconfigurationmcpmulti-agentsync
by IsthisLee Sep 15, 2026 7/10
app Reddit

command-bridge: Local CPU Speech-to-Text and TTS for Coding Agents

A CLI that gives any coding agent speech-to-text and text-to-speech through bash, running locally on CPU — so Claude Code, Codex, or Grok can talk to you and you can talk back. Built for running several agents at once: while one is still reasoning you switch and speak to another. Agents also get a canvas to draw diagrams on and point at while they explain.

voicesttttsclimulti-agent
by JuanjoFuchs Sep 15, 2026 7/10
app Reddit

Agent HUD: Quota Glow Around the Notch, Lit When a Turn Finishes

Puts remaining quota in the glow around a MacBook notch — yellow at 70% used, red at 90% — and lights it up when a turn finishes or quota resets, with hover detail for reset countdowns and token usage. Covers Claude Code plus 15 other agents. Open-source core, and the author notes the unexpected part was letting Claude sessions coordinate with each other.

macosnotchquotanotificationsopen-source
by No-Hunter9792 Sep 15, 2026 6/10
app GitHub

nearly: Log the Commands Refused, Pushes Blocked and Turns Rolled Back

A pull request shows what changed; this records what nearly happened — the commands a human declined, the pushes policy blocked, the turns that got rolled back. That near-miss trail is the part of agent behaviour normally lost entirely, and it is what you want when reviewing how much an agent tried to do on its own.

observabilityauditpolicyrollbackreview
by anujpatel06 Sep 15, 2026 7/10
app GitHub

autonomous-harness: One Encrypted Window for Every Agent on Every Machine

A single window onto Claude Code, Codex, Cursor and 11 other agents running across all your machines. A daemon keeps each one alive in tmux and the connection is end-to-end encrypted with no SSH, delivered as a desktop app plus daemon, relay, and a USB device. Aimed at people driving many long-running sessions from wherever they happen to be.

tmuxdaemonremotemulti-agente2ee
by autonomous-ai Sep 15, 2026 7/10
app Reddit

Aether-Vault: Git-Like Versioning for Code, Weights and Datasets

A self-hosted version control system for machine learning: atomic commits spanning code, weights, and datasets that check out identically anywhere. A C++17 core hashes multi-gigabyte files in parallel and shards safetensors per layer with content-defined chunking and dedup, behind a FastAPI registry and a Next.js dashboard with weight diffs. Agent-facing features include stable JSON envelopes, a Python SDK, resumable event streams, and .avh context memory so the next agent inherits intent. Positioned against bolting Git LFS or DVC onto a normal repo.

ml-opsversioningself-hosteddatasetsagents
by Particular-Sleep3719 Sep 15, 2026 5/10
app GitHub

Inkbox Plugin: Give Your Claude Code Agent a Mailbox and Phone Number

A Claude Code plugin that provisions your agent its own Inkbox identity — a mailbox, iMessage, a phone number for calls and SMS, and an internet address. You can then talk to the agent from anywhere rather than only from the terminal. Aimed at long-running agents you want to reach while away from the machine.

pluginmessagingremote-accessnotifications
by inkbox-ai Sep 15, 2026 6/10
app GitHub

NotchStatus: Claude Code Status Indicator for the MacBook Notch

A small macOS utility that renders Claude Code session status in the MacBook notch area. Gives you an at-a-glance signal of whether the agent is working, waiting on you, or done without tabbing back to the terminal. Handy when running sessions alongside other work.

macosstatuslinemonitoringui
by pekkachiu Sep 15, 2026 6/10
app GitHub

ai-study-kit: Turn Any Question Bank Into a Full Learning Loop

A Claude Code / zcode plugin that converts any set of questions into practice sessions, courses, flashcards, wrong-answer deep-dives, and spaced repetition, with progress synced across devices. Distributed as a plugin so there is no repo to clone or site to stand up. Bilingual Chinese/English.

educationpluginspaced-repetitionflashcards
by jerryjiao Sep 15, 2026 5/10
app GitHub

Flint: Local-First Asset Manager for Your Personal Skill Library

A local skills hub that centralizes, tags, and deduplicates your AI agent skills, then distributes them to individual agents and project directories by symlink or copy. Skills stay plain files you own rather than entries in someone else's registry. Chinese-language README.

skillslibrarylocal-firstsymlink
by lcy362 Sep 15, 2026 6/10
app GitHub

Due Process Complaint Drafter: IDEA Special Education Filings

A Claude Code plugin that drafts an IDEA special education due process complaint from school documents for any US state, fact-checks every claim against the source documents, and outputs a PDF to file plus a Word file to edit. A narrow but concrete example of a document-grounded legal workflow as a plugin.

legalplugindocument-generationeducation
by b33kman Sep 15, 2026 5/10
app GitHub

AWS Sample: Run Claude Code on 43 Bedrock Models, With HumanEval

An official aws-samples repo for running Claude Code against any foundation model on Amazon Bedrock (43 of them) or a self-hosted model on EC2, bundled with a HumanEval benchmark harness. Lets you measure how the harness performs across models instead of guessing. Useful reference for anyone evaluating model choice for agentic coding.

bedrockawsbenchmarkhumanevalevaluation
by aws-samples Sep 15, 2026 8/10
app GitHub

all-pet: One Desktop Pet That Watches All Your Coding Agents

A desktop pet that monitors Codex, Claude Code, Claude Desktop, DeepSeek Harness, and Grok at once, with a macOS GUI and a cross-platform CLI. The pet's state reflects what your agents are doing, so idle or blocked sessions are visible without checking each terminal. Bilingual Chinese/English.

desktop-petmonitoringmacosmulti-agent
by haverainlilili Sep 15, 2026 6/10
app GitHub

Token-Usage-Dashboard: Dependency-Free Local Usage Explorer

A privacy-first local dashboard for exploring Claude Code and Codex usage across tokens, costs, models, projects, sessions, and billing blocks. It reads exported JSON, runs on the Python standard library, and needs no dependencies, build step, or cloud service. Good choice if you want usage visibility without installing a stack.

tokensdashboardusagepythonprivacy
by Flexible-Universe Sep 15, 2026 7/10
app GitHub

Token Watcher: Real-Time Quota Dashboard Across Seven Agent CLIs

A local real-time token usage and quota dashboard covering Claude Code, ccmr, Codex, ZCode, dsh, WorkBuddy, and Grok Build. Zero-dependency backend, live SSE panel, and a macOS menu bar entry, started with a single npx command. Useful when you split work across several agent CLIs and want one view of what is left.

tokensquotadashboardmacossse
by luwill Sep 15, 2026 6/10
app GitHub

sansheng-tv-adb: Debloat an Android TV Over ADB With an AI Agent

Lets an agent strip bloatware from an Android TV over ADB, with brand-by-brand developer-mode entry instructions, twelve safety gates, and every step reversible. No root required. A good illustration of how to wrap a destructive-by-default operation in gates before handing it to an agent.

adbandroidautomationsafety-gates
by sanshengai Sep 15, 2026 5/10
app GitHub

burnTracker: Track Token Usage Across Claude, OpenAI, and Gemini

A usage tracker that aggregates token consumption across Claude, OpenAI, Gemini, and other providers in one place. Aimed at people who spread work across several model vendors and lose track of the total. Straightforward tool, minimal setup.

tokensusagetrackingmulti-provider
by aminurislamarnob Sep 15, 2026 5/10
app GitHub

snapwatch: Live Side-by-Side Diffs of What Your Agent Is Doing

Watches an agent's changes to your project and streams live side-by-side diffs in the browser, snapshotting into a shadow git repo so your own .git is never touched. Lets you supervise an unattended session without polluting history or fighting over the index. Good fit for long autonomous runs.

diffmonitoringgitsupervision
by llehouerou Sep 15, 2026 7/10
app GitHub

FarAgent: Native TUI for Running Coding Agents Over Plain SSH

Runs Claude Code, Codex, Grok, and Pi on remote machines through a native TUI over plain SSH, with nothing installed on the server. API keys stay on the remote side and sessions survive closing the laptop. Solves the 'agent dies when my connection drops' problem without tmux gymnastics.

sshtuiremotesessions
by mahingbun-dev Sep 15, 2026 7/10
app GitHub

masterwork: A Workbench for Refining and Proving Skills

A local workbench where you browse, edit, and AI-refine agent skills and subagents, then prove they work via scored simulation runs. The scoring turns 'this skill feels better now' into something measurable. Aimed at people maintaining a nontrivial skill library.

skillssubagentsevaluationworkbench
by flieks Sep 15, 2026 7/10
app Reddit

Orbit Code: Open-Source 3D Visual UI for Claude Code Sessions

Draws your workspace as a 3D dependency graph and animates the live session on top of it — MCP calls, skill use, file reads and writes, spawned subagents, git diffs, and thinking all become visible motion rather than scrolling stdio. Includes conventional diff and code views in the same harness. Open source.

uivisualization3dopen-sourcesubagents
by NoEgg2932 Sep 15, 2026 7/10
app GitHub

claude-session-bridge: Durable Message Bridge Between CC Sessions

A file-based bridge that lets long-running Claude Code sessions message each other durably, with a per-session push watcher and a fleet launcher for Windows and Git Bash. Messages persist on disk, so a session that was busy still receives them. Useful for coordinating several agents that outlive any single terminal.

multi-agentipcsessionswindows
by csitte Sep 15, 2026 6/10
app GitHub

bundlebox: Route Work Across Agents and Measure Tokens Saved

Scans, packs, routes, and runs work across Claude Code, Codex, Gemini CLI, Cursor, Aider, OpenCode, and other agents, measuring every token used and saved along the way. The 'zero-token' framing refers to the packing and routing work happening outside the model. Interesting if you are optimizing spend across multiple harnesses.

routingtokensmulti-agentoptimization
by blackswanalpha Sep 15, 2026 5/10
app GitHub

opencode-do: OpenCode's Remote Server on Cloudflare Durable Objects

A demonstration of running OpenCode's remote server on Cloudflare Durable Objects for persistent, low-cost, global-edge command execution and session storage. Shows an alternative to keeping a VPS alive for agent sessions. Reference implementation rather than a product.

cloudflaredurable-objectsopencodeedge
by jarvisAI-droid Sep 15, 2026 5/10
app GitHub

Watch (AgentRelay): Hand Your Session Off When Quota Runs Out

When Claude Code hits its limit, this relays the local session to Codex, OpenCode, Kimi, or Pi while preserving the working directory, with no cloud relay in between. Includes a macOS desktop app with light, dark, and system appearance. Chinese-language README.

session-relayquotamulti-agentmacos
by can4hou6joeng4 Sep 15, 2026 6/10
app GitHub

claude-account-switcher: Fail Over Between Accounts at Rate Limit

Runs several Claude Code accounts side by side and fails over to another when one hits its rate limit, carrying the conversation across the switch. Worth checking against your plan's terms before use. Posted here as an example of the account-juggling tooling appearing since the limit changes.

accountsrate-limitsfailoversessions
by MarwanMaher0 Sep 15, 2026 5/10
app GitHub

powerbi-autopilot: One Request to a Finished Power BI Report

Combines an AI agent, purpose-built 'pilots', and a theme-first PBIP generator to turn a single request into a finished Power BI report, verified in Power BI Desktop. The theme-first ordering means styling is not bolted on at the end. Aimed at analysts who build the same report shapes repeatedly.

powerbireportingdataautomation
by Haweee47 Sep 15, 2026 6/10
app GitHub

tokenledger: One Hub for a Team's Pooled Claude Subscriptions

Tracks how much headroom each of your team's Claude subscriptions has left across every machine, with cross-endpoint usage, per-team cost attribution, a live dashboard, and a read-only MCP server. Turns a pool of individual accounts into something you can actually account for. Aimed at teams rather than solo users.

tokensteamsmcpdashboardcost
by verkyyi Sep 15, 2026 6/10
app GitHub

Agent-Architecture: Visual Multi-Agent Designer in One HTML File

A visual designer for Claude Code multi-agent systems shipping 28 agents, a Five Minds Protocol, human-in-the-loop gates, and live simulation — all in a single HTML file with zero dependencies. You can lay out an agent topology and watch it run before committing to it. Easy to try since there is nothing to install.

multi-agentdesignsimulationhtml
by TheJacksonCode Sep 15, 2026 6/10
app Reddit

Open-Source Platform for Trading Leftover Weekly Usage

Unused weekly quota does not roll over, so this free open-source platform moves it between people: spend a spare week shipping a PR for a priced GitHub issue and earn credit, then spend that credit getting an issue in your own repo fixed during a dry week. Work lands as merged PRs under your own GitHub account. An unusual answer to the limit-reset problem.

usage-limitsopen-sourcecommunitygithub
by Nitjsefnie Sep 15, 2026 5/10
app Reddit

HarnessMark: Benchmark Coding-Agent Harnesses, Not Just Models

Runs the same model on the same coding tasks through different harnesses and compares success rates and costs, so claims about a harness using fewer tokens can be checked against whether it still finishes the work. Includes a minimal reference harness with only shell and edit tools as a baseline. Open source and looking for feedback.

benchmarkharnessevaluationopen-source
by curious_capsuleer Sep 15, 2026 7/10
app GitHub

Jam Plugin: Paste a Bug Recording and Your Agent Reads It

The official Jam plugin for Claude Code, Cursor, GitHub Copilot CLI, and Gemini CLI. Paste a Jam link and the agent pulls the screen recording, console logs, and network requests from the bug report. Removes the step where you manually transcribe repro details into the prompt.

debuggingpluginbug-reportsdevtools
by jamdotdev Sep 15, 2026 7/10
app GitHub

claude-code-statusline: Dependency-Free Node.js Statusline

A Node.js statusline for Claude Code showing model, current task, git state, context window, rate limits, and an Anthropic peak-hours indicator, with no dependencies. The peak-hours signal is an unusual addition given how much limits have been discussed lately. Drop-in for anyone who wants more than the default line.

statuslinenodejsrate-limitsgit
by ilia-pluzhnikov Sep 15, 2026 7/10
app GitHub

LiveClaude: Keep Claude Code Remote Control Alive on Windows

A C# supervisor — running as a Windows service or scheduled task — plus a desktop app with an embedded terminal, built to keep Claude Code Remote Control sessions from dying. Addresses the recurring complaint about /rc sessions dropping when idle. Entirely C#, no Node or Python dependency.

windowsremote-controlcsharpsupervisor
by LeandroCannizzaro Sep 15, 2026 6/10
app GitHub

home-office: Multi-Agent Harness With a Pixel-Art Office View

A local multi-agent coding harness where agents work your repositories inside isolated Docker sandboxes, visualized as a pixel-art office. The sandboxing is the substance; the office is a legible way to see who is working on what. Good middle ground between raw parallel terminals and a full platform.

multi-agentdockersandboxvisualization
by misaon Sep 15, 2026 7/10
app GitHub

seerr-bot: Discord Bot for Seerr Media Requests Using the Anthropic SDK

A Discord bot that handles Seerr media requests, built on the Anthropic SDK. Natural-language requests in Discord become Seerr actions. Small, focused example of the SDK used for a chat-fronted service rather than a coding agent.

discordanthropic-sdkbotmedia
by s0up4200 Sep 15, 2026 5/10
app GitHub

relay-dev: Native macOS Workspace Manager for AI CLI Agents

A keyboard-driven macOS window holding projects, terminal sessions, AI CLI agents, dev services, Docker, and SSH together. Sessions run in a background daemon and survive quitting the app, so agents keep working after you close the window. Aimed at replacing a screenful of tmux panes.

macosworkspaceterminaldaemon
by maketryuk Sep 15, 2026 6/10
app Reddit

Claude Usage: Tray App That Hands You the Raw Limits JSON

Sits in the tray, periodically reads your current usage and limits, then writes Anthropic's payload verbatim to a file, POSTs it to a URL, or both. Because the JSON is unmodified, anything that reads a file or listens on HTTP — your own dashboard, a webhook, Home Assistant, a cron script — can display your limits. No API key needed, multiple accounts supported.

usage-limitstraywebhookjsonmonitoring
by Silver-Wong Sep 15, 2026 6/10
app GitHub

whalegirl-deskpet: Desktop Pet for dsh and Claude Code

A whale-girl desktop pet with both a dsh and a Claude Code (PetPet) version. Idle animation is baked from a layered PSD; the remaining motions are AI video converted to sprite sequences. Chinese-language README.

desktop-petanimationui
by wei125775-lab Sep 15, 2026 5/10
app GitHub

slidesmith: Static Deck In, Animation Code Out, Human Decides

Takes a static slide deck and produces animation code, with the machine checking output against fixed guardrails while the final call stays with a person. The author is explicit that this is a demo merging ideas from two production pipelines, not a finished product. Worth reading as a guardrail-plus-human-gate pattern.

slidesanimationguardrailsdemo
by shwemahendran Sep 15, 2026 5/10
app GitHub

AgentDock: Local-First Control Plane for Multi-Runtime Agents

A local-first control plane giving multi-runtime AI agents isolated Environments and auditable Runs, with a CLI, HTTP API, and Node.js SDK. The audit trail on every run is the differentiator over just launching agents in terminals. Bilingual English/Chinese.

control-planemulti-agentsdkauditlocal-first
by parkerluxu Sep 15, 2026 6/10
app GitHub

claude-code-usage: Live Usage in the VS Code Status Bar

Shows Claude Code usage in the VS Code status bar with a 5-hour block meter, weekly limit, and per-model and per-session breakdown. Keeps the limit picture in the editor instead of a separate window. Good fit if you drive Claude Code from the VS Code extension.

vscodeusage-limitsstatusbartokens
by mehrshaad Sep 15, 2026 6/10
app GitHub

agentic-imodels: Agent-Interpretable Data Science Tools

Interpretable machine learning tooling designed for agents to use and reason about, evolved through autoresearch. Comes from the imodels lineage of interpretable modeling. Niche, but a genuine research angle on agent-usable data science.

data-scienceinterpretabilityresearchml
by csinva Sep 15, 2026 5/10
app GitHub

Cockpit explorer: File Manager With Claude and Codex CLI Tabs

A Cockpit plugin turning the web console into a full file manager — browse, edit, preview, search, terminals, and Git — with integrated Claude and Codex CLI tabs showing a live git diff, plus fstab/mounts, SMB and NFS shares, and a GRUB editor. Brings agent-assisted work into server administration. Useful for homelab and small-fleet admins.

cockpitsysadminfile-managergitlinux
by ismetozalp Sep 15, 2026 6/10
app GitHub

Vibespace: Terminal Grid and Kanban Board That Dispatches Agents

An open-source agentic development environment running Claude Code, cursor-agent, Codex, and plain shells side by side in a terminal grid, with a kanban board that dispatches work to them, shared agent memory, and multi-agent orchestration. The kanban-as-dispatcher idea gives parallel agents a single queue. Open source.

multi-agentkanbanterminalorchestrationmemory
by hharsha98 Sep 15, 2026 6/10
app GitHub

SVDO Meter: Open-Source Telemetry and Eval Layer for Coding Agents

Measures execution, token usage, cost, sessions, tooling behavior, and repository alignment across Codex, Claude Code, and other agents. 'Repository alignment' is the interesting metric — whether the agent's work actually matches the repo's conventions. Open source telemetry rather than a vendor dashboard.

telemetryevaluationtokenscostopen-source
by brianofrokk3r Sep 15, 2026 6/10
app Reddit

Plugin That Lets Agents Generate Explainer Videos for Handoffs

Aimed at the context-switching cost of running multiple agents: one dumps logs, another rewrites the plan, a third found the bug three messages ago. This plugin lets them show you the bug, the flow, or the change as a video instead. Example uses include a daily Sentry bug summary and a standup recap of the last day's work. Open source.

videoplugincontext-switchingopen-source
by Competitive_Dust7395 Sep 15, 2026 6/10
app GitHub

d.sh: A Minimal Agent Harness in a Single Bash File

An entire agent harness in one Bash file with a one-line quick start, designed to act as a bootloader agent on bare-metal servers. Being a single script means it runs anywhere you have a shell, before any toolchain is installed. Useful as a readable reference for what a harness minimally needs.

harnessbashminimalbootstrap
by SiriusNEO Sep 15, 2026 6/10
app Reddit

Maestro: A Dashboard for When Four Parallel Sessions Stop Being Fun

Three parallel sessions are manageable; the fourth breaks the mental map — one is blocked on a permission prompt, one finished twenty minutes ago unnoticed, one is silent and you cannot tell if it is thinking or dead. Maestro gives an overview, a session grid, and a control panel over all of them. Free with no paid tier, built in-house by a dev shop.

multi-agentdashboardsessionsmonitoring
by Pakoxtror Sep 15, 2026 6/10
app GitHub

hotpl8: Local Quota Dashboard for Claude and Codex (Windows Preview)

A local dashboard showing your Claude and Codex usage quotas in one place. Monitor-only by default, so it reads state without touching your sessions. Currently a Windows preview, which fills a gap since most quota trackers assume macOS or Linux.

quotadashboardmonitoringwindows
by Mmore35 Sep 15, 2026 6/10
app GitHub

bridge: Give Your Coding Agents a Phone Number via a macOS Daemon and CLI

An open-source macOS daemon and companion CLI that attaches a phone number to your coding agents, so long-running sessions can reach you over SMS instead of requiring you to sit and watch a terminal. Useful for approval prompts and completion notices on unattended runs. Open source, unlike most agent-notification services.

notificationsmacoscliremote-control
by pagrdev Sep 15, 2026 7/10
app GitHub

skillbundle: Compare AI Coding Skills and Save Them as Stack Bundles

A discovery tool for AI coding assistant skills that lets you compare candidates side by side and then save a chosen set as a reusable bundle for your stack. Solves the practical problem that skill catalogs are large and most entries are near-duplicates. Bundles mean a new project starts from your curated set rather than a blank skills directory.

skillsdiscoverybundlescatalog
by joncoronel Sep 15, 2026 6/10
app GitHub

skills-hub: Desktop App to Install Agent Skills Once and Sync Everywhere

A cross-platform desktop app that manages all your Agent Skills in one place and syncs them into the global skills directories of multiple AI coding tools. The pitch is 'install once, sync everywhere', which removes the manual copying you otherwise do whenever you switch between Claude Code, Codex, and friends. Worth a look if you maintain the same skill set across several tools.

skillssyncdesktopmanagement
by qufei1993 Sep 15, 2026 7/10
app GitHub

lex: Your Neovim Code Remembers the AI Conversations That Touched It

lex anchors AI conversations to the place in the code they were about, so opening a file later surfaces the discussions that shaped it. It works inside Neovim and supports Claude Code, Codex, and OpenCode. A direct answer to losing the reasoning behind a change once the session ends.

neovimmemorycontextopencode
by lukaskellerstein Sep 15, 2026 7/10
app GitHub

TokenPulse: Local-First Token Monitor for Claude Code and Other CLIs

TokenPulse is a zero-config Windows dashboard (v0.1) showing real-time token consumption, spend trends, and cost estimates across Claude Code, Codex, Gemini CLI, Qwen, and ZCode. Everything stays on your machine — no data leaves the host. Notable for covering multiple agent CLIs in one view and for being one of the few Windows-first trackers.

tokensmonitoringwindowslocal-first
by Alan-Houxj Sep 15, 2026 6/10
app GitHub

boris-cherny-claude-code-playbook: 132 Claude Code Tips, in German

A curated German-language collection of 132 Claude Code tips attributed to Boris Cherny, auto-updated two to three times daily, with a visual dashboard offering filters and a timeline. It also ships a one-shot implementation guide that configures Claude Code from the tips. Worth a look for German-speaking teams or anyone wanting the tips in one browsable place.

tipsdocumentationgermansetup
by SKZL-AI Sep 15, 2026 6/10
app GitHub

burn-token-burn: Read-Only Token Usage and Budget Runway Tracker

A local-first, read-only tracker that reports token usage for AI coding agents and projects how much budget runway you have left. Read-only by design means it never touches your agent's state. Useful if you care about when the budget runs out, not just what you have spent so far.

tokensbudgetmonitoringlocal-first
by qvest-ssels Sep 15, 2026 6/10
app GitHub

orbit-code: A Live 3D Visual Alternative to the Claude Code Terminal

orbit-code replaces the terminal view with a live 3D visualization of what the agent is doing, shipping as both a VS Code extension and a desktop app. Open source, and aimed at programmers and vibe coders alike. The most visually ambitious take on the Claude Code UI problem so far.

uivisualizationvscodedesktop
by imshaikot Sep 15, 2026 7/10
app GitHub

agent-wrapped: A Local-First Wrapped Card for Your Claude Code Habits

Generates a Spotify-Wrapped-style card summarizing how you actually work with Claude Code, built entirely from local transcripts. Nothing leaves your machine. One of several wrapped-card tools around, but this one commits hard to the local-first constraint.

statstranscriptslocal-firstvisualization
by lfgcampos Sep 15, 2026 5/10
app GitHub

skills-telemetry: Attribute Token Cost and Outcomes to Individual Skills

Measures which of your standards-as-skills actually earn their keep by attributing token cost and outcomes to each skill across Claude Code and GitHub Copilot. It records metadata only, never content. The point is making keep/refine/deprecate calls on evidence rather than vibes — valuable once your skill library gets large enough to be unclear.

telemetryskillstokensmeasurement
by amiable-dev Sep 15, 2026 7/10
app GitHub

amber: A Clean Web-Based Claude Code Clone

Amber is a simple, web-based clone of Claude Code, available at amberagent.dev. It aims at a clean uncluttered interface rather than replicating every terminal feature. Worth trying if you want agent coding in a browser tab.

webuicloneagent
by tpolasek Sep 15, 2026 6/10
app GitHub

domux: Open-Source Terminal Multiplexer for AI Coding Agents

domux is a terminal multiplexer built specifically for running AI coding agents, rather than a general-purpose tmux replacement. It gives each agent its own pane and keeps parallel sessions manageable. Open source and focused — useful once you routinely run more than two agents at once.

multiplexerterminalparallelopen-source
by pranav7 Sep 15, 2026 7/10
app Reddit

lookbook: Pick a Visual Direction Before Claude Code Writes Any UI Code

Built by a user tired of every generated site looking identical — purple gradient, Inter, three feature cards. A browser-based selector runs before any code is written: choose a style, set an accent color, upload screenshots of sites you like, and add your own rules, producing a .claude/branding.json everything downstream follows. The reference-image upload is the strongest part, since a screenshot rules out default archetypes better than paragraphs of description. Pure Python standard library, runs locally.

uidesignbrandingfrontend
by rethoric Sep 15, 2026 7/10
app GitHub

Ultron Control Center: desktop cockpit for Claude Code memory and agents

A Tauri 2 + React 19 + Rust desktop app that acts as a control cockpit for Claude Code. It provides governed memory, an AI router, and orchestration for skills and agents, installable component by component. Useful if you want a GUI layer over your Claude Code setup instead of managing config files by hand.

taurirustreactmemoryorchestrationdesktop
by SkiTemplar Sep 14, 2026 7/10
app GitHub

chiltepin: agent-written docs that CI can actually verify

A documentation toolchain where agents write Markdown with typed YAML blocks, and the renderer (not the model) produces diagrams, API docs, ADRs, and slides. Because the blocks are typed, CI can validate them, so docs fail the build instead of silently rotting. Aimed at keeping AI-generated documentation correct rather than merely plausible.

documentationciyamladrdiagramsvalidation
by jdiejim Sep 14, 2026 7/10
app GitHub

Claude-pet: A Desktop Pet That Types While Your Agent Works

A desktop companion wired into Claude Code hooks so it visibly types while the agent iterates and pops a speech bubble when the run finishes. Avatars are pluggable, so you can swap in your own character art. Useful as an ambient signal that a long session is still running without watching the terminal.

desktop-pethooksstatusambient
by DecoudJuan Sep 14, 2026 6/10
app GitHub

claude-pulse: Usage HUD With Statusline Segment and Web Dashboard

A cross-platform usage heads-up display that tracks both the 5-hour and weekly limit windows and shows reset countdowns. It ships a fetcher, a Claude Code statusline segment, and a GitHub Pages dashboard for the longer view. Aimed at people who keep hitting plan limits mid-week and want to see the burn rate before it bites.

usagestatuslinelimitsdashboard
by hasuwini77 Sep 14, 2026 7/10
app GitHub

codebuddy-proxy: Rust Anthropic API Proxy for CodeBuddy Models

A Rust proxy that speaks the Anthropic Messages API and forwards to CodeBuddy, tuned for Claude Code as the client and deepseek-v4.1-flash as the backing model. Lets you point Claude Code at a non-Anthropic model without changing the client. Niche, but relevant if you are spreading work across providers to stretch limits.

proxyrustapimodel-routing
by jacek4yang Sep 14, 2026 5/10
app GitHub

cc-audit: Static Security Scanner for Skills, Hooks and MCP Configs

A deterministic, AI-free scanner that inspects Claude Code artifacts — skills, hooks, and MCP server configs — for data exfiltration paths, prompt injection, and supply chain risks. Because it is static analysis rather than a model call, results are reproducible and cheap to run in CI. A sensible gate before installing third-party skills or plugins.

securitystatic-analysisskillsmcpsupply-chain
by ryo-ebata Sep 14, 2026 8/10
app GitHub

ia_workspaces: A Workspace Terminal That Tells You When an Agent Waits

A cross-platform terminal organized around projects as vertical tabs, where any tab splits into panes that can be a shell, editor, file tree, diff, git history, browser, or image board. It explains git operations in plain English and surfaces when a coding agent is blocked waiting on your input. Aimed at people juggling several agent sessions at once.

terminalworkspacegitmulti-agent
by aombk Sep 14, 2026 6/10
app Reddit

T.R.A.C.E.: Browser IDE for Running Claude Agents in Remote Containers

Terminal for Remote Agents in a Contained Environment — a browser-based IDE built on an xterm.js SSH client, where the server owns every terminal process so sessions survive closing the tab. It streams a real neovim over WebSocket with themes injected to match, plus a command palette and OnlyOffice integration. Built for people who work exclusively over SSH in remote containers and want agent harnesses living there too.

remote-devterminalsshneovimcontainers
by pancakesausagestick Sep 14, 2026 6/10
app Reddit

DGV adds C4 and Structurizr DSL export for architecture diagrams

DGV, a diagram-as-code viewer, can now write its working model out as Structurizr DSL via `dgv export --format structurizr`, and the viewer grew a C4 button. Nodes become containers, frames become groups, modules become components, and externals sit outside the system, with output validated against the Structurizr CLI on every example. Useful if you keep architecture diagrams in the repo and want C4 tooling to read the same file.

diagramsc4structurizrarchitecture
by Training_Ostrich_660 Sep 14, 2026 6/10
app Reddit

Overflow: a mutual-credit ledger for unused weekly Claude capacity

A shared ledger built on GitHub issues and pull requests. A repo owner prices an issue with a 1-10 label, someone with spare weekly capacity claims it and ships the closing PR, and the merge settles: contributor credited, owner debited. Credit earned in one tracker spends in any other registered one, with review rounds subtracting from the credit so a sloppy PR costs the contributor. No money and no token involved — the pitch is that capacity you would otherwise waste before a reset fixes someone else's backlog.

githubcollaborationusage-limitsopen-source
by Nitjsefnie Sep 14, 2026 6/10
app Reddit

Open-source 'Brains': shared project context across Claude Code and Codex

A desktop app that builds a knowledge graph of your codebases and auto-manages the resulting context as docs and skill files. Each project gets a Brain that any coding agent can read, so switching tools does not mean re-explaining the project from scratch. Positioned as an open-source take on Cursor's Projects feature.

contextknowledge-graphdesktop-appopen-source
by BearInevitable3883 Sep 14, 2026 5/10
app Reddit

PicHaven: phone-to-PC photo backup built solo with Claude Code

Three codebases from one person over a summer — a Rust core for the PC side, a Tauri 2 tray app on Windows, and a Kotlin/Compose Android app. Phone and PC pair by QR code and talk mTLS with pinned fingerprints, so new photos land on your own machine as original files sorted by year and month, and nothing is ever deleted. The write-up focuses on the testing discipline that made a three-codebase solo project survive a closed beta.

built-with-clauderusttauriandroid
by Zitroni Sep 14, 2026 6/10
app Reddit

Motioneer: a local motion studio you direct from Claude Code

Captures website elements and assembles them into an editable local timeline you direct conversationally — 'keep this transition', 'give the product elements more movement', 'simplify the ending' — through Claude Code or Codex. Demo films are built from Notion's and Figma's own typography, colors and graphics with original soundtracks. The result stays editable in the local editor instead of being a one-shot render.

motion-graphicsvideocreativelocal-first
by Sea-Assignment6371 Sep 14, 2026 6/10
app Reddit

bough: search and visualize your Claude Code prompt history

A prompt-history visualizer updated after community feedback. It now does full-text search across everything you have typed (you rarely recall the exact sentence, but usually two words of it), shows which prompts actually ended in a commit, and nests sub-agent work inside the prompt that dispatched it instead of floating it off separately.

visualizationsessionshistoryopen-source
by VoidEqualZero Sep 14, 2026 6/10
app Reddit

discord-threads: one Claude Code session per Discord thread

A daemon that maps each Discord thread to its own Claude Code session with its own memory, so posting in a channel opens a thread and a second thread is a fully separate task running in parallel. Built because the official Discord plugin sometimes dropped replies and shared a single conversation across everything. Lets you keep handing an agent work from a phone.

discordremotemobiledaemon
by killer_z3 Sep 14, 2026 7/10
app Reddit

agi-mem: one local memory store shared by Claude Code, Cursor and Codex

A memory store for coding agents with four deliberate constraints: cross-agent, so a decision made in one tool is known to the others; local, as plain SQLite on your disk; zero dependencies, using only the Python stdlib with no vector DB or daemon; and git sync, so your memory is a repo you own and can diff or delete. Free and open source.

memorycross-agentlocal-firstsqlite
by Rude_Gate7599 Sep 14, 2026 6/10
app Reddit

Does Claude Code need a persistent map of the codebase?

A discussion of how much session time goes into re-deriving things the agent already worked out — where things live, what calls what, how a system is structured — and why CLAUDE.md only partly covers it once a repo gets large. The author works on Ix, an open-source project that builds a persistent graph of a codebase and lets Claude query it.

contextcodebaseknowledge-graphdiscussion
by PlusLoquat1482 Sep 14, 2026 5/10
app GitHub

agent2learn: a local, source-cited course vault for AI agents

Stores course material locally so an agent can teach from it with citations back to the original source. Aimed at keeping agent-delivered learning grounded in a vault you control rather than in model recall.

learninglocal-firstragagents
by ManagementMO Sep 14, 2026 5/10
app GitHub

zeloryn: a local-first Kanban cockpit for terminal coding agents

A free, open-source software engineering cockpit that wraps terminal-capable AI coding agents in Kanban-style task execution. Tasks move across a board as the agent works them, giving you a visible queue instead of a single chat session. Local-first, with no hosted service in the loop.

kanbanlocal-firstopen-sourcetask-management
by yassin-kryleos Sep 14, 2026 7/10
app GitHub

lgtm: a fast Zig TUI for reading agent-written code with vim motions

A terminal reviewer built for the moment just before you approve an agent's diff. Written in Zig for speed and driven with vim motions, it targets the habit of rubber-stamping changes you have not actually read.

code-reviewtuizigvim
by kunkka19xx Sep 14, 2026 7/10
app GitHub

moshpit: SSH, Mosh and tmux on iOS, built for remote coding agents

An iPhone and iPad terminal for driving coding agents on remote machines, using Mosh so connections survive network changes. Its Vibe Island feature puts the agent's current status on the Lock Screen, so you can tell whether it is working or blocked without opening the app.

iosmoshtmuxremote
by Cluas Sep 14, 2026 7/10
app GitHub

telltales: daemon-backed status-line instrument panels for CLI agents

Replaces the usual one-line status with a daemon-driven instrument panel, so state that is expensive to compute is gathered out of band rather than on every status refresh. telltale-clawd covers Claude Code today, with a Codex variant planned.

statuslinedaemonmonitoringcli
by hoohugokim Sep 14, 2026 6/10
app GitHub

agent-long-task-monitor: stop burning tokens polling long local jobs

Long-running local jobs make agents poll in a loop, and every poll costs a turn and a slice of context. This monitor watches the job out of band and hands the agent a result when there is one, replacing repeated check-and-wait cycles.

token-efficiencymonitoringbackground-jobscli
by Feiyue222 Sep 14, 2026 6/10
app GitHub

IWE: an IDE for thinking built on top of Claude Code

An Intellectual Work Environment layering protocols, AI-agent roles, memory and knowledge formalization over Claude Code. Aimed at structured thinking and knowledge work rather than at writing code.

knowledge-workmemoryagent-roleside
by iwesys Sep 14, 2026 6/10
app GitHub

bivy: run Claude Code on your own machines from phone or browser

An open-source, self-hostable control plane for running Claude Code, Codex and other coding agents on hardware you own, reachable from a phone, a browser or an automation. Keeps the work on your machines rather than someone else's.

self-hostedremotemobileopen-source
by bivysh Sep 14, 2026 7/10
app GitHub

MemoryGuard: keep CLAUDE.md and AGENTS.md current and secret-safe

Local-first context sync that keeps AGENTS.md, CLAUDE.md, MEMORY.md and Cursor rules up to date as the project changes, while checking that secrets do not end up committed inside agent context files.

claude-mdcontextsecretslocal-first
by atharvmantri Sep 14, 2026 6/10
app GitHub

claude-runway: will your Claude allowance last until the reset?

Reports how much of your subscription allowance is left and, more usefully, projects whether it will survive to the next reset at your current burn rate. Aimed squarely at the weekly-limit anxiety dominating the community right now.

usagequotaclimonitoring
by tenex-hq Sep 14, 2026 7/10
app GitHub

tviz: see where a session's context window went, call by call

A browser-only visualizer for Claude Code transcripts that breaks context consumption down per tool call. Nothing to install and nothing leaves the page, which makes it easy to find the one tool result that ate half the window.

contextvisualizationtranscriptsdebugging
by wyattjoh Sep 14, 2026 7/10
app GitHub

vibe-pulse: a native Windows traffic light for session state

A small native Windows monitor showing Qoder and Claude Code session status as a traffic light, so you can tell at a glance whether an agent is working, blocked or finished. Docs in Chinese.

windowsmonitoringstatuslinechinese
by lun3322 Sep 14, 2026 5/10
app GitHub

omnicache-proxy: a semantic caching gateway for LLM API costs

A caching and cost-optimization gateway in front of OpenAI and Anthropic APIs that uses semantic matching to serve repeated work from cache, claiming 40-75% bill reduction. The headline numbers are the author's own and unverified.

cachingcostgatewayapi
by 13manmayarai-hash Sep 14, 2026 5/10
app GitHub

claude-status: Claude Code state in your tmux status bar

Shows whether Claude Code is working, blocked or done directly in the tmux status bar, so a session waiting on input does not sit idle in a pane you are not looking at.

tmuxstatuslinemonitoringcli
by stefanahman Sep 14, 2026 6/10
app GitHub

kortext: turn a brief into approved analysis docs before any code

A local-first project brain that takes a brief through to approved analysis documents, then hands those to whichever agent CLI you use — Claude, Codex or another — to write the code. Holds no API key of its own.

planningspecslocal-firstdocs
by erayendes Sep 14, 2026 6/10
app GitHub

vibetime: track what you actually ship with AI, with no account

Measures your real output from AI-assisted work with no config, no daemon and no account by default — a counterweight to tracking tools that want a signup before they tell you anything.

trackingmetricslocal-firstcli
by iamnotstatic Sep 14, 2026 6/10
app GitHub

serverjack: your tmux sessions and coding agents, from your phone

A single Python file with no Node and no sudo that exposes tmux sessions and the agents running in them to a phone browser. Appealing precisely because there is almost nothing to install or trust.

tmuxmobilepythonremote
by jackgillette006 Sep 14, 2026 6/10
app GitHub

rhost: remote execution for agents with local-like process semantics

Runs commands on a remote host over OpenSSH while preserving the process semantics an agent expects locally — exit codes, streams and signals — so remote execution needs no special handling on the agent side.

sshremoteexecutioncli
by starfield17 Sep 14, 2026 6/10
app GitHub

tipee-tools: Claude Plugin for Tipee HR Data

A Claude plugin that connects to the Tipee HR platform so Claude can read and modify employees, teams, shifts, absences, on-calls, activities, and time-clock entries. Aimed at teams who would rather run HR admin conversationally than click through the Tipee UI. Niche, but a clean example of wiring a business SaaS into Claude.

pluginhrintegrationsaas
by Floriferous Sep 14, 2026 5/10
app GitHub

quartermaster: Offline Quota Check Across Every Agent Account

A CLI that reports remaining quota across all your agent accounts: every Claude Code profile on the machine rather than just the default one, plus Codex and the opencode providers. It reads local state only, with no network calls and no credentials required. Spanish-language README.

quotacliusage-limitsmulti-account
by legiosai Sep 14, 2026 6/10
app GitHub

zai-quota-statusline: Z.AI and GLM Quota in the Claude Code Statusline

A statusline showing real-time 5-hour and 7-day Z.AI/GLM limits, styled to match Claude's own palette. Updates are driven by Claude Code hooks rather than cron or polling, so nothing runs in the background. For anyone pointing Claude Code at GLM models.

statuslinequotaglmhooks
by moriarthur Sep 14, 2026 6/10
app GitHub

skillsonar: Detect Routing Collisions Between Agent Skill Files

A static analyzer that scans skill files and flags routing collisions, where two skills claim overlapping triggers and the agent may load the wrong one. It runs offline and deterministically in milliseconds, so it fits in a pre-commit hook or CI. Increasingly relevant once a skill library grows past a handful of entries.

skillsstatic-analysislintingtooling
by corticalepilepsyladyofthehouse956 Sep 14, 2026 7/10
app GitHub

ai-secret-scout: Scan and Redact Secrets in AI Assistant Histories

A zero-dependency heuristic scanner that finds leaked credentials inside the local transcript history of AI coding assistants, then redacts them. Covers Claude Code, Antigravity, Codex, Copilot, and Cursor. Worth a run if you have ever pasted a key into a session.

securitysecretsredactionprivacy
by DevRedious Sep 14, 2026 7/10
app GitHub

Jarhead: Voice-First Mac Assistant That Drives Coding Agents

A Mac assistant with full-duplex voice behind an on-device wake word and Touch ID, backed by vendor-neutral brains including Claude Code and Codex. It adds native Swift automation, a console into every coding-agent session, and the ability to rewrite itself in a worktree once you approve. Ambitious and unusual in scope.

voicemacosassistantorchestration
by Kevin-Liu-01 Sep 14, 2026 6/10
app GitHub

grok-bridge: One CLI for Task Handoffs Between Coding Agents

An experimental CLI that passes tasks between Grok Bot, Codex, Claude Code, Cursor, and Antigravity. The idea is to hand work to whichever agent suits it without re-explaining the context each time. Early stage.

climulti-agenthandoffinterop
by niharnm Sep 14, 2026 5/10
app GitHub

seisin: OS-Enforced Permission Layer for AI Coding Agents

Gives agents role-scoped folders and keys with the boundaries enforced by the operating system rather than by prompt instructions. When something is blocked it reports whose file the agent reached for, so the failure is diagnosable instead of mysterious.

securitypermissionssandboxingagents
by carlostapiaolguin3-stack Sep 14, 2026 7/10
app GitHub

agctl: Multi-Account Manager for Claude Code, Codex, and Copilot

Manages several agent accounts from one CLI: per-account usage limits, switching between them, and isolated sessions so state does not leak across profiles. Covers Claude Code, Codex, Cursor, and Copilot.

climulti-accountusage-limitssessions
by zchee Sep 14, 2026 6/10
app GitHub

baron: Local-First Agent Orchestrator With Worktrees and a Test Gate

A terminal UI that runs coding agents in isolated git worktrees, puts a real build/lint/test gate in front of every change, and auto-merges only when policy allows. Local-first, so no hosted service is needed to coordinate the work.

orchestrationtuiworktreesci
by ykocaman Sep 14, 2026 7/10
app GitHub

perch: Run Claude Code Under Any Account Without the Login Flow

Switches Claude Code between accounts directly, skipping the interactive login each time. Useful if you juggle a personal and a work subscription, or several profiles on one machine.

cliaccountsauthenticationworkflow
by perch-cli Sep 14, 2026 6/10
app GitHub

AgentStreamDeck: Stream Deck Mini as Mission Control for Agents

Turns a Stream Deck Mini into a monitor for six concurrent coding-agent sessions, with live status on each key and one-touch window switching. Ships adapters for OpenCode, Claude Code, GitHub Copilot, Gemini CLI, and Cursor CLI.

streamdeckmonitoringhardwaremulti-agent
by darkmatter2222 Sep 14, 2026 7/10
app GitHub

anotador-ui: Annotate a Running UI and Send Precise Change Requests

Lets you mark up an app's interface while it runs and hand those annotations to a coding agent, Claude Code, Codex, or Gemini, as specific change requests, with a two-way conversation back from the agent. Portuguese-language README.

uiannotationfrontendfeedback
by edinaldoof Sep 14, 2026 6/10
app GitHub

claude-atlas: Run Obsidian Knowledge Wikis With Claude Code

Uses Claude Code to maintain Obsidian wikis: ingesting new sources, prioritizing what to tackle next, and catching items that would otherwise slip. Inspired by Karpathy's LLM-wiki idea, and built to handle several vaults at once.

obsidianknowledge-basenotesautomation
by nathanaday Sep 14, 2026 6/10
app GitHub

coding-agent-internals: How 12 Coding Agents Actually Implement Tools

A deep 2026 comparison of twelve AI coding agents focused on tool implementation rather than feature checklists: how each one does file editing, search, shell execution, and context handling. Covers Claude Code, Codex, omp, Hermes, Aider, Cursor, and more. Good reading if you are building a harness of your own.

comparisoninternalsresearchagents
by alloevil Sep 14, 2026 8/10
app GitHub

flywheel: Frontier Leads Plan, Cheap Workers Build, Everything Audited

A Go factory for coding agents: frontier models plan and inspect while cheaper OpenCode workers do the building, with every unit measured, audited, and traceable. Control and data planes are deterministic, so the orchestration itself is not left to model judgement.

orchestrationgolangmulti-agentcost-optimization
by suzworx Sep 14, 2026 7/10
app Reddit

airoom: A Pixel Office Showing Every Claude Code Session at a Glance

Reads your Claude Code sessions off local disk and draws them as a pixel-art office, one room per project and one robot per session. Color codes status as working, waiting on you, blocked, or idle. Click a desk to open the conversation, send a follow-up, queue a message, or stop a run.

monitoringsessionsuimulti-agent
by CommercialGift9237 Sep 14, 2026 7/10
app GitHub

mneme: Deterministic Guardrails Against Architectural Drift

Open-source tooling that keeps coding agents aligned with a repository's existing architecture, using deterministic guardrails rather than prompt reminders. Targets the slow drift that accumulates when many agent-written changes each look reasonable on their own.

architectureguardrailsqualityopen-source
by MnemeHQ Sep 14, 2026 6/10
app GitHub

bitrouter: Context-Aware Model Router That Learns Your Workflows

Routes each step of a long-horizon coding task to an appropriate model, adapting based on what your workflows actually look like over time. Lightweight and extensible, and deliberately agnostic about harness, model, and loop structure.

routingmodelscost-optimizationorchestration
by bitrouter Sep 14, 2026 6/10
app GitHub

prompt-to-asset: Generate Icons, Favicons, and Logos From Prompts

Generates icons, favicons, logos, and platform-specific asset sets from text prompts using free inference providers, callable from the CLI or from an AI coding assistant. Handles the tedious export-size matrix that app and web projects need.

assetsiconsclidesign
by lightsomenessvandyke9074 Sep 14, 2026 5/10
app GitHub

pockode: Control Claude Code and Codex From Your Phone

A mobile interface to a coding agent running on your own machine, covering Claude Code and Codex. Lets you check on a session, answer a prompt, or kick off work while away from the desk.

mobileremotesessionscodex
by sijiaoh Sep 14, 2026 7/10
app GitHub

ai-chat-cleaner: Interactive TUI for Pruning AI Chat History

A terminal UI for reviewing and deleting accumulated AI chat sessions. Straightforward housekeeping for anyone whose local history has grown large enough to be worth trimming.

tuicleanuphistorycli
by jinghaihan Sep 14, 2026 5/10
app GitHub

agent-statusline: Ten Labelled Rows of Claude Code Telemetry

A dense, width-aware Claude Code statusline showing context usage, rate limits, prompt-cache economics, cost history, and machine pressure across ten labelled rows. It adapts to terminal width rather than truncating, so the whole picture stays readable.

statuslinemonitoringcontextrate-limits
by nachiketbhujbal Sep 14, 2026 6/10
app GitHub

prompt-link: Turn Any Text Into a Ready-to-Open Prompt Link

Converts text into a prompt link for Claude, ChatGPT, Perplexity, or Grok, checks it against the 7500-character limit, shortens it, and returns the finished link. Handy for sharing a prompt that someone can open directly in their own assistant. Portuguese-language README.

promptssharinglinksportuguese
by marioluciofjr Sep 14, 2026 5/10
app GitHub

shiyi: local-first macOS console for Claude Code and Codex sessions

A macOS desktop app that shows AI coding sessions as they run, searches your full session history, and restores any past session in one click. It also gives Claude Code and Codex a single place to manage skills, rules, MCP servers, agents, commands, and hooks. Everything stays local.

macossession-managementcodexskillsmcp
by wp763691 Sep 13, 2026 7/10
app GitHub

forgeterm: runtime guardrails that watch what your coding agent does

Monitors AI coding agents while they run and blocks file access, network connections, and shell commands that fall outside policy, with system resource limits on top. Aimed at people who want to let an agent run unattended without handing it the whole machine.

securitysandboxmonitoringguardrailsagents
by Lavenderustilagomaydis9432 Sep 13, 2026 7/10
app GitHub

engram-cli: a Rust CLI giving agents persistent local memory

A local memory store for AI agents written in Rust, using hybrid retrieval to combine keyword and semantic search. It runs fully offline, so you can build a knowledge base agents query across sessions without sending anything to a service.

memoryrustcliofflineretrieval
by Mohdar1277 Sep 13, 2026 6/10
app GitHub

VocsCode: one desktop app for every coding agent harness

A desktop client that lets you pick which coding-agent harness to use per session, and any model that harness can reach. Useful if you switch between Claude Code, Codex, and others rather than committing to one.

desktopmulti-agentharnesscodexgui
by vocsong Sep 13, 2026 6/10
app GitHub

chromium-profile-migrator: move browser profiles, agent-readable output

Inspects, compares, and migrates Chromium-family browser profile configuration: extensions, shortcuts, and allowlisted settings. Dry-run by default with hash-verified backup and rollback, and it emits JSON an agent can act on.

chromiummigrationjsonclibrowser
by arkaigrowth Sep 13, 2026 5/10
app Reddit

CliDeck V2: agent-to-agent tasking and live previews in a CLI TUI

The second version of CliDeck adds projects, live session status, and collaboration across CLI providers. Agents can now hand tasks to each other and talk inside the TUI so you see the traffic between them, and their output — docs, HTML, images, video — previews automatically. Open source.

tuimulti-agentdashboardopen-sourcecli
by Oren_Lester Sep 13, 2026 6/10
app GitHub

claude-code-statusline: real plan usage plus context window in one line

A Claude Code status line showing your actual plan consumption — both the 5-hour block and the weekly limit — alongside current context window usage. Ships in both bash and PowerShell so it works on Windows as well as Unix.

statuslineusagelimitsbashpowershell
by regisdias Sep 13, 2026 6/10
app GitHub

ai-native-profile: provenance-aware developer profiles and analytics

An open profile format that records how much of a developer's work was AI-assisted and where it came from, with analytics over the result. Aimed at making AI-native contribution legible rather than guessed at.

provenanceanalyticsprofilesopen-standardmetrics
by Gaurav890 Sep 13, 2026 5/10
app GitHub

TokenMeter: macOS menu bar quota monitor across ten AI providers

Tracks subscription quota windows for Kimi, Claude Code, Codex, GLM, DeepSeek, MiniMax, and OpenCode Go, plus relay balances from several proxy services. Supports API keys, OAuth, and web session auth, and notifies on low balance or expired credentials. Native Swift with no third-party dependencies; adding a provider takes one directory and one line.

macosusagequotaswiftmenu-bar
by Amdeo Sep 13, 2026 6/10
app GitHub

vicoa: an agentic IDE for running a team of coding agents anywhere

An IDE built around running several coding agents at once, reachable from desktop, mobile, or a VPS. Open source and self-hostable, so the agents run on hardware you control while you check on them from wherever you are.

idemulti-agentself-hostedmobileopen-source
by vicoa-ai Sep 13, 2026 7/10
app GitHub

jarvis: a self-healing Discord ops bot with RAG and 99 scripts

An AI operations platform that runs continuously as a Discord bot, backed by a RAG store, an insight layer, and 99 automation scripts. It is built to detect and repair its own failures and accumulate knowledge over time, with no API charges.

discordautomationragopsself-healing
by Ramsbaby Sep 13, 2026 5/10
app GitHub

agent-from-scratch: build a coding agent step by step to see how it works

A tutorial repository that builds an AI coding agent incrementally, implementing each piece so the mechanics — tool loops, context handling, execution — stay visible rather than hidden behind a framework. Bilingual Chinese/English.

tutorialagentlearningfrom-scratchchinese
by liiiiiiiiil Sep 13, 2026 6/10
app Reddit

claude-code-statusline: session cost, energy use, and per-model split

A single bash script status line that estimates session spend, tokens in and out, elapsed and active time, energy in kWh, and a per-model cost breakdown. The author built it after a fleet of subagents quietly ran up a bill. Needs only bash, jq, and awk — no Node or Python. MIT.

statuslinecosttokensbashsubagents
by WirlVortex Sep 13, 2026 6/10
app GitHub

claude-console: drive Claude Code from a Logitech MX Creative Keypad

Maps Claude Code onto physical hardware: live session status on the keypad screen, one-press canned prompts, git actions, and offline voice input. A tactile alternative to alt-tabbing back to the terminal to check whether a run finished.

hardwarekeypadlogitechvoicestatusline
by rshankras Sep 13, 2026 7/10
app GitHub

cc-peer: an unofficial SDK for Claude Code's cross-session peer protocol

Talks to local Claude Code instances over the native peer protocol they already use to communicate across sessions. Unofficial and reverse-engineered, but it opens the door to scripting session-to-session messaging without standing up a separate bus.

sdkmulti-sessionprotocolunofficialipc
by ExaDev Sep 13, 2026 7/10
app GitHub

panoma: a local catalog of your projects for you and your agents

Indexes the projects on your machine into a catalog both you and your agents can query, and keeps learning from how they are used. Aimed at the problem of an agent not knowing what else you have already built.

cataloglocalprojectsdiscoverymemory
by PanomaAI Sep 13, 2026 5/10
app GitHub

claude-print: a claude -p replacement that keeps subscription billing

A drop-in substitute for `claude -p` that drives the interactive TUI through a PTY instead of the headless path, so scripted and automated runs bill against your subscription rather than the API. Useful for cron jobs and pipelines on a Max plan.

cliautomationbillingptyheadless
by jedarden Sep 13, 2026 7/10
app GitHub

tokenmiser: cut Claude Code token use with indexing and ignore rules

Indexes a codebase up front and generates ignore rules so the agent navigates by index instead of reading its way through the tree. The project claims around an 80% reduction in token usage on large repos.

tokensindexingoptimizationcostignore-rules
by Fabioadrianculasso Sep 13, 2026 6/10
app GitHub

claude-drift: replay your old Claude Code sessions against a new model

Takes sessions you already ran and replays them on a different model, then diffs the results. Rather than arguing about whether a new release is better, you get to see what changed on your own work.

evaluationreplaymodelsbenchmarkingsessions
by mandu5 Sep 13, 2026 7/10
app GitHub

claude-code-for-jetbrains: a native GUI client with no Node at runtime

A JetBrains plugin that puts Claude Code in the IDE properly: streaming chat, diffs you can edit in place, MCP support, and a deterministic security layer. Works across IntelliJ IDEA, PyCharm, WebStorm, GoLand, and Rider, and needs no Node.js at runtime.

jetbrainsidepluginmcpgui
by serialexperimentslainnnn Sep 13, 2026 8/10
app GitHub

skipper: mission control for every Claude Code session, subagent, loop

A local dashboard that shows and steers everything running — sessions, subagents, /loop runs, and todo lists — from one place, with zero dependencies. Aimed at people who lose track of what is happening across several terminals.

dashboardsessionssubagentsmonitoringlocal
by bilol-makhmudov Sep 13, 2026 8/10
app GitHub

DocGov: catch stale docs, duplicate files, and docs that contradict code

Your agent writes documentation faster than anyone can review it. DocGov checks it — flagging docs that have gone stale, duplicate files covering the same ground, and prose that contradicts the code it describes. Ships as a Claude Code plugin and a CLI.

documentationlintingplugincliquality
by ZeeshanSultan Sep 13, 2026 7/10
app GitHub

buster-claw: give your own agent a browser, Gmail, Calendar and a queue

A macOS app that hands your existing Claude Code, Codex, or OpenCode agent a set of hands: a browser it can drive, access to Gmail and Calendar, a durable work queue, and an audit trail. There is no LLM inside and no API keys — it uses the agent you already pay for.

macosbrowser-automationgmailcalendaraudit
by hightowerbuilds Sep 13, 2026 7/10
app GitHub

cc-ledger: a token ledger that survives transcript pruning

A Claude Code status line backed by a persistent per-request ledger. Because the numbers are recorded as each request happens rather than recomputed from the transcript, they stay accurate after compaction prunes history.

statuslinetokensledgercompactionusage
by hmedkouri Sep 13, 2026 6/10
app GitHub

kifu: find the ideas you abandoned in past Claude Code sessions

Mines your session history for loose ends: what you started and dropped, where each idea eventually went, and patterns in how you work. Available as a web app, an API, and a Hermes Agent plugin.

sessionsanalysisideashistoryplugin
by gweber Sep 13, 2026 6/10
app GitHub

PolyClaw: a vendor-independent fork of Claude Code, written in Rust

A model-agnostic CLI coding agent forked from Claude Code, able to drive local models as well as cloud providers. For people who want the Claude Code interaction model without being tied to one vendor.

forkrustmodel-agnosticlocal-llmcli
by FolatheDuckofDuckingburg Sep 13, 2026 7/10
app Reddit

CodeSage 0.30: a no-change index run went from 4s to 0.07s

CodeSage indexes on every commit, checkout, and merge via a git hook, so its fixed cost is paid dozens of times a day. It was loading the ONNX model and mapping a CUDA context before checking whether any file had changed: 2.7-4.5s and 1.16GB. It now checks first — 0.07s and 67MB on a 210-file repo. Risk scores also now state what they did not measure.

indexingperformancegit-hookssearchembeddings
by Ilia0001 Sep 13, 2026 6/10
app Reddit

CCC v5.33.0: message a running session straight from the terminal

Five releases of Claude Command Center summarized for people running many parallel sessions: ccc send and ccc ask message a running session from the terminal, a five-minute self-check surfaces dashboard health so silent local failures show up, a new Ask tab answers plain-language questions like 'where did I work on X?', and each Claude and Codex session gets a weekly quota estimate. The author runs 30+ sessions through it.

dashboardparallel-sessionscodexquotarelease
by amirfish Sep 13, 2026 7/10
app GitHub

pulpo: a self-hosted meter and breaker box for coding agents

Meters exact usage for Claude Code, Codex, and any terminal agent on machines you own, then enforces budgets — the breaker trips rather than the bill growing. Self-hosted, with monitoring on top.

meteringbudgetself-hostedcost-controlmonitoring
by darioblanco Sep 13, 2026 7/10
app GitHub

nudge-extension: prompt your coding agent by clicking the pixel

A browser extension for Chrome and Safari that lets you point at an element in your localhost UI and prompt the agent about it directly, through one shared local bridge. Currently a temporary developer preview.

browser-extensionchromesafarilocalhostui
by gstangl Sep 13, 2026 6/10
app GitHub

project-surface: one verifiable artifact describing a project to agents

Proposes a semantic layer for software projects: a single generated artifact any AI agent can read to understand the project's shape, designed to be verifiable rather than hand-maintained prose.

metadatasemantic-layerinteropagentsdocumentation
by Richie11747 Sep 13, 2026 6/10
app Reddit

CoTFly: a simulated fruit-fly brain plays a 3D browser tank game

A fork of the Three.js multiplayer game Claude of Tanks in which a virtual fruit fly operates the tank from a miniature cockpit, steering, aiming, firing and repairing. The neural simulation runs 124 identified fruit-fly neurons and 1,106 measured connections from a reduced MaleCNS circuit, with the neural activity visible on screen. A showcase of how far a hobby project built with Claude Code can be pushed.

gamethreejssimulationshowcase
by BasedKetsu Sep 13, 2026 6/10
app GitHub

decaf: keeps macOS awake during agent runs, with menu-bar token stats

A native macOS menu bar app that prevents your Mac from sleeping while Claude Code or Codex is working, so long unattended runs are not cut short. It also tracks daily and monthly token usage locally. Small quality-of-life fix for anyone running overnight sessions.

macosmenubartoken-usageutility
by AlanY1an Sep 13, 2026 7/10
app GitHub

hyprcage: a caged virtual desktop for AI agents on Hyprland

Gives an agent its own virtual screen on the Hyprland compositor so it can drive a GUI without taking over your actual desktop. Keeps computer-use style automation from stealing focus or clicking on your windows. Linux-only, aimed at people who want agents driving real applications safely.

hyprlandlinuxsandboxcomputer-use
by hexadecimil Sep 13, 2026 7/10
app Reddit

Agency: one workspace for multiple projects, agents, issues and notes

A desktop workspace built to replace juggling one VS Code window per project. It runs several projects and agents from a single window, notifies you when an agent finishes or needs input, and adds a per-project markdown issue tracker and wiki. Works with Claude Code, Codex, Cursor and other CLI agents so you can swap models freely.

workspacemulti-projectnotificationsissue-tracker
by albatrossalt Sep 13, 2026 7/10
app Reddit

Blockforge: wires Claude Code to roblox-ts, Rojo and Roblox Studio

A Windows and macOS desktop app that sits around roblox-ts, Rojo and Roblox Studio so you can describe a game and watch it appear in Studio. The agent terminal is front and centre rather than hidden behind an API wrapper, and it never launches Claude with permission checks disabled. Includes a CC0 asset bank and optional Open Cloud publishing with your own key.

robloxgamedevdesktop-approjo
by Obluness Sep 13, 2026 7/10
app GitHub

imprnt: plain-markdown agent memory read back with grep and BM25

A memory system for AI assistants that stores everything as plain markdown files. The model writes once and retrieval is done with grep plus BM25 ranking, with no embeddings, no vector store and no MCP server to run. MIT licensed, and deliberately simple enough to inspect by hand.

memorymarkdownbm25no-embeddings
by aleksandr-bogdanov Sep 13, 2026 7/10
app GitHub

tokenUsage2: btop-style terminal dashboard for agent token usage

A live terminal dashboard styled after btop that tracks token consumption for Claude Code, Codex CLI and OpenCode across multiple local accounts and backends. Runs offline and read-only with no API keys required, since it reads what the tools already write locally.

tuitoken-usagemonitoringoffline
by marcelpetrick Sep 13, 2026 7/10
app GitHub

reviewstage: draft Claude Code PR reviews, post them as yourself

A human-gated review assistant that has Claude Code draft a pull request review, then lets you pick which comments actually reach GitHub. Everything posts under your own name rather than as a bot. A reasonable middle ground between fully automated review bots and doing it all by hand.

code-reviewgithubpull-requestshuman-in-the-loop
by Wimukti Sep 13, 2026 7/10
app Reddit

claudebar: Claude usage limits in the macOS menu bar, written in Rust

A small menu bar app that shows your Claude usage limits. It reads the OAuth token Claude Code already keeps in the Keychain and calls the same endpoint the usage command uses, so there is no account setup and checking your limits does not consume any of them. Rust and GPUI, MIT licensed, nothing leaves your machine.

macosmenubarusage-limitsrust
by vemkris Sep 13, 2026 7/10
app GitHub

OCI-draw.io-Architect: OCI diagrams from Terraform via a CC plugin

A Claude Code plugin that generates draw.io architecture diagrams for Oracle Cloud Infrastructure, either from existing Terraform configuration or from a written description. Saves hand-drawing diagrams that go stale the moment the infrastructure changes.

diagramsterraformociplugin
by sergio-farfan Sep 13, 2026 6/10
app GitHub

explain-diff-html: turn diffs into interactive HTML walkthroughs

Converts a pull request or code diff into a standalone interactive HTML page that walks through the logical flow of the change rather than listing files alphabetically. Useful for handing a large change to a reviewer who was not in the room when it was written.

diffcode-reviewdocumentationhtml
by malav2110 Sep 13, 2026 6/10
app GitHub

codex-collab: hand work to Codex from inside Claude Code

A small integration that lets Claude Code collaborate with Codex directly, so you can route parts of a task to the other agent without leaving your session. Minimal in scope, aimed at people who keep both subscriptions and want a second opinion in-line.

codexintegrationmulti-agentcollaboration
by Kevin7Qi Sep 13, 2026 6/10
app GitHub

ia-usage-bar: Windows tray monitor for AI usage across providers

A Windows system tray application that tracks usage limits, remaining quota, reset times and spend across several AI providers at once. Fills a gap for Windows users, since most of these monitors are macOS menu bar apps.

windowstrayusage-limitsmonitoring
by Shadelight Sep 13, 2026 6/10
app GitHub

anyagent (Rust crate): multiple agent harnesses behind one interface

A Rust crate that exposes several agent harnesses through a single, simple interface, so a program can target one API and keep working as harnesses change. Aimed at developers building tooling on top of agents rather than at end users. Note this is unrelated to the earlier project of the same name.

rustlibraryharnessabstraction
by spotta85 Sep 13, 2026 5/10
app Reddit

footrue: 290+ Offline Browser Tools Built With Claude Code

A developer used Claude Code in the terminal to build footrue.com, a collection of 290+ browser-only utilities (ffmpeg via WASM, local Whisper transcription, PDF tools) with no backend at all. Everything runs client-side, so hosting stays free even under a traffic spike. The author reports the CLI workflow made debugging WASM workers and local models noticeably easier, and is answering questions about the prompts and terminal setup.

wasmclient-sidewhisperffmpegcase-study
by TurbulentFail5486 Sep 12, 2026 5/10
app GitHub

hicortex: Self-Learning Memory That Distills Agent Experience Into Lessons

hicortex captures an agent’s working experience automatically, then distills it overnight into reusable lessons that are shared across an entire fleet of agents rather than staying stuck in one session. The pitch is memory that improves over time on its own instead of a static notes file you maintain by hand. It supports Claude Code alongside Hermes, OpenClaw, and Pi.

memoryself-learningmulti-agentfleetlessons
by gamaze-labs Sep 12, 2026 7/10
app GitHub

fleet: Native macOS Terminal for Running Many Coding Agent Sessions

A native macOS terminal built for supervising many concurrent AI coding agents — Claude Code, Codex, and Antigravity — from one window. It surfaces which session is blocked and waiting on you instead of making you cycle through tabs. Aimed at people running several agents in parallel across projects.

macosterminalmulti-agentorchestrationui
by fleet-terminal Sep 12, 2026 7/10
app Reddit

Native macOS App That Puts Claude Code, Codex and Kimi in One Chat

A macOS app that runs Claude Code, Codex, and Kimi Code as real CLIs in hidden terminals sharing a single chat window, with OpenRouter models joining as extra participants. You type once and every agent sees it; @name addresses one directly, and they can reply to each other until you call it off. Built out of an adversarial-review habit of having one model critique another.

macosmulti-agentcodexopenrouterreview
by DeliciousGorilla Sep 12, 2026 7/10
app Reddit

YouCoded Assistant: Cross-Platform Desktop Client for Claude Code and More

A desktop AI assistant, now in public preview, that integrates Claude Code alongside ChatGPT subscription plans, OpenRouter and API providers, and a built-in local model runner with its own download interface. Tested on Windows, macOS, and Linux. The author is spending the next several weeks exclusively on bug fixes before adding features.

desktopapplocal-modelsopenrouterpreview
by destinmoss Sep 12, 2026 6/10
app GitHub

single-file-wbs: Zero-Dependency Gantt and WBS Viewer in One HTML File

A work-breakdown-structure and Gantt viewer that ships as a single HTML file reading one JSON data file, with no dependencies. The structure is deliberately plain so Claude Code can maintain the schedule directly. Includes an inazuma progress line for spotting slippage at a glance.

ganttproject-managementsingle-filehtmlplanning
by piguo45 Sep 12, 2026 5/10
app GitHub

glyph: Stamp Every Agent Session With Your Label, Project and Machine

Gives every coding agent session one consistent identity across Claude Code, Antigravity, Codex, and Gemini. Each session is marked with your label plus the project, the machine, and the moment it ran. Useful when work is spread over several machines and you need to tell later which run produced what.

identitysessionsmulti-agentattributiontracking
by fru-dev3 Sep 12, 2026 5/10
app GitHub

mjolnir: Rust Control Plane for ACP Coding Agents With Quotas and Sessions

A Rust terminal and web control plane for coding agents that speak the Agent Client Protocol — Codex, Claude Code, Muse Code, Kimi Code, Grok Build, and DeepSeek Harness. Provides durable sessions, isolated environments, per-agent quotas, and remote control. Aimed at running a stable of agents without babysitting each one individually.

rustacporchestrationsessionscontrol-plane
by BrokkAi Sep 12, 2026 7/10
app GitHub

geniro-app: Local-First macOS App to Run CLI Agents Solo or as a DAG

A macOS desktop app for running CLI coding agents like claude and cursor-agent, either one at a time in a chat or wired together as a team in a DAG where each agent feeds the next. Everything runs on your machine — no cloud, no account, no telemetry. For people who want multi-agent pipelines without handing sessions to a hosted service.

macoslocal-firstdagmulti-agentprivacy
by geniro-io Sep 12, 2026 7/10
app GitHub

cdpx: Supervised Browser Automation CLI With Origin Allowlists for Agents

A CLI that hands coding agents Chrome DevTools Protocol browser control with guardrails attached: every action returns one JSON object, reachable origins are fixed by allowlist, and each run leaves reproducible evidence. Designed so agent browsing stays auditable instead of free-roaming. A safer option than giving an agent an unrestricted browser.

browsercdpautomationclisecurity
by iNem0o Sep 12, 2026 7/10
app GitHub

confab-web: Self-Hosted Session Analytics and Recaps for Claude Code

An open source, Docker-deployable platform for managing Claude Code and Codex sessions, with analytics, AI-generated recaps, sharing, and team features. Session history stays on your own infrastructure. Useful for teams that want visibility into agent work without routing it through a hosted vendor.

self-hostedanalyticssessionsdockerteam
by ConfabulousDev Sep 12, 2026 7/10
app GitHub

ghostspend: Audit AI CLI Spend Against a Baseline of Tools You Use

GhostSpend audits spend across Claude Code, Codex CLI, Gemini CLI and other AI CLIs against a one-time baseline of the tools you actually use. Instead of only reporting a total, it flags charges coming from anything unexpected. Ships as a free open-source Claude Code plugin plus standalone bash scripts.

cost-trackingpluginclaude-codebash
by danmackenz Sep 12, 2026 7/10
app GitHub

auterix: Autonomous Context Engine and Studio for Nine Coding Agents

auterix keeps one workflow across Cursor, Claude Code, Antigravity, Copilot, Codex, Windsurf, Cline and Augment so context does not drift when you switch tools. It pairs an autonomous context engine with a visual studio for inspecting and steering that context.

context-managementmulti-agentcross-tool
by SapanMozammel Sep 12, 2026 6/10
app GitHub

Skill-audit: 31-Rule Security Scanner for Agent Skills Before Install

A zero-dependency scanner that inspects an agent Skill before you install it, flagging prompt injection, dangerous shell usage, secret access and exfiltration paths. It ships 31 rules and emits SARIF for CI. Run it with npx @royalpinto007/skill-audit.

securityskillsscannerprompt-injectionsarif
by AgentPostmortem Sep 12, 2026 7/10
app GitHub

lmux: Native macOS Workbench for Claude Code and CodeBuddy Sessions

A macOS app for running parallel Claude Code and CodeBuddy Code agent sessions side by side. It shows live context and credit meters, resumes past conversations, syncs across Macs, and renders terminals through Ghostty.

appmacosmulti-sessionmonitoring
by LiManshiang Sep 12, 2026 6/10
app GitHub

Bug Hunt Bench: 105 Real Bugs, Frontier Models Graded Blind in Their CLI

A benchmark that puts 105 real bugs from two production repositories in front of frontier coding models — GPT-6, Claude, Grok, Gemini, DeepSeek and others — each working in its own CLI. Results are graded blind, with a live leaderboard and every receipt published.

benchmarkevaluationbug-fixingleaderboard
by phuryn Sep 12, 2026 7/10
app GitHub

prism-desk: Windows Desktop for Codex, Claude Code and Grok

A Windows desktop client (棱镜) that lets you carry a task across multiple subscription accounts, run conversations in parallel, and keep project context together in one place. Localized in nine languages.

appwindowsmulti-accountdesktop
by shixi-11 Sep 12, 2026 6/10
app GitHub

agentboard: Kanban Board Your Agent Works Through on Its Own

Prepare cards on a Kanban board, then let your AI agent pull them and work the queue unattended. It pings you only when it actually needs a decision from you.

appkanbantask-queueautonomous
by Robbertvermeulen Sep 12, 2026 6/10
app GitHub

Claude-Swap-Desktop: Windows Tray Quota Meters for Claude Accounts

A Windows 11 tray companion for the claude-swap CLI. Its glass popover shows live 5-hour and 7-day quota meters plus reset countdowns for every Claude account, and you click to confirm a switch.

appwindowsmulti-accountquotarate-limits
by adithyanraj03 Sep 12, 2026 6/10
app GitHub

hermes-blind: Recover the Original Goal of a Long Agent Session

Reads the first user turn of a long Claude Code or Codex session and reconstructs what you originally asked for, so you can restate it before continuing. It also includes a prompt wrapper that adds evidence and hedging constraints to evaluation prompts. Deterministic and local with no model calls; the author labels it experimental.

appcontext-managementsessionslocal
by hermes-labs-ai Sep 12, 2026 6/10
app GitHub

red-ocean-scanner: Red/Yellow/Green Verdict on a Product Idea

Checks a product idea before you build it by measuring how much supply already exists against search demand, then returns a red, yellow or green verdict. It covers global and Chinese markets and needs no API keys.

appmarket-researchvalidationproduct
by xxdeye Sep 12, 2026 6/10
app GitHub

Вектор: Telegram AI Assistant Your Coding Agent Installs Itself

A Russian-language personal AI assistant for Telegram handling Word and PDF documents, voice messages, reminders and conversation memory. It ships as a ready-to-go repository: hand it to Claude Code or Codex and the agent sets everything up.

apptelegramrussianassistant
by PavelDumbrao Sep 12, 2026 5/10
app GitHub

Claude-Kanban: Local Board Where Claude Plans, Codes and Reviews

Hand Claude a list of tasks on a board that runs on your own computer and walk away — it plans, writes and reviews the work in parallel. Includes approval gates and cost tracking.

appkanbanparallellocalcost-tracking
by husseinalnahi-iq Sep 12, 2026 6/10
app GitHub

semlith: Fast Local Vector Store That Stays Current as You Save

Indexes your files once, keeps the index up to date as you save, and answers questions across the whole set in milliseconds. Everything stays on the machine, with no service to call out to.

appvector-storelocalsearchrag
by semlith Sep 12, 2026 6/10
app Reddit

stoat: One Go Binary So Agents Can Spin Up QEMU VMs Locally

Built after finding no agent-native way to sandbox code execution: Docker breaks down when the VM needs systemd, kernel modules or a loopback device and still shares your kernel, while VirtualBox and VMware assume a human clicking a GUI. stoat is a single Go binary that starts QEMU VMs an agent can call directly, instead of approving every bash command or letting the agent run loose on your machine.

appsandboxqemuvmsecurity
by Bright-Fun-1638 Sep 12, 2026 7/10
app Reddit

PolyDB: One Database for Agents Instead of Five Data Stores

An infrastructure engineer kept discovering they needed yet another data store as they did more with agents, which led to asking whether those models could be combined into a single data layer. PolyDB is the result after a year of work, now in beta, aimed at agents that manage their own infrastructure and complete tasks over APIs.

appdatabaseinfrastructurebeta
by bishopLucas Sep 12, 2026 5/10
app GitHub

grounder: Obsidian Vault as Memory for Claude Code and Cursor

Uses an Obsidian vault as the memory layer for Cursor and Claude Code, holding session handoffs, plans and notes as plain files you own rather than in someone else's database.

appobsidianmemorynoteslocal
by andrej-kolic Sep 12, 2026 6/10
app GitHub

claude-manual-todos-plugin: Track the Manual Steps Only a Human Can Do

A Claude Code plugin that captures the steps an agent cannot finish itself — filling a form in some console, seeding a secret, answering a review — and records them in local SQLite. You then work through them on a per-project board. Useful when agent runs keep stalling on human-only handoffs that otherwise get lost in the transcript.

plugintodossqlitehandoff
by javirub Sep 12, 2026 6/10
app GitHub

wordcell: Markdown Knowledge Base With Backlinks for Coding Agents

A knowledge base built for coding agents to read, combining Markdown files, backlinks, semantic search, and Git context. The aim is giving an agent a durable place to look things up rather than re-deriving project knowledge each session. Sits between a wiki and a memory layer.

knowledge-basemarkdownsemantic-searchmemory
by hraness Sep 12, 2026 6/10
app GitHub

cc-monitor: Traffic-Light Status Monitor for Claude Code Usage

A status monitor that surfaces harness stats for Claude Code and the DeepSeek harness as a simple traffic-light display. It gives an at-a-glance read on whether you are clear to keep working or approaching limits. Documentation is partly in Chinese.

monitoringusagestatsdashboard
by BolunHan Sep 12, 2026 6/10
app GitHub

asu-createai-fallback-harness: Continue a Turn Past Usage Limits

A loopback bridge that lets Claude Code or Codex continue the same turn on ASU CreateAI once you hit a usage limit, rather than losing the in-progress work. Aimed at users with institutional CreateAI access. Interesting as a general pattern for provider fallback mid-conversation.

fallbackusage-limitsbridgeproxy
by Rich627 Sep 12, 2026 5/10
app GitHub

AI-Termux-Android: Five AI Coding CLIs on Android Without Root

A setup guide and menu for running five AI coding CLIs — Copilot, Claude, Codex, Antigravity, and OpenCode — under Termux on Android with no root required. Includes a real install walkthrough rather than just a package list. Documentation is in Portuguese.

androidtermuxmobilesetup
by micheljatuba Sep 12, 2026 5/10
app GitHub

claude-top: Per-Session CPU and Memory Attribution for Claude Code

A monitoring tool that answers which Claude Code session is eating your Mac. Breaks down CPU, memory, subprocesses and containers per session rather than showing one opaque process. Useful when several sessions run in parallel and the fans spin up.

monitoringmacosperformanceparallel-sessions
by mbrummerstedt Sep 11, 2026 8/10
app GitHub

claude-code-plugin-hud: A Minimal Claude Code Statusline

A clean, minimal statusline plugin for Claude Code showing session context at a glance without the clutter of heavier HUDs. Documentation is bilingual Chinese/English.

statuslinepluginuiminimal
by sj817 Sep 11, 2026 5/10
app GitHub

mindpalace: Always-On Personal Agent on Your Claude Max Subscription

A self-hosted personal AI agent that runs on an existing Claude Max subscription and is reachable from the terminal and Discord at the same time. Keeps persistent memory and a structured knowledge vault, with autonomous skills and a heartbeat loop that lets it act between prompts.

personal-agentmemoryself-hosteddiscord
by aashutosh396 Sep 11, 2026 7/10
app Reddit

Mnemos: Local Meeting Memory That Runs on Your Claude Subscription

An open-source meeting recorder that transcribes locally with Parakeet, then summarizes and extracts action items, decisions and open questions per meeting, organized into projects so memory accumulates instead of resetting each call. Uses your existing Claude Code subscription — no separate API key — and only transcript text ever leaves the machine.

meetingstranscriptionlocal-firstmemory
by Ecstatic-Night4222 Sep 11, 2026 7/10
app Reddit

An AI-Native Notion Where Every Page Is Customizable HTML

A note-taking app built for visual thinkers: pages are HTML rather than Markdown, so any agent can embed visuals and workflows directly into notes. Each page can carry its own distinct visual style instead of a single uniform template.

noteshtmlvisualagent-native
by Electrical-Ebb5326 Sep 11, 2026 5/10
app GitHub

stackkeel: Next.js Monorepo Starter Built for Five Coding Agents

An AI-ready Next.js monorepo starter shipping auth, an admin panel, RBAC, audit logging, mobile apps and theming out of the box. Defines one shared development workflow that Claude Code, Codex, Copilot, Cursor and Gemini all follow.

starter-kitnextjsmonorepomulti-agent
by chenson42 Sep 11, 2026 6/10
app GitHub

output: TypeScript Framework for AI Workflows, Built for Claude Code

An open-source TypeScript framework for building AI workflows and agents, designed so you describe what you want and Claude Code builds it with the framework's best practices already baked in.

frameworktypescriptagentsworkflows
by growthxai Sep 11, 2026 6/10
app GitHub

smart-tree: Context-Aware tree Replacement With Semantic Search

A directory-tree tool rebuilt for AI consumption, positioning itself as a replacement for 20+ CLI tools with compression, semantic search, AST-aware editing and persistent partnership memory. The pitch is heavy, but the core idea — tree output shaped for a context window — is sound.

clitreesemantic-searchcontext
by 8b-is Sep 11, 2026 6/10
app GitHub

siteseo: Search and AI-Search Readiness Auditing as a Plugin

A Claude Code plugin that audits sites you own for both classic search and AI-search readiness, against a local build or a live URL. Every finding carries its evidence, the two scores are never blended into one number, and a free offline gate runs before deploy.

seoauditpluginpre-deploy
by dtsoden Sep 11, 2026 6/10
app GitHub

project-sweep: macOS Cleanup for AI Project and Agent Data

A native SwiftUI app that reclaims disk space from AI-assisted projects and the local data left behind by Codex, Claude Code and Cursor, including installed skills. Local-only, no API key required; the app UI is in Simplified Chinese.

macoscleanupdisk-spaceswiftui
by Oliverzheng0727 Sep 11, 2026 6/10
app GitHub

kitty-bridge: Run Claude Code on Any LLM Provider

A universal bridge that points coding agents at whichever provider you want — Claude Code on MiniMax, Codex on GLM, Gemini CLI on OpenRouter — with one command. Also works with OpenClaw, Hermes and other harnesses.

proxyprovidersroutingcli
by Shelpuk-AI-Technology-Consulting Sep 11, 2026 6/10
app GitHub

canary: Keep Large File Reads Out of the Context Window

A Claude Code plugin that intercepts large file reads so they never land in the context window. Ships with the measurement harness used to evaluate it — which found the win is context headroom rather than cost savings, a distinction most such tools skip.

contextpluginfile-readsbenchmarking
by matolah Sep 11, 2026 7/10
app GitHub

shunt: Per-Agent Model Routing for Claude Code Subagents

An inference-layer routing proxy that sends individual Claude Code agents to different models, selectively rather than globally. Lets cheap subagents run elsewhere while the main agent stays on Claude.

routingproxysubagentsmodels
by pleaseai Sep 11, 2026 7/10
app GitHub

relay-tty: Know When Your Terminal Agents Are Waiting on You

A relay for terminal-based agents that surfaces the moment a session is blocked waiting for input, so parallel agents do not sit idle unnoticed in a detached pane.

notificationsttyparallel-sessionscli
by ddrscott Sep 11, 2026 5/10
app Reddit

Cartographer: A Knowledge Base That Provisions Your ~/.claude

A knowledge base that Claude Code reads and that also sets Claude Code up: it writes the MCP entry into ~/.claude.json, maintains a managed block in ~/.claude/CLAUDE.md without touching the rest, and installs skills and subagents. Built to stop hand-copying configuration between machines and teammates.

configurationsyncteamknowledge-base
by BeppeTemp Sep 11, 2026 7/10
app GitHub

berth: Daemonless Worktree Workspaces for Parallel Coding Agents

Fast local workspaces for running coding agents in parallel: one git worktree per agent, isolated ports, private data directories and supervised processes, with no VM overhead and no daemon. Single Go binary for Linux, macOS and Windows, with an optional reusable container backend.

worktreesparallel-agentsisolationgo
by Mrjwj34 Sep 11, 2026 7/10
app GitHub

agent-skill-observatory: Discovery and Security Auditing for Skills

Evidence-based discovery, specification validation, static security auditing and ranking for open Agent Skills across Claude Code, Codex, Antigravity and Cursor. Addresses the real risk that installing a skill means running someone else's instructions.

skillssecuritydiscoveryauditing
by imMamdouhaboammar Sep 11, 2026 7/10
app GitHub

ctxlint: Lint CLAUDE.md and AGENTS.md Against Your Real Codebase

A linter for agent context files that checks what CLAUDE.md or AGENTS.md claims against what the codebase actually contains. Catches the silent drift where instructions point at commands, paths or conventions that no longer exist.

lintingclaude-mdcontextdrift
by YawLabs Sep 11, 2026 7/10
app GitHub

ai-team-sync: File Scope Locks for Multiple Agents on One Repo

Coordinates Claude Code, Cursor and Codex working the same repository through declared sessions, advisory or exclusive file scope locks, and shared decisions. Surfaced in VS Code, a browser dashboard, a CLI and natively over MCP.

coordinationlocksmulti-agentmcp
by pvestal Sep 11, 2026 7/10
app GitHub

ai-security-corpus: 5,660 Grep-able AI Security Links

A plain-Markdown corpus of 5,660 AI security references across 29 categories — prompt injection, agent and MCP security, skills and supply chain, red teaming, sandboxing, incidents and CVEs. Includes 570 arXiv papers and 1,155 repos, forkable and diffable, with an Obsidian vault export. Listed, explicitly not endorsed.

securityprompt-injectioncorpusreference
by AnthonyHerman Sep 11, 2026 7/10
app Reddit

Turning a Repository's Year Into a Film, Now With Flags

A tool that renders a repo's year of history as a film — commits flowing along a line, branches peeling off and rejoining, releases pinned. The follow-up post is about the useful correction: commenters did not want a prettier video, they wanted flags to control what the history shows.

visualizationgithistoryvideo
by Classic_Display9788 Sep 11, 2026 5/10
app GitHub

codexpiator: An All-Domain Claude Code Plugin Toolkit

A broad Claude Code plugin bundling guidance for frontend, backend, security, testing, architecture, DevOps, git/DX and AI integration into one install, aimed at both vibe coders and engineers.

plugintoolkitguidancefull-stack
by emanuelegreco29 Sep 11, 2026 5/10
app GitHub

ai-gateway: One Dependable Endpoint Across Providers and Quotas

A resilient gateway that collapses fragmented LLM providers, API keys and quotas behind a single endpoint, failing over rather than surfacing every provider's outage to your agents.

gatewayprovidersfailoverquotas
by fongap Sep 11, 2026 5/10
app GitHub

doc2md: Convert Office and PDF Files to Markdown Before the Agent Reads

Batch-converts Word, Excel, PowerPoint, PDF, EPUB, RTF and CSV into clean Markdown before an agent ever opens them, so the model reads text rather than fighting binary formats. A wrapper over firecrawl/anydoc.

documentsmarkdownconversionpreprocessing
by ilyautov Sep 11, 2026 6/10
app GitHub

cordon: A Deterministic Boundary Between Untrusted Content and Actions

A deterministic layer sitting between untrusted content and an agent's actions: it strips the hidden layer of fetched content, tracks where each piece of data came from, and keeps tool calls inside the boundaries of the original intent. A structural answer to prompt injection rather than a prompt-level one.

securityprompt-injectionprovenancesandboxing
by ilyautov Sep 11, 2026 7/10
app GitHub

maskit: Local Redaction Gateway That Masks Data Before It Leaves

A proxy between your coding tool and the model provider that masks sensitive values on the way out and restores them in the streamed reply. Works with anything you can point at a custom base URL, including Claude Code, Cursor and Codex. Docs are in Chinese.

privacyproxyredactionchinese
by xiaYuTian11 Sep 11, 2026 6/10
app GitHub

UltraSplitter: Content-Aware Image Splitting for Coding Agents

Splits large images into pieces along content boundaries instead of a fixed grid, so a multimodal agent can read each tile without losing context at the seams. Aimed at feeding screenshots, diagrams and long designs to agents that have per-image size limits.

multimodalimagespreprocessing
by PlevanTem Sep 11, 2026 6/10
app GitHub

NVIDIA SkillEvaluator: Measure Whether a Skill Changes Agent Behavior

NVIDIA's framework for evaluating agent skills across multiple tiers: quality gates, detection of semantic overlap between skills, synthetic evaluation dataset generation, and live runs that measure how a skill actually shifts agent behavior. Answers the question most skill authors skip — does this skill help?

evalsskillsnvidiabenchmarking
by NVIDIA Sep 11, 2026 8/10
app GitHub

claude-context-monitor: Context and Rate Limits in the macOS Menu Bar

Puts Claude Code's context usage and rate-limit status in the macOS menu bar so you can see how close a session is to the edge without switching to the terminal. Useful for long sessions where compaction otherwise arrives as a surprise.

monitoringmacoscontext-windowrate-limits
by ErrantKim Sep 11, 2026 7/10
app GitHub

txcript: Pandoc for AI Chats — Move Sessions Between Harnesses

Converts chat transcripts between Claude Code, Codex, OpenCode, Cursor and other harnesses, so a session started in one tool can be continued in another. Ships as a Rust library, a CLI and a WASM build. A genuinely missing piece for anyone running more than one agent.

transcriptsinteroprustwasm
by skillsynchq Sep 11, 2026 8/10
app GitHub

claude-use: Run Multiple Claude Code Logins From One Machine

A profile manager and launcher that keeps separate Claude Code logins on one machine, with directory-scoped control over exactly what config, history and credentials each profile shares. Built for people juggling work and personal accounts.

profilesmulti-accountlauncher
by ExaDev Sep 11, 2026 7/10
app GitHub

Hunter Community Edition: Self-Hosted Multi-Agent Finance Stack

A self-hosted private finance research setup built on opencode, Claude Code, MCP and a multi-agent layout, covering AI analysis and quantitative work. Starts from Docker in about fifteen minutes. Bilingual Chinese and English docs.

financemulti-agentself-hosteddocker
by agentpit-io Sep 11, 2026 5/10
app GitHub

agents-docker: Container Images for the Claude, Codex and Gemini CLIs

Docker images with the Claude, Codex and Gemini CLIs preinstalled alongside Java, Python, Go and Node toolchains. Useful for running agents in a disposable container instead of on your host, or for giving CI a ready-made agent environment.

dockersandboxingcitoolchains
by cloudyhomelab Sep 11, 2026 6/10
app GitHub

arle: Local Inference for Coding Agents With a Persistent KV Cache

A single-binary Rust inference server that speaks both the Anthropic and OpenAI APIs and keeps its KV cache alive across turns, so turn twenty starts as fast as turn two. Runs on Apple Silicon and NVIDIA, with on-policy distillation on the same runtime.

local-inferencerustkv-cacheself-hosted
by acupof-ai Sep 11, 2026 7/10
app GitHub

agentic-retrieval: Compare Six Retrieval Strategies on Your Own Repo

A Claude Code plugin and offline retrieval engine that indexes your project's docs and code, then benchmarks six approaches side by side — contextual BM25, LLM-enriched lexical, dense ANN, Lucene BM25, hybrid RRF, and tree-sitter AST chunking. Lets you pick a retrieval strategy from evidence instead of vibes.

retrievalragbenchmarkingtree-sitter
by josix Sep 11, 2026 7/10
app GitHub

Relayer: Answer Prompts From Several Coding Agents in One Place

Runs multiple AI coding agents at once and funnels all their permission prompts and questions into a single interface. Removes the usual problem of parallel agents each silently blocking in their own terminal.

multi-agentorchestrationprompts
by Hocsman Sep 11, 2026 6/10
app GitHub

claude-code-statusline-astro: Status Line With Context and Limit Meters

A cross-platform colored status line showing project, git branch, model, context usage and rate-limit meters, plus a rarity-rolled mascot that indicates what the current turn is doing. Cosmetic on top, genuinely useful meters underneath.

statuslinemonitoringcross-platform
by black-astro Sep 11, 2026 6/10
app GitHub

Beacon-Split: An Agent-First Workspace for Parallel Projects

A workspace that puts Claude Code sessions, terminals, files and git for several projects on one screen, designed to minimize context switching when you supervise multiple agents at once.

workspacemulti-projectparallel-agents
by hxst1 Sep 11, 2026 6/10
app GitHub

ccx: A Reversible, Version-Aware Patcher for the Claude Code Binary

Applies curated community patches to the Claude Code CLI as selectable groups, tracking provenance, matching patches to your installed version, and reversing cleanly. A daily release watch flags when a new Claude Code version lands. Unofficial — patching the binary is at your own risk.

patchingcliunofficialcustomization
by kendreaditya Sep 11, 2026 6/10
app GitHub

agent-activity-dashboard: See What Every Local Agent Is Doing Right Now

A read-only, localhost-only dashboard showing every Claude Code agent on your machine — which tool it is running, which file it is touching and for how long — including every sub-agent spawned. Zero dependencies.

dashboardmonitoringsubagentsobservability
by greentourn Sep 11, 2026 7/10
app GitHub

whip: Steer a Running Claude Code Turn Without Interrupting It

Injects course corrections into a Claude Code turn while it is still working, instead of pressing escape and throwing away the turn's progress. Ships with a playful lightsaber interaction for when steering is not enough.

steeringinteractiveturn-control
by alphhs Sep 11, 2026 6/10
app GitHub

slowave: A Living Local Memory Layer for AI Tools

Keeps a local, continuously updated memory store that your AI tools read from, so context accumulated in one session is available in the next. Early-stage; the README is light on mechanics.

memorylocalcontext
by slowave-ai Sep 11, 2026 5/10
app GitHub

contextrot: Find Where Your Coding Agent Starts Degrading

Analyzes your own session transcripts to find the context length at which your agent's output quality starts falling off. Runs fully locally with no configuration via `uvx contextrot`. Turns a widely-felt intuition into a number you can act on.

analyticscontext-rotlocaltranscripts
by Priyanshu-byte-coder Sep 11, 2026 7/10
app GitHub

codex-router: One Menu to Share Model Subscriptions Across Tools

A local router letting Codex, Claude Code and any OpenAI-compatible client pick from GPT, DeepSeek, Kimi, GLM, Gemini and Claude in a single menu, pooling the subscription quotas you already have. Includes a vision relay so text-only models can get images described. Chinese and English docs.

routermulti-modelsubscriptionschinese
by 822807097 Sep 11, 2026 6/10
app GitHub

braids: Browse Claude Code Sessions as a Graph and Fork Any Message

A terminal tool that renders your Claude Code session history as a graph of sessions and branches, searches it locally, and starts a new conversation forked from any message in it. Makes 'I wish I had gone the other way at that step' an actual recovery option.

sessionsbranchingtuihistory
by Ashes47 Sep 11, 2026 7/10
app GitHub

atoll: An ASCII Dynamic Island for Claude Code on macOS

A floating ASCII-styled status pill for Claude Code on macOS, modeled on the iPhone's Dynamic Island, showing what the agent is doing without keeping the terminal in view.

macosstatuslineuimonitoring
by mehdi7129 Sep 11, 2026 5/10
app GitHub

tack: A Different Claude Code Setup in Every Terminal

A profile switcher that isolates Claude Code configuration per terminal, so separate windows can run different models, permissions and settings at the same time.

profilesconfigterminalisolation
by Mariano215 Sep 11, 2026 6/10
app GitHub

ccred: Save and Switch Named Claude Code Credential Sets

Stores multiple local Claude Code credential sets under names and switches between them, for juggling separate accounts on one machine. Unofficial and not affiliated with Anthropic.

credentialsmulti-accountcliunofficial
by Zigecek Sep 11, 2026 6/10
app GitHub

swttch: A Claude Code GUI Plugin for JetBrains IDEs

Brings a graphical Claude Code interface into IntelliJ, PyCharm and other JetBrains IDEs, replacing the embedded-terminal workflow. Formerly published as 'Claude Code with GUI'.

jetbrainsideguiplugin
by Swttch Sep 11, 2026 7/10
app GitHub

KGraph: Compiler-Aware Code Graph for Token-Efficient Retrieval

Builds a structural code graph using compiler-level knowledge, developed against operating-system kernel code, so an agent can retrieve exactly the relevant structures instead of dumping whole files into context. Aimed at very large C codebases.

code-graphretrievalkerneltoken-efficiency
by ajksunkang-aios Sep 11, 2026 6/10
app GitHub

hamsters: Chainable macOS AI Workers, One Script Each

Each worker is a single script with a native macOS GUI and no installer or dependencies. Connect one worker's outbox to another's inbox to chain tasks, driven by whichever of the Gemini, Claude or Codex CLIs you already have.

macosguipipelinescomposable
by Miki-AG Sep 11, 2026 6/10
app GitHub

cairn: A Self-Hosted Tracker Agents Read Before They Start

A searchable, self-hosted store of tasks, dead ends and lessons learned that agents consult at the start of a session and write back to as they work. Aims to stop the next agent from re-walking a path that already failed.

trackermemoryself-hostedtasks
by montytorr Sep 11, 2026 6/10
app GitHub

ai-switch: One Local Key Hub for Every Agent CLI

Change an API key once and OpenClaw, OpenCode, Codex and Claude Code all pick it up, with dead keys evicted automatically so a bad credential does not take a tool down. Chinese-language docs.

api-keysconfigclichinese
by kingkate2009-droid Sep 11, 2026 5/10
app GitHub

QuotaStation: Track Claude Code and Codex Quotas on Windows

A Windows desktop app showing quota consumption, usage history, reset times and estimated API cost for Claude Code and Codex. Fills a real gap, since most usage monitors target macOS.

windowsquotasusagemonitoring
by SteveWang92 Sep 11, 2026 6/10
app Reddit

ContextVeil: Keep Secrets in cat .env Out of the Model's Context

Intercepts tool results in Claude Code and blanks credential values before they reach the model — the command still runs and the file is still read, only the model-bound copy is redacted. Addresses the ordinary case where a useful command output happens to also contain an API token.

securitysecretsredactioncontext
by d8schreiber Sep 11, 2026 7/10
app GitHub

claudebill: Retroactive Offline Cost Breakdown for Claude Code Sessions

A zero-dependency CLI that reads the Claude Code session logs already on your disk and works out what each session actually cost. It runs retroactively over history you never instrumented, and entirely offline. Useful for per-session spend visibility without wiring up a billing dashboard.

cost-trackingclianalyticsoffline
by aitechexplore Sep 11, 2026 7/10
app GitHub

mechapad-cli: Run Claude, GPT, DeepSeek and Gemini Side by Side

A control surface that fans one prompt out to several coding models in parallel so you can compare answers in one place. It also ships a native MCP server, making the same model pool reachable from Claude Code as tools. Aimed at people who cross-check one model against another before committing an answer.

multi-modelmcpclicomparison
by EugeneFinch Sep 11, 2026 6/10
app GitHub

Lahe: Direct Editing and Agent Threads Injected Into Local HTML

Lahe injects an editing layer into any HTML file on your machine, so you can click text to edit it in place and open threaded agent conversations anchored to specific elements. Edits and comments stay attached to the region of the page they came from. Handy for reviewing and revising generated pages without bouncing between browser and editor.

htmleditorbrowserreview
by kenxle Sep 11, 2026 6/10
app GitHub

modelswap: Encrypted Key Vault and Model Switching for 10 Agent CLIs

A local console that keeps API keys in an encrypted vault and swaps model and provider settings across Claude Code, Codex, OpenCode, Kimi, Grok and five other agent CLIs. Config changes are surgical — it patches the specific keys each tool reads rather than overwriting whole files — and usage is tracked per provider. Local-first with no resident daemon.

configapi-keysmulti-agentusage-tracking
by Cing-self Sep 11, 2026 7/10
app GitHub

prov_ledger: Data Contracts and Provenance for Data-Science Agents

Catches the case where an agent's pipeline exits 0 but quietly produced wrong data. It layers data contracts and provenance over data-science coding agents: a plan-to-verified-change audit trail, runtime schema-drift detection, and a decision ledger so the same mistake is not repeated later. For anyone letting an agent touch real datasets.

data-scienceprovenancedata-contractsschema-driftaudit
by yizhao95 Sep 11, 2026 7/10
app GitHub

Claude-Usage-Monitor: macOS Menu Bar Tracker With Daily Limits and Run Alerts

A macOS menu bar app that tracks Claude.ai usage in real time without needing an API key. It shows daily limit progress and per-model (Sonnet) bars, and fires alerts when scheduled routine runs complete. Useful if you want quota visibility while working on a subscription plan.

usagemacosmenu-barmonitoringquota
by preseniledementiaorganicphenomenon554 Sep 11, 2026 6/10
app GitHub

estelle-cli: Grounding Gate That Blocks Ungrounded Agent Output

A model-agnostic (BYOK) trust layer that sits under coding agents and refuses to ship claims that aren't backed by the real codebase. It combines repository memory, a deterministic grounding gate, and grounded review. Aimed at cutting hallucinated code and false claims of completion.

groundingverificationcode-reviewclihallucination
by uqeu Sep 11, 2026 7/10
app GitHub

resection: Audit the Drift Between a Project's Vision and Its Implementation

Two cold agents independently describe what a Claude Code project is supposed to do and what it actually does, then a deterministic diff surfaces every point where the two accounts disagree. The independence is the point — neither agent sees the other's write-up. Useful for catching scope drift on long-running agent-built projects.

auditdriftmulti-agentverificationproject-health
by justinstimatze Sep 11, 2026 7/10
app Reddit

Week 7 of Vibecoding an MMO: Balance, UX, and Player Retention

The seventh installment of a public build log for an MMO built largely with AI coding agents. This week shifts from feature work to game balance and UX design, with a Hacker News traffic spike that brought ~1000 players but very low retention. Honest numbers on where vibe-coded projects get hard after the prototype phase.

vibecodinggame-devbuild-logretentionmmo
by Electrical-Pig Sep 11, 2026 5/10
app GitHub

claude-code-gateway: Multi-Provider Gateway With Key Rotation and Fallback Chains

An Anthropic-compatible gateway that lets Claude Code talk to Anthropic, Bedrock, Vertex, or any OpenAI-compatible backend. It adds API key rotation, fallback chains when a provider errors, cost tracking, and a dashboard. Aimed at teams who need resilience and spend visibility across providers.

gatewayproxymulti-providerbedrockvertexcost-tracking
by Mukller Sep 11, 2026 7/10
app GitHub

llm-proxy: Lightweight Local Proxy for Groq, Nvidia NIM, and Ollama Backends

A small local proxy that lets agent CLIs like Claude Code and Antigravity talk to OpenAI-compatible providers. Supports Groq, Nvidia NIM, and Ollama out of the box. Handy for local or cheaper inference without changing your agent setup.

proxyollamagroqlocal-llmopenai-compatible
by cadakerem Sep 11, 2026 6/10
app GitHub

cc-deck: Control Claude Code From Phone, Watch, Web, or Desktop

A remote control layer for Claude Code across four clients — phone, watch, web, and desktop — supporting approvals, prompt injection, interrupts, and model switching mid-session. It also adds workflow features: stronger task management with completion push notifications, scheduled tasks, inline Q&A, and structured transcripts. Self-hosted cloud bridge with end-to-end encryption. Documentation is in Chinese.

remote-controlmobileself-hostednotificationse2e-encryption
by humumu130 Sep 11, 2026 7/10
app GitHub

terminal-lobby: Browser tmux Sessions With a Claude-Aware Session List

Runs tmux sessions in the browser with per-user isolation and shared projects, plus a read-only watch mode for observing someone else's session. The session list is Claude-aware, so agent sessions are identifiable at a glance. Useful for teams pairing on or supervising agent runs.

tmuxbrowserremotecollaborationsessions
by ViktorBarzin Sep 11, 2026 6/10
app Reddit

Vestige: Preserve Why a Fix Exists, Not Just What It Does

Addresses the case where Claude reads an odd-looking exception during an unrelated task and helpfully removes it, undoing a fix that took hours to discover. Vestige records the reasoning behind decisions so it survives new sessions and context compaction. Built by the maintainer in response to recurring memory complaints in the community.

memorycontextdecisionscompactiondocumentation
by ChikenNugetBBQSauce Sep 11, 2026 7/10
app GitHub

anywh: Self-Hosted Relay and Native Desktop/iOS App for Agent CLIs

A relay you run on your own machine plus native desktop and iOS clients for driving coding-agent CLIs remotely. Supports chat, voice input, and a multi-session UI. Everything stays on your hardware — no third-party service in the loop.

remoteself-hostediosvoicemulti-session
by anywh-sh Sep 11, 2026 6/10
app GitHub

career-copilot: Job Search, Tracking, and Applications via CLI, MCP, and Agent

A career assistant that searches listings, tracks applications, and helps you tailor materials, exposed three ways — CLI, MCP server, and agent skill. Works with Claude Code, Codex, OpenCode, and WorkBuddy. Useful pattern for shipping the same tool through multiple agent surfaces.

mcpclijob-searchcareerproductivity
by ronineymessjr-sudo Sep 11, 2026 5/10
app GitHub

clodex: Visual Fleet Manager for Claude Code and Codex Agents

Manages fleets of coding agents from one view with real terminals, live context and cost readouts, and agents that can message each other. Spans your Mac and any Linux box you point it at. Built for people running many concurrent agent sessions rather than one.

multi-agentfleetterminalcost-trackingorchestration
by avirtual Sep 11, 2026 7/10
app GitHub

AI-Token-Optimizer: Compress Git diffs and enforce token budgets for coding agents

A context optimizer for Claude Code, Codex and Cursor that compresses Git diffs, summarizes history and enforces a per-session token budget. The author claims up to 70% lower token usage. Worth a look if long sessions keep blowing through your context window.

tokenscontextgit-diffoptimization
by berylenonmechanistic8499 Sep 10, 2026 6/10
app GitHub

sissy: macOS menubar meter for Claude Code token spend and rate limits

A macOS menubar app showing today's token spend, cost and remaining rate-limit headroom for both Claude Code and Codex. One click gets you the current numbers without dropping into a terminal. Useful for staying ahead of a limit reset mid-task.

macosmenubarusage-monitoringrate-limitstokens
by xsmyile Sep 10, 2026 7/10
app Reddit

Cutlist: Open-source agent plugin that finds short-form clips in long videos

A free, open-source agent plugin that scans long-form video and pulls out the moments worth cutting into short-form content, instead of you scrubbing the timeline guessing. Works across agents, with the author's testing documentation included in the repo. Aimed at creators and marketers sitting on hours of unedited footage.

videocontent-creationpluginopen-source
by itsryanlenk Sep 10, 2026 6/10
app GitHub

glasshouse: Multi-agent orchestrator for Claude Code, Codex and other agents

An orchestrator that runs Claude Code, Codex and other coding agents behind one harness with request routing, shared project memory and live tool results. Its code-mode harness is meant to reduce the number of inference boundaries a task crosses. For people juggling several CLIs on the same codebase.

orchestrationmulti-agentroutingmemorycodex
by HarzerHeribert Sep 10, 2026 7/10
app GitHub

origin-of-memory: Persistent agent memory on Windows with FTS5 retrieval

A Windows-focused memory layer that captures sessions automatically, compiles them nightly into a knowledge base, and injects BM25/FTS5 search results into every prompt. Built for Claude Code, with other agents reading the root map from AGENTS.md and querying over MCP. Stdlib-only with no vector database, which keeps setup light.

memorywindowsfts5retrievalmcp
by Capslockiller Sep 10, 2026 7/10
app GitHub

switchboard (davidlahuta): Control Room for Parallel Sessions and Plans

A local control room that keeps concurrent Claude Code agent sessions from stepping on each other, and juggles several Claude subscriptions with live hand-off between them. Useful if you routinely run more agents than one plan's rate limits comfortably allow.

session-managementparallel-agentssubscriptionslocal-first
by davidlahuta Sep 10, 2026 8/10
app GitHub

scoped-agent-dispatch: Session Indexing Plus Containerized Agent Execution

Indexes every local coding-agent session straight from the agents' own log files, giving you searchable session state without extra instrumentation. It also runs agents inside containers that never touch your real working tree.

session-statecontainersisolationobservability
by saptaxis Sep 10, 2026 7/10
app Reddit

Stvena: A Visual Review Layer Wrapped Around Your Claude Code Session

Launch Claude Code through `stvena claude` and get a review and control surface alongside the terminal: changed files and hunks visible while the agent is still working, with the ability to jump straight to suspicious code. Built to kill the terminal-to-editor-and-back loop when reviewing agent edits.

code-reviewdiff-viewertuimulti-agent
by goddeschunk Sep 10, 2026 7/10
app GitHub

usclaude: Linux Tray Applet Showing Claude Code Usage Limits

A small Rust tray applet for Linux that surfaces what /usage reports — your 5-hour session quota and weekly quota, along with reset times. Keeps the limit visible without interrupting a session to ask.

usage-limitslinuxrusttraymonitoring
by niqoz Sep 10, 2026 7/10
app Reddit

bury-bench: Deterministic Scoring for Whether Agents Bury the Answer

An open-source harness that scores coding-agent replies against ADHD-friendly 'do not bury the lede' rules using regex, structure, and heuristics — no LLM judge, so the same input always yields the same score. Produces a Markdown leaderboard; the demo runs without API keys and separates a good chat (~76.9) from a buried one (~7.9).

benchmarkevaluationdeterministiccommunication
by Obluness Sep 10, 2026 6/10
app GitHub

agent-session-butler: Cross-Platform Session Manager as a Single Go Binary

Discovers, browses, and cleans up AI agent sessions across platforms from one place, shipping as a single Go binary with both a CLI and a web UI. Aimed at the pile of stale session state that accumulates when you run agents daily.

session-managementgocliweb-uicleanup
by aleck31 Sep 10, 2026 7/10
app GitHub

afaro: Local-First Data Broker Opt-Outs Driven by Claude in Chrome

Walks Claude in Chrome through opt-out flows on people-search and data broker sites, keeping all your personal data on your own machine and requiring your approval for every request. Each site integration is an open JSON file backed by a screenshot of the opt-out page it was built from, so the automation is auditable.

privacybrowser-automationclaude-in-chromelocal-first
by afaro-ai Sep 10, 2026 6/10
app GitHub

jamat: Desktop Control Center for Many Claude Code Sessions Across Machines

An open-source desktop app for running many Claude Code and Codex sessions at once, both locally and on other computers you own. Sessions run in a host process and survive closing the window, with live status, diffs, and usage collected into one workspace.

session-managementdesktop-appmulti-machinediffsopen-source
by ludekvodicka Sep 10, 2026 8/10
app Reddit

Indexing Every Claude Code Session Locally and Feeding It Back via Hooks

Claude Code writes a full JSONL transcript of every session to ~/.claude/projects — 596 MB in the author's case — undocumented, organized by directory, and often larger than any context window, so in practice the work is lost. This builds a local index over all of it and wires results back into live sessions through hooks, addressing both starting from nothing between sessions and compaction discarding your exact wording within one.

transcriptshookssearchmemorylocal-index
by No-Ad7069 Sep 10, 2026 8/10
app GitHub

sharedfiles: Predict Where Parallel Agent Work Will Collide, From Git History

Reads git history alone to identify which files parallel work streams are likely to fight over, with no tokens spent and no configuration. Handy for deciding how to split tasks before launching several agents at once.

parallel-agentsgitconflict-detectionzero-config
by quintetkit Sep 10, 2026 6/10
app GitHub

local-review: Minimal Local Webapp for Reviewing Branch Diffs

A small self-hosted web UI for reviewing the changes on a local branch, without pushing anywhere or opening a pull request. Fits the loop where an agent produced a branch and you want to read it properly before it goes anywhere.

code-reviewdiff-viewerlocalgit
by rosenbjerg Sep 10, 2026 5/10
app GitHub

ccheck: Lint Your .claude/ Config, With Every Finding Citing the Docs

A linter for your .claude/ directory that reports what is broken and what has been deprecated. Each finding cites the specific documentation that backs it, so you can verify the claim instead of trusting the tool.

linterconfigurationvalidationclaude-codedeprecation
by quintetkit Sep 10, 2026 8/10
app GitHub

wayfinder (WBXWHT): Codex and Claude Code Work as a Visual Voyage Map

A local macOS app that renders your Codex and Claude Code activity as a single visual map of the journey. Aimed at seeing the shape of a long stretch of agent work rather than scrolling back through transcripts.

visualizationmacossession-historycodex
by WBXWHT Sep 10, 2026 6/10
app Reddit

Fable 5.1 Playing Ultima Online Autonomously for Two Hours

A Claude Code agent given one open-ended prompt — play Ultima Online however you see fit — running fully autonomously on a live MMO shard for over two hours. Notable moments include the agent choosing to attend an in-game server festival after an NPC mentioned it; the author reports a clear improvement over an earlier Opus run of the same setup.

agentic-demogame-automationautonomyfable
by autorokk Sep 10, 2026 6/10
app GitHub

vibe-term: Self-Hosted Web Terminal for Driving Claude Code From Your Phone

A self-hosted web terminal over tmux that lets you run Claude Code and Codex on your own machines and take over from a phone or tablet. Supports a multi-machine mesh, end-to-end encryption, and terminal sharing.

remote-accesstmuxweb-terminalmobileself-hosted
by 12dora Sep 10, 2026 7/10
app GitHub

compose (getlatentic): Local-First AI Markdown Editor for macOS

A macOS Markdown editor where Claude Code, Codex, or Ollama edit your documents in place, with review and undo around every change. No terminal, no API keys, and no setup required.

markdowneditormacoslocal-firstollama
by getlatentic Sep 10, 2026 7/10
app GitHub

opensider: Browser Extension That Drives Local Agent CLIs From the Page

A browser extension that hands the current page to local agent CLIs — Claude Code, Copilot CLI, OpenCode, Cursor CLI and others — for web information gathering and browser automation. Keeps the agent local while giving it a real browser session to work from.

browser-extensionautomationweb-scrapingcli-agentschinese
by parksben Sep 10, 2026 7/10
app GitHub

tapproval-helper: Answer Claude Code Permission Prompts From an Apple Watch

The computer-side half of Tapproval, which forwards Claude Code's approval prompts to an Apple Watch so a long run does not stall waiting on you at the keyboard. Open, auditable, and written against the standard library only.

approvalsapple-watchnotificationsremote-control
by marcobelini Sep 10, 2026 7/10
app GitHub

thing-cli: Publish What Your Coding Agent Builds to a Durable Link

A CLI that turns whatever Claude Code, Codex, Cursor or Gemini CLI produces into a hosted artifact at a stable URL. Each publish is versioned, and the page carries comments so reviewers can respond in place. Useful when you want to hand a generated prototype to someone without setting up a repo or deploy.

artifactssharingcliversioning
by unravel-team Sep 10, 2026 6/10
app GitHub

aidc: Sandboxed Dev Container for Running Claude Code in Yolo Mode

A dev container built so you can skip permission prompts safely: egress is filtered to an allowlist, git is local-only, taint detection flags data that came from untrusted input, and everything is audited. The premise is that yolo mode is fine if the blast radius is bounded. A solid answer to the 'agent wiped my machine' genre of post.

sandboxcontainersecurityyoloaudit
by pacepace Sep 10, 2026 8/10
app GitHub

thedrain: What Claude Did Today, Measured Against the Linux Kernel and Doom

Reads your local Claude data and reports the day's tokens, API-equivalent cost, commits and lines written, with the line counts scaled against familiar codebases for perspective. Runs entirely offline — zero tokens spent, no network calls. More fun framing than the usual usage dashboard.

usagestatslocaltokens
by Azamatfg Sep 10, 2026 6/10
app GitHub

artifact-to-pdf: Render a Claude Artifact as One Continuous PDF

Converts any Claude artifact or web page into a pixel-accurate PDF with no page breaks cutting through content. The continuous-page output is the point: long dashboards and generated documents survive export intact. Useful for archiving or sharing artifacts outside the Claude UI.

pdfartifactsexportrendering
by darbycommunal344 Sep 10, 2026 6/10
app GitHub

earheart: Local Voice Dictation Straight into Claude Code, Codex or Cursor

Press a hotkey, speak, and the transcription lands in whichever coding agent you have focused. Runs Parakeet and Gemma locally, so audio never leaves the machine, and works on Windows, macOS and Linux. A genuinely useful input method for long prompts you would rather not type.

voicedictationlocalprivacyinput
by cleanunicorn Sep 10, 2026 8/10
app Reddit

Margin: A Notes App Whose AI Is Your Existing Claude Code Install

A notes app that shells out to whatever `claude` is on your PATH using `claude -p --output-format text`, so there is no API key to paste and your existing subscription pays. Every AI change arrives as a diff you accept hunk by hunk rather than an in-place rewrite. If the CLI is missing it says so instead of silently degrading.

notesdiffcli-integrationsubscription
by sth_wicked1 Sep 10, 2026 7/10
app GitHub

Musage: Cross-Platform Floating Quota Monitor for Claude Code and Peers

A Tauri 2 and Rust overlay showing remaining quota across MiniMax, DeepSeek, Claude Code, Cursor, OpenRouter and relay providers in one floating window. Runs on Windows, macOS and Linux. Aimed at people juggling several subscriptions who want one place to see burn rate.

usagequotatauricross-platform
by Thedeergod666 Sep 10, 2026 6/10
app GitHub

ultra-edit: Snapshot-Based, Verifiable Multi-Edit Tool for Claude Code

A Rust replacement for the built-in multi-edit path that snapshots files before editing and verifies the result afterwards, so a partially applied batch is detectable and reversible. Targets the failure mode where a multi-file edit half-lands and leaves the tree inconsistent.

editingrustsnapshotstooling
by subashc2023 Sep 10, 2026 7/10
app GitHub

renki: Run Claude Code on Your Own Server, Drive It from Your Phone

A self-hosted daemon that keeps Claude Code running on your machine, with web, VS Code and Android clients to talk to it. Sessions survive you closing the laptop. One of the more complete takes on remote Claude Code, given it ships three clients rather than just a web view.

remoteself-hostedmobileandroiddaemon
by Zawaer Sep 10, 2026 8/10
app GitHub

ebi-agent-chat-relay: Drive Claude Code from Discord or Microsoft Teams

A relay that fronts Claude Code, Codex, local and AG-UI agents behind chat clients, so a session can be started and steered from Discord or Teams. Multi-frontend by design rather than bolted to one platform. Useful for teams that already live in a chat tool.

chatdiscordteamsrelayremote
by Pu11en Sep 10, 2026 7/10
app GitHub

cc-switch-plus: One Skill Library Shared Across Claude Code and Codex

An enhanced fork of CC Switch focused on managing a single skill library across projects and agents, so skills stop being copied per-repo. Keeps CC Switch's provider-switching lineage. Chinese and English documentation.

skillsmanagementcc-switchcodex
by Andythropics Sep 10, 2026 6/10
app GitHub

aibridge: Let Your Coding Agent Drive the Other AIs on Your Machine

Exposes other locally installed AI CLIs to your coding agent, so Claude Code can delegate to whatever else you have running. Turns a collection of separate tools into something one agent can orchestrate. Sparse documentation, but the idea is clear.

orchestrationmulti-agentdelegationcli
by ycmjason Sep 10, 2026 6/10
app GitHub

openlit: OpenTelemetry Observability and Evals for Coding Agents

An open-source platform that traces LLM calls, tool invocations, prompts, costs and full agent workflows using OpenTelemetry, with an evaluation layer on top. Standard instrumentation means it slots into existing observability stacks rather than being another silo. Mature project relative to most agent-monitoring tools.

observabilityopentelemetrytracingevals
by openlit Sep 10, 2026 7/10
app GitHub

skillvariants: See How the Same Agent Skill Diverges Across GitHub

Tracks how Agent Skills mutate as they get copied between repositories, surfacing the variants of a given skill. Useful for finding the version someone actually improved rather than the first search hit. A view of the skill ecosystem that did not exist before.

skillsdiscoverygithubcomparison
by ppplkmvvb Sep 10, 2026 6/10
app GitHub

ClaudeBar: Provider Switching and Session Monitoring in the macOS Menu Bar

A menu bar app covering Claude Code, Cursor and Codex with provider switching, a live session monitor and token usage in one place. The provider switching is what separates it from the pile of usage-only menu bar widgets. macOS only.

macosmenubarusageprovider-switching
by wangxiajun68 Sep 10, 2026 5/10
app Reddit

Tokens: iOS App and Home Screen Widget for Claude Code Usage

A macOS companion reads Claude Code usage locally and syncs it through the author's own iCloud to an iPhone app with a Home Screen widget. Built for a setup where a Mac mini runs the agent and the phone is the interface. No account and no third-party cloud in the path.

iosusagewidgeticloudremote
by maa1l Sep 10, 2026 6/10
app GitHub

cmux-picker: Click a DOM Element in Chrome, Send It to Your Agent

A Chrome tool that lets you pick any element on a page and forward it, along with a prompt, to a coding agent running in cmux. Closes the gap between seeing a UI bug and describing where it lives. Requires cmux on the receiving end.

chromedomuicmuxbrowser
by scaccogatto Sep 10, 2026 7/10
app GitHub

aitracker: Local-First Token Tracking That Also Distills Sessions into Skills

Tracks tokens and spend across Claude Code, Codex and Cursor, then converts finished sessions into reusable Skills and long-term memory. The distillation step is the interesting half — most trackers stop at reporting numbers. Open source and local-first, with Chinese and English docs.

usageskillsmemorylocal-first
by estelwalks Sep 10, 2026 6/10
app Reddit

Claude Pulse v1.5: Live 5h/7d Usage Rings Inside the Claude Composer

A browser extension that injects usage meters into the claude.ai composer: 5-hour window, 7-day window, a local tiktoken estimate and a countdown to the cheaper cache window. It hooks fetch and XHR through an injected script and passes responses to the content script via postMessage. Knowing where the 5-hour window sits decides whether a long refactor starts now or after reset.

usageextensiontiktokenquota
by Moist_Tonight_3997 Sep 10, 2026 6/10
app GitHub

helm: Personal Task and Accountability System Driven from Claude Code

A task tracker built on Convex that Claude Code operates directly, so tasks are created and closed from inside the session rather than in a separate app. Personal-scale rather than team project management. Requires a Convex deployment.

tasksconvexproductivityaccountability
by AlexCunliffe Sep 10, 2026 5/10
app GitHub

skillsboard: An Agent-Native Skills Registry for Teams

A registry where teams publish and discover Agent Skills, designed to be read by agents rather than only browsed by humans. Free forever per the author. Fills the internal-distribution gap between a personal skills folder and a public marketplace.

skillsregistryteamsdiscovery
by TommyBez Sep 10, 2026 6/10
app GitHub

agent-git: Version, Share and Resume AI Coding Sessions

Treats agent sessions as versioned artifacts you can share and pick back up, across Claude Code, Codex, OpenCode and Cursor. Lets a colleague resume the session that produced a change rather than only reading the diff. Useful for handoffs and for reproducing how something got built.

sessionsversioningsharingresume
by autocatalytic-quartette9513 Sep 10, 2026 7/10
app GitHub

SwooshRouter: Open-Source Gateway for Routing Multiple LLM Providers

A gateway that fronts several model providers behind one unified API, so clients target a single endpoint and routing happens server-side. Open source. Crowded category, but a straightforward self-hosted option.

gatewayroutingprovidersapi
by envielxyz Sep 10, 2026 5/10
app GitHub

claude-approver-d200: Approve Claude Code Permissions from a Deck Key

Maps Claude Code permission requests onto an Ulanzi D200 stream deck: approve, always-allow or deny with a physical key, while the display shows each session's state and context window usage. Turns approval into a glance-and-tap instead of a window switch. Requires the specific hardware.

hardwarepermissionsstream-deckapprovals
by BeeLTL Sep 10, 2026 6/10
app GitHub

sleep-after-claude: Put Your Mac to Sleep When the Session Finishes

A small macOS bash utility that watches a Claude Code session and sleeps the machine once it completes. For long unattended runs you start before leaving. Does one thing, in a shell script you can read in a sitting.

macosautomationpowerunattended
by sambatia Sep 10, 2026 5/10
app GitHub

tallybook: Price Your Sessions from Transcripts and Find the Waste

Reads Claude Code and Codex transcripts off disk, prices each session, and explains in plain English what you overpaid for. The diagnosis angle separates it from trackers that only show a total. Runs locally against files you already have.

costtranscriptsanalysislocal
by magna-nz Sep 10, 2026 6/10
app GitHub

uze: Install Once, Share One Context, Run Your Agents Side by Side

A toolchain that installs multiple coding agents, gives them a shared context, and runs them alongside each other. Aimed at people who switch between agents and are tired of maintaining parallel configs. Early but the shared-context piece is the useful part.

toolchainmulti-agentcontextsetup
by hiukky Sep 10, 2026 6/10
app GitHub

ectype: Read, Redact and Export Sessions from Ten Coding Agents

Reads on-disk sessions from Claude Code, Codex CLI, Gemini CLI, Antigravity, Copilot Chat, Cursor, Cline, Roo Code, Continue and Aider plus three chat apps, with filtering, redaction and export — and can copy a session back into an agent to resume it. CLI and local web UI. The redaction step makes sharing transcripts practical.

sessionsexportredactionmulti-agentresume
by chaybits Sep 10, 2026 7/10
app GitHub

TokenTide: macOS Menu Bar Widget for Codex and Claude Code Quota

Shows remaining quota, weekly utilization and usage history for both Codex and Claude Code from the menu bar. Bilingual Chinese/English. Another entry in a crowded category, distinguished mainly by covering both tools and keeping history.

macosmenubarquotausage
by redbson Sep 10, 2026 5/10
app GitHub

web-agent-mate: Open-Source Chrome Assistant for Coding Agents

A Chrome extension giving Codex, Claude Code and OrcaRouter browser tools and local workspaces, so an agent can act against pages you have open. Open source. Overlaps with headless browser MCP servers but keeps you in your real, logged-in browser.

chromebrowserextensionworkspaces
by wintc23 Sep 10, 2026 6/10
app GitHub

rementum: Self-Hosted Shared Memory with Versioning and Safe Concurrent Writes

Memory infrastructure for agents where knowledge is versioned and concurrent writes resolve without clobbering each other. Self-hosted. The conflict-safe write handling is what most agent memory stores skip and then regret at multi-agent scale.

memoryself-hostedversioningconcurrency
by rementum Sep 10, 2026 6/10
app GitHub

booley: An Open-Source Agentic IDE for RTL Hardware Design

An IDE for register-transfer-level hardware design with agent assistance built in. Niche relative to the usual web and backend tooling, which is exactly why it is worth noting — agentic tooling for HDL work is thin on the ground. Early stage.

hardwarertlideverilogeda
by boldaxolotl Sep 10, 2026 5/10
app GitHub

leash: Talk to Claude Code on Your Own Machine over Telegram

Runs Claude Code locally and exposes it through Telegram with no tunnel, no webhook and no cloud relay in between. That constraint is the design: nothing about your session leaves your machine except the messages you send. Straightforward setup for phone-driven sessions.

telegramremotemobileself-hostedprivacy
by zalogarcia Sep 10, 2026 7/10
app GitHub

tokitoki-windows: 0.5 MB C17 Tray App for Syncing Agent Usage

A Windows tray app written in C17 with no runtime dependency that syncs coding agent usage and cost to Tokitoki. Half a megabyte total. Notable mostly for how small it is next to the Electron alternatives in this category.

windowstrayusagec17lightweight
by tokitoki-dev Sep 10, 2026 5/10
app GitHub

revenant: Reopen Every Crashed Agent Session, Resumed and In Place

Pick a time window, hit revive, and each crashed Claude Code or Codex session reopens in its own terminal tab — resumed, in the correct working directory. Windows, macOS and Linux, with no daemon running in the background. Directly useful after a machine restart or a terminal crash takes out a batch of sessions.

sessionsrecoveryresumecross-platform
by DonPlaton Sep 10, 2026 7/10
app GitHub

llm-usage-tracker: Real-Time Session Analytics with No Telemetry

A macOS desktop and always-on Docker app tracking Claude and OpenAI/Codex quotas plus every agent session in real time: tool calls, files touched, token usage and analytics. Local-first with SQLite, SSE streaming and encrypted credentials, and no telemetry leaving the machine. More depth than a quota widget.

usageanalyticslocal-firstsqlitedocker
by ninedter Sep 10, 2026 6/10
app GitHub

agente-encuesta-hogares: Claude Code Agent for Uruguay Household Survey Reports

A Claude Code agent that produces methodologically rigorous statistical reports from the microdata of Uruguay's INE Continuous Household Survey. The user fills in guided forms instead of writing code, and the agent handles the analysis and write-up. A concrete example of pointing Claude Code at a public statistical dataset as a domain workflow.

data-analysisstatisticsspanishagent
by MCornesLucas Sep 10, 2026 5/10
app GitHub

git-resume-analyzer: Turn Git History Into Resumes and Interview Scripts

Generates job-hunting material — resumes, interview talking points, technical articles — directly from a repository's commit history. The AI reads commits, diffs, and source to infer what problems were solved and how, while the bundled scripts only collect raw data. An interesting inversion of the usual "summarize my repo" tool.

gitresumecareercode-analysis
by uuicdown Sep 10, 2026 6/10
app GitHub

onehand: Native Rust Desktop Host for Agent Client Protocol Sessions

A native desktop host for AI coding agents that speaks the Agent Client Protocol, written in Rust with GPUI. Runs many concurrent sessions against the same project root and includes a lightweight editor and terminal. An alternative to terminal-only workflows when you want several agents side by side.

desktopacprustmulti-session
by jarviisha Sep 10, 2026 7/10
app GitHub

pkgtruth: Catch Hallucinated and Slopsquatted npm Packages Before Install

Checks npm dependencies suggested by AI coding agents against ground truth, flagging packages that do not exist or that squat on a plausible-looking name. Runs before the dependency reaches your lockfile. Addresses a real and growing supply-chain risk in agent-written code.

securitynpmsupply-chainhallucinationdependencies
by hxckya Sep 10, 2026 8/10
app GitHub

api-claws: Agent Skill and TypeScript Quickstart for Hosted Agents

A starter for building an agent harness on Buda's API Claws, combining an agent skill with a runnable TypeScript quickstart. The goal is to drop a hosted AI agent into an existing device, app, or SaaS product without building the loop yourself. Vendor-specific, but the quickstart is a reasonable reference for harness structure.

harnesstypescripthosted-agentsquickstart
by buda-ai Sep 10, 2026 5/10
app Reddit

dif: Git-Native Feature Flags and A/B Tests Claude Code Can Read

A CLI that stores each feature flag or experiment as a Markdown file checked into the repo, then generates a typed client that assigns variants locally with no network call. It also writes dif/context.json so Claude Code starts each session knowing which experiments are active and what earlier ones concluded. dif init installs three project skills for mapping routes to surfaces, authoring flags, and concluding experiments.

feature-flagsab-testingcliskillsgit
by dazog92 Sep 10, 2026 7/10
app GitHub

repomon: Mission Control for a Fleet of Coding Agents Across Repos

A desktop app plus Rust TUI for supervising many AI coding agents (Claude Code, Codex, OpenCode, Cursor, Aider, Antigravity) working across multiple repositories. Sessions are tmux-backed, and agents coordinate through durable "fleet mail" with policy-based supervision. Useful if you run several agents in parallel and want one place to watch and steer them.

orchestrationtuitmuxmulti-agentdesktop-app
by AliHamzaAzam Sep 10, 2026 8/10
app GitHub

braintrust-coding-agent-plugins: Braintrust Plugins for Coding Agents

A plugin collection published by Braintrust, the LLM evaluation platform, aimed at coding agents. The repo description is minimal, so check the source for exactly which agents and workflows are covered. Relevant if you already run Braintrust evals and want them reachable from an agent session.

pluginsbraintrustevalstooling
by braintrustdata Sep 10, 2026 5/10
app GitHub

vir: Distill Claude Code Sessions Into an Obsidian Vault You Own

Processes Claude Code session transcripts into notes in a local Obsidian vault, filtering out routine agent output and keeping the decisions you actually made. The result is a durable, searchable record of project reasoning that outlives the session files. Good fit if you already keep engineering notes in Obsidian.

sessionsobsidiannotesknowledge-management
by djolex999 Sep 10, 2026 7/10
app GitHub

herdr-agent-kind: Show Which Agent Runs in Each Herdr Pane

A small Herdr add-on that detects the agent running in each pane (claude, codex, and others) and publishes it as an $agent_kind token for the sidebar, alongside the agent name. Makes a multiplexed session readable at a glance when you have mixed vendors running side by side. Only useful if you already use Herdr.

herdrtmuxmultiplexermulti-agentui
by gregsantos Sep 10, 2026 5/10
app Reddit

stillpane: Capture Any Mac Window as Markdown + Screenshot for Claude Code

Open-source macOS app that attaches whatever you are looking at to your next Claude Code prompt — press both Option keys and the active window or webpage is captured as a screenshot plus full markdown text. Text comes from the accessibility tree, so content scrolled out of view is included; hold Shift for markdown only. Works across the CLI, desktop app and IDE extensions.

macosscreenshotcontextopen-source
by shipdaily Sep 9, 2026 7/10
app GitHub

vibex: One Workspace for Coding Agents From Prompt to Commit, Desktop to Mobile

Agent workspace that keeps sessions, files and commits under your control rather than a vendor's, and reaches the same work from desktop or phone. Connects to Claude Code, Codex, OpenCode, Pi, Grok, DeepSeek Harness and Antigravity through ACP, so the harness is swappable.

acpmulti-agentworkspacemobile
by vibex-ai Sep 9, 2026 6/10
app GitHub

claude-model-guard: Statusline Alarm for Silent Model Downgrades

Statusline plugin that makes it obvious when Claude Code quietly drops you to a different model or effort level. Renders a theme-proof full-width alarm covering model, effort, thinking level and rate-limit pressure, so a downgrade mid-session is caught instead of being blamed on the model getting worse.

statuslinemonitoringmodel-selectionplugin
by ventusff Sep 9, 2026 7/10
app Reddit

Private-Table Texas Hold'em Web App Built With Claude Code, Now a Business

Build story for an online poker app made for a friend group after their old site shut down, taken from a 40-minute prototype to a paying product. Claude Code handled game logic and front end, with Postgres replacing an early SQLite-plus-ngrok setup and Claude Design plus Gemini used for UI. Worth reading for the progression from pet project to production.

build-storyweb-apppostgrescase-study
by you_are_wrong_tho Sep 9, 2026 5/10
app GitHub

switchboard: Browser Kanban for Every Coding-Agent Session on Your Machine

Single local board showing claude, codex and gemini CLI sessions as kanban cards, each with an attached PTY terminal you can type into. Also surfaces transcripts, health scores and cost per session. Local-only with no backend, so nothing leaves the machine.

kanbansession-managementptylocal-first
by 13angs Sep 9, 2026 7/10
app Reddit

OtoDock: Self-Hosted Company OS Running a Fleet of Claude Code and Codex Agents

Multi-tenant, self-hostable application that runs departments of agents — marketing, engineering, plus a CEO agent that reads each department's morning digest and briefs you. Every agent is a real Claude Code or Codex CLI running as a persistent process, driven by your own subscription or local models.

self-hostedmulti-agentorchestrationopen-source
by dimitrismrtzs Sep 9, 2026 7/10
app GitHub

BurrowTime: Local-First Time Tracking for Developers and Coding Agents

Time tracker that records both your hours and your agents', shipping a CLI, a TUI, agent skills and an MCP server so Claude Code can log its own work. Data format is Watson-compatible, so existing tooling and exports keep working.

time-trackingmcpclilocal-first
by fabean Sep 9, 2026 6/10
app GitHub

wsp: Fork Your Dev Machine to the Cloud for Coding Agents

Provisions cloud machines that mirror your local setup so Claude Code and Codex can work on a real replica of your environment instead of a bare container. Forking takes seconds, which makes throwaway machines per task practical.

cloudenvironmentsdevopssandboxing
by Zingzy Sep 9, 2026 6/10
app GitHub

sbb: Run Several AI Subscriptions as One Team From a Single Terminal

Coordinates Claude Code, Codex, Antigravity and Cursor running on separate accounts as a single crew, driven over tmux with a web console and verified delivery of each task. Aimed at people juggling multiple subscriptions to work around per-account limits.

multi-accounttmuxorchestrationusage-limits
by StevenzUltra Sep 9, 2026 6/10
app GitHub

claude-code-feishu: Keep Steering a Running Claude Code Session From Feishu

Bridge that hands an in-progress Claude Code session to Feishu/Lark so you can start at the desk, follow up from your phone, and return to the same session unchanged. Keeps one continuous conversation rather than spawning a separate mobile session.

feishumobileremote-controlchinese
by ruodou233 Sep 9, 2026 6/10
app GitHub

Sego-Agent: Independent Review and Acceptance Layer for AI-Written Code

Sits after whichever coding agent wrote the code and runs an independent review, producing evidence and an explicit acceptance decision rather than a summary you have to trust. Positioned as the trust layer for teams merging large volumes of AI-generated diffs.

code-reviewverificationqualityci
by 007M7 Sep 9, 2026 6/10
app GitHub

open-computer-use: Focus-Safe Parallel Browser and macOS Automation

Computer-use automation that runs several browser and native macOS tasks at once without stealing your keyboard focus — the usual failure mode when an agent drives a real desktop. Built specifically for Claude Code.

computer-usebrowser-automationmacosparallel
by anpu-ai-official Sep 9, 2026 7/10
app Reddit

Cadence Money: A Budget App Built Almost Entirely With Claude Code

Long, candid account of building an opinionated personal-finance app solo with Claude Code, from years of failed pre-agentic attempts to a shippable product. Notable for the honest cost side — the author describes it displacing most other parts of life — alongside the design and tooling decisions.

build-storycase-studyfintechsolo-dev
by Trav_Hogan Sep 9, 2026 5/10
app GitHub

carl-vibe-kanban: Zero-Dependency Local Kanban Backed by Git Worktrees

Kanban board where each card is a markdown file for one branch, and column state is read live from git worktrees and pull requests instead of a separate database. No login, no server, no dependencies; Claude Code and Codex interact with it via a skill, hooks or MCP.

kanbangitworktreeslocal-first
by LearnPrompt Sep 9, 2026 6/10
app GitHub

gentle-ai: One Configurator for Whichever Coding Agents You Already Use

Sets up Claude Code, Cursor, OpenCode, Codex, Pi and others from a single choice of options: persistent memory, spec-driven development, curated skills, MCP servers, personas and optional bounded review. Open source and deliberately free of agent lock-in.

configurationskillsmcpspec-driven
by Gentleman-Programming Sep 9, 2026 6/10
app GitHub

handraise: macOS Overlay Where Claude Code Agents Raise Their Hand

Liquid Glass overlay that collects the moments your agents need you — questions and pending tasks — into one surface, and sends your answers back into the sessions. Solves the babysitting problem of several agents each blocking on a different terminal.

macosnotificationsmulti-agentui
by Gabriel-Beer Sep 9, 2026 6/10
app GitHub

Ephesus: An Agent Company You Govern as Its Architect

Desktop harness that arranges the coding CLIs you already pay for into a self-coordinating crew, with per-agent memory, mailboxes and desks laid out on a 2D floor plan. Pre-alpha and built in public, so expect rough edges.

multi-agentdesktoporchestrationpre-alpha
by mertefesensoy Sep 9, 2026 5/10
app GitHub

learning-with-claude: Turn Your Own Diffs Into Quizzes

Flips Claude Code into a teaching loop by quizzing you on the code that just landed in your diffs and tracking which areas each developer keeps getting wrong. Aimed at the problem of shipping agent-written code you do not actually understand.

learningcode-reviewdiffsteam
by Tykok Sep 9, 2026 6/10
app Reddit

Centaur: Open-Source Control Plane for Running Your Own Agent Infrastructure

Self-hosted control plane for running Claude Code and other harnesses on infrastructure you own, built for teams but usable solo. The author walks through the reasoning for owning the control plane as agent processes scale, with a long explainer video linked.

self-hostedinfrastructurecontrol-planeopen-source
by bradwmorris Sep 9, 2026 6/10
app GitHub

contexture: Context Store for Coding Agents Using Markdown and Git

Keeps project context as plain markdown in git, retrieved through a catalog and a graph rather than embeddings, so there is no vector database to run or keep in sync. Everything stays diffable and reviewable like the rest of the repo.

contextmemorymarkdowngit
by ayxuerui Sep 9, 2026 6/10
app GitHub

qaping: Agent-Planned QA for Your Game, Run by Real Playtesters

Your coding agent writes the check plan for each patch, human playtesters actually run it, and you get a report back per build. Bridges the gap where automated testing cannot judge whether a game feels right.

qagamestestinghuman-in-the-loop
by alex-durango Sep 9, 2026 5/10
app GitHub

tenx: run many Claude Code agents in parallel git worktrees

A task runner that gives every parallel task its own git worktree and its own Claude Code agent. Its main contribution is visibility: a dashboard-style view that surfaces which of the running agents is actually blocked and waiting on you. Useful if you routinely juggle several agent sessions and lose track of which needs input.

worktreesparallel-agentsorchestrationcli
by aluedeke Sep 9, 2026 8/10
app GitHub

minos: report what a Claude Code session actually changed

Audits a Claude Code session and reports the full set of file changes it made. The interesting part is that it separates changes you explicitly asked for from changes the agent applied on its own initiative. Good safety net for reviewing long unattended sessions before committing.

auditdiffsession-reviewsafety
by AraneaDev Sep 9, 2026 8/10
app Reddit

brnrd: turn Claude Code into a resident, repo-scoped process

Wraps Claude Code in a longer-lived process that belongs to the repo rather than to one terminal session, owning conversation, task identity, repo context and execution environment. You can walk away from the terminal and keep steering the same work from Telegram or a web dashboard, and the underlying CLI can restart without losing agent identity. Supports worktrees, Docker, and Codex as an alternative harness.

daemonremote-controltelegramorchestrationworktrees
by Disastrous-Radio-732 Sep 9, 2026 7/10
app GitHub

omniline: one statusline framework for every AI coding CLI

A statusline framework that shares rendering and data-lookup primitives across harnesses, with one thin adapter per CLI so the same statusline config works in Claude Code and elsewhere. Python 3.8+ with zero dependencies. Worth a look if you maintain statusline setups across more than one coding agent.

statuslineclipythoncustomization
by Deetss Sep 9, 2026 7/10
app GitHub

bebok: local-first headless coding agent in Rust with an MCP bridge

A headless local-first coding agent written in Rust (axum, tokio, rmcp, portable-pty) exposed over HTTP + SSE, with an Angular 20 zoneless client and a Tauri 2 desktop shell. Supports Anthropic alongside OpenAI, Z.ai and Ollama, and includes an MCP bridge, a permission engine and a PTY terminal. An alternative harness rather than a Claude Code add-on, but the MCP and permission plumbing is worth studying.

rustagent-harnessmcptaurilocal-first
by henrykbrzoska Sep 9, 2026 6/10
app GitHub

chute: Traffic Lights in the macOS Menu Bar for Your Coding Agent Sessions

A menu bar app that shows at a glance which Claude Code or Codex session is blocked, working, or done. Useful when you run several agent sessions in parallel and keep tabbing between terminals to find the one waiting on you. Offline, no telemetry, MIT licensed.

macosmenubarsessionsmonitoring
by avaluev Sep 9, 2026 7/10
app GitHub

rigsmith: Four Single-Binary CLIs Covering the Whole Dev Loop

A family of single-binary CLIs that wrap your stack from the inner build/test loop out to changesets, releases and your Claude Code setup. Native builds for macOS, Linux and Windows with no runtime to install. Useful if you want one consistent command surface an agent can drive.

clibuildreleasetooling
by rigsmith Sep 9, 2026 6/10
app GitHub

tokenchit: Render a Stat Card of Your Local Agent Usage Into Your Repo

Reads the logs your AI coding agent already writes locally and renders a stat card you can commit into the repo. Gives a lightweight, shareable view of how much agent work went into a project. No account or API needed.

usagestatslogsbadge
by iyashjayesh Sep 9, 2026 5/10
app GitHub

agent-notch: A Local-First macOS Notch Workspace for Coding Agents

Turns the MacBook notch area into a workspace for Claude Code, Codex, CodeBuddy and other coding agents. Keeps session state visible without giving up screen real estate to another window. Local-first with no cloud component.

macosnotchuisessions
by lihao505 Sep 9, 2026 6/10
app GitHub

fountain: Run Claude Code, Codex and Gemini CLI as an HTTP API

Wraps each coding agent CLI behind an HTTP API, with every agent isolated in its own sandbox. Makes it possible to call agents from other services or scripts instead of driving them interactively. Useful building block for automation and CI.

http-apisandboxautomationmulti-agent
by BinaryBourbon Sep 9, 2026 7/10
app GitHub

brain-kit: A Persistent Memory and Consolidation Layer for Agent CLIs

Adds durable memory to Claude Code and other agent CLIs, storing everything as plain Markdown on your machine with a consolidation step that keeps it from sprawling. No API key or hosted service involved. Aimed at the recurring problem of agents forgetting what happened last session.

memorymarkdownlocal-firstcontext
by layersistem Sep 9, 2026 7/10
app GitHub

HarnessDesk: An Open-Source Control Plane for Agents You Own

Runs Codex, Claude Code, Gemini, Cursor and ACP agents side by side with shared history, permissions, handoffs and audit logs. Aims to be the single place you supervise a fleet rather than juggling per-tool UIs. Open source and self-hosted.

control-planemulti-agentauditself-hosted
by HarnessDesk Sep 9, 2026 7/10
app GitHub

mayak: A FastAPI Backend Template Meant to Be Maintained by Agents

A FastAPI project template structured for services that coding agents will build and keep maintaining, rather than one optimized purely for human readers. Conventions and layout are chosen to be unambiguous to an agent. Good starting point for agent-authored backends.

fastapitemplatepythonbackend
by LamantinAI Sep 9, 2026 5/10
app GitHub

agent-environment-doctor: Diagnose What Your Agent Environment Actually Is

A read-only diagnostic that reports the effective runtime state of Claude Code and Codex environments — what is actually loaded and configured, not what you think is. Useful when an agent behaves differently across machines or a config change silently did nothing. Makes no modifications.

diagnosticsconfigtroubleshootingread-only
by becky-exists Sep 9, 2026 6/10
app GitHub

claude-codex-usage: Multi-Account Quota Gauges for Claude Code in tmux

A single Go binary that displays Claude Code and Codex usage in tmux: per-account gauges, rate limits and reset times, always visible. No runtime dependencies to install. Useful if you juggle several accounts and want to see which one still has headroom.

usagetmuxgorate-limits
by n-hiraha Sep 9, 2026 6/10
app GitHub

orbit: Durable, Intent-Tracked Project Management for Agentic Work

Project management built around tracking the intent behind work rather than just tasks, so context survives across agent sessions. Aimed at developers whose plans keep getting lost between runs. Durable storage rather than in-context state.

project-managementintentdurableplanning
by constellation-works Sep 9, 2026 5/10
app GitHub

Halowake: A Local-First Companion for Codex, Claude Code and OpenCode

Desktop companion covering sessions, Git state, code review and development processes for several coding agents including Claude Code, Codex, OpenCode and Antigravity. Local-first with no hosted backend. Aims to be the place you supervise work rather than the terminal.

desktopsessionscode-reviewlocal-first
by zhkai-ybwn Sep 9, 2026 6/10
app GitHub

skill_manager: A Local Panel That Installs Claude Code Skills From GitHub

One-click installs skills straight from GitHub, manages them via symlinks so nothing is copied, and aggregates newly published skills across the web daily. Pure Node with zero dependencies. Solves the growing problem of tracking and organizing dozens of installed skills.

skillspackage-managernodediscovery
by ssssssanjiu Sep 9, 2026 7/10
app GitHub

switchboard: Run Multiple Claude, ChatGPT and Codex Accounts Side by Side

Gives each account its own macOS window with its own CLI login and a live rate-limit bar. Lets you move work to whichever account still has quota without logging in and out. Useful for anyone with a personal and a work subscription.

macosaccountsrate-limitsmulti-session
by shayaansultan Sep 9, 2026 6/10
app GitHub

agentfence: Measure Which Agent Boundary Settings Actually Block Anything

A regression harness that empirically tests whether a coding agent's permission and boundary settings really prevent the actions they claim to. Turns security configuration from a belief into an observation. Bilingual Korean/English documentation.

securitypermissionstestingsandbox
by WTCYJ Sep 9, 2026 6/10
app GitHub

kavranta: Keep Protected Env Vars Out of Your Agent's Reach

Manages project environment variables locally while withholding values you mark as protected from AI-agent workflows. Lets an agent run your app without ever seeing production credentials. Addresses a common gap when agents get shell access.

secretsenv-varssecuritylocal
by haechan1103 Sep 9, 2026 6/10
app GitHub

deck: An AI-Native Board-Based Software Delivery Workflow for Teams

A delivery board designed around agents doing the work rather than bolted onto a human-first tracker, pitched as a Warp alternative. Team-oriented rather than single-developer. Worth a look if your kanban tool fights your agent workflow.

kanbandeliveryteamsworkflow
by fishuke Sep 9, 2026 5/10
app GitHub

theo: A Self-Hosted Assistant That Finishes Long-Running Work

A personal assistant you run yourself that remembers what you tell it, carries long-running tasks through to a finished result, and reaches you on Telegram or in your terminal. Aimed at work that outlasts a single interactive session. Self-hosted with no cloud dependency.

assistanttelegramself-hostedmemory
by fpl0 Sep 9, 2026 5/10
app GitHub

tet: Every Project's Terminals and Git State on One Screen

A desktop workspace for coding agents that puts each project's terminals alongside its git state in a single view. Removes the tab-hunting that comes with running agents across several repos. Desktop native.

desktopterminalsgitworkspace
by samil-kale Sep 9, 2026 5/10
app GitHub

messrequess: A TUI for GitLab Merge Requests With One-Key Claude Sessions

Shows your GitLab merge requests in a terminal dashboard focused on whose turn it is to act, and launches a Claude session preloaded with the full MR context from a single keypress. Removes the copy-paste step between review tool and agent. Terminal native.

gitlabcode-reviewtuimerge-requests
by piligrimnick Sep 9, 2026 6/10
app GitHub

claude-session-manager: Name, Browse and Resume Sessions From VS Code

A VS Code sidebar that names your Claude Code and Codex CLI sessions, lets you browse them and resume any one with a click. Includes auto-mode resume, session backup and switching between tools. Fixes the problem of forgetting which session held the work you want.

vscodesessionsresumebackup
by CoreyLyu76 Sep 9, 2026 6/10
app GitHub

agent-radar: Rank New Claude Skills and MCP Servers, Catch Star Farming

Scans GitHub for new and rising Claude skills, subagents and MCP servers, scoring them on momentum, trust, and whether the repository actually contains what its description claims. Explicitly detects star-farmed repos. Useful given how much of the skill ecosystem is now noise.

discoverygithubtrustskillsmcp
by Malpiedi Sep 9, 2026 7/10
app Reddit

Collins: A GTK4 Native Linux Session Manager for Claude Code

A Linux-native session manager built after the author found the desktop app and other Linux options lacking, forked from agent-session-manager. Manages multiple sessions including existing ones, has a GUI prompt editor with saved drafts, a model picker, automatic PR tracking via gh, attachments panel, git panel and split terminal. Works with subscriptions, no API key needed.

linuxgtk4sessionsgui
by g_hack_it Sep 9, 2026 6/10
app GitHub

lark-echo: Bridge Feishu/Lark Group Chats to Local Agent Sessions

Connects Feishu or Lark group chats to agent sessions running on your machine, so a team can drive Claude Code or Codex from the chat they already use. Keeps the agent local while the interface is remote. Also supports pi.

feishularkchatremote
by san-tian Sep 9, 2026 5/10
app GitHub

herdr-draft: A One-Submit New-Session Dialog for herdr

A herdr plugin that collects the Linear issue, worktree, placement, agent kind, clauth account and initial prompt in a single dialog before launching a session. Compresses a multi-step setup into one form. Only useful if you already run herdr.

herdrlinearworktreessessions
by ZviBaratz Sep 9, 2026 5/10
app GitHub

shipward: A Kanban Where Done Requires a Command That Actually Passes

A local kanban board for one developer and their coding agent, where a card can only reach done when the command you declared for it passes. Removes the gap between an agent saying it finished and the work being verifiably finished. Runs entirely locally.

kanbanverificationlocalsingle-dev
by albertoclemente Sep 9, 2026 6/10
app GitHub

ios-aso-copilot: Free App Store Optimization and Keyword Ranking Copilot

An ASO copilot for iOS covering keyword rankings and growth analysis, positioned as a free alternative to the Astro MCP service. Handles the research side of app store listing work. Useful for indie developers shipping iOS apps.

asoiosapp-storekeywords
by rusel95 Sep 9, 2026 5/10
app GitHub

agent-pipline-compressor: Deterministic, Recoverable Compression of Bash Output

Compresses noisy Bash output from Codex and Claude Code before it eats your context, locally and deterministically, with the original recoverable. Unlike summarization it does not lose information you might need later. Targets build and test logs specifically.

contextcompressionbashlogs
by DKotsyuba Sep 9, 2026 6/10
app GitHub

fonendo: A Stethoscope for Claude Code's Agentic Loop

Captures raw API traffic, does token accounting, and provides a live web inspector showing what Claude Code is actually sending and receiving each turn. The right tool when you want to know where your tokens went rather than guess. Useful for debugging cache behaviour and context bloat.

observabilitytokensdebugginginspector
by lussoluca Sep 9, 2026 7/10
app GitHub

geiger: One Read-Only Command to Inventory Every Agent on a Machine

Sweeps a machine and lists every coding agent, MCP server, plugin and AI extension installed on it. Read-only, so it is safe to run anywhere including a machine you have inherited. Useful for security review and for finding the MCP server you forgot you installed.

inventorysecurityauditmcpread-only
by Atomburstofficial Sep 9, 2026 7/10
app GitHub

social-flow: A Channel-Based Content Pipeline With 46 MCP Tools

A Claude Code plugin running short-form and long-form social content end to end: storyboarding behind adversarial quality gates, video production, human-approved publishing, and autonomous growth loops. Ships its own MCP server exposing 46 tools. Substantially more complete than a posting integration.

socialvideocontentmcppipeline
by ttalkkaklab Sep 9, 2026 6/10
app GitHub

AgentWhileTrue: Resume a Rate-Limited Session, But Only When Safe

Watches Claude Code and Codex quota inside KDE Konsole and resumes a rate-limited session automatically — but only when terminal, process identity, prompt, quota and policy all agree it should. The multi-signal check is what keeps it from resuming the wrong thing. Python 3.12+ with no runtime dependencies.

rate-limitsautomationkderesume
by marcelpetrick Sep 9, 2026 6/10
app GitHub

lockout: A Mutex So Parallel Agents Stop Thrashing Your Machine on Builds

A job queue that serializes expensive compilation, keeping several agents' cargo builds from competing for the same cores. One dependency-free bash script for macOS and Linux, bash 3.2 and up. Small, obvious, and fixes a real problem once you run more than two agents.

buildrustcargoparallel-agentsbash
by ajmwagar Sep 9, 2026 6/10
app GitHub

claude-cli: Docker Wrapper for Running Claude Code in a Container

A Docker wrapper around the Claude Code CLI that handles directory mounts and environment config setup for you. Useful for keeping Claude Code isolated from the host or reproducing the same setup across machines. Low-ceremony alternative to hand-rolling your own devcontainer.

dockerclisandboxtooling
by weaponsforge Sep 9, 2026 6/10
app GitHub

CodexIsland: AI usage limits displayed in the MacBook notch

A macOS menu-bar-style app that renders your AI coding usage limits inside the MacBook notch area, so quota state is always visible without opening a terminal. Aimed at people running long agent sessions who keep hitting rate windows unexpectedly. Small, single-purpose utility.

macosusage-limitsmonitoringmenu-bar
by ericjypark Sep 9, 2026 5/10
app Reddit

OpenCode AgentDeck: Six AI coding agents on one Stream Deck

A Stream Deck setup that fronts six concurrent AI coding agents from a single physical panel, built around OpenCode. Each key maps to an agent so you can switch focus and monitor state without window juggling. Relevant to anyone running several agent sessions in parallel.

stream-deckopencodemulti-agenthardware
by darkmatter2222 Sep 9, 2026 5/10
app GitHub

claude-local-nexus: Dockerized local AI orchestration platform

A sovereign, reproducible orchestration stack running entirely on your own machine: Claude Code alongside Ollama, LiteLLM, adaptive routers, a Redis cache, PostgreSQL, and Langfuse for tracing. Local and cloud models are exposed through one unified interface. Documentation is in French; useful if you want observability and model routing without a SaaS dependency.

orchestrationdockerollamalitellmobservability
by KinSushi Sep 9, 2026 6/10
app Reddit

AMA: I burned 500M tokens optimizing token usage.

I spent most of the weekend + over 500M tokens auditing and optimizing my token usage. I mostly work in the Claude Code app and have Claude dispatch to CODEX for code reviews; sometimes work direct...

hooktestingreview
by Individual_Ideal Sep 8, 2026 9/10
app Reddit

Pre-Flight prompt for all my projects

# PRE-LAUNCH INSTRUCTION SET FOR AGENT DEVELOPMENT WORK Read this fully before your first action. Return the §14 pre-flight response, then wait. --- ## §1 DIAGNOSE BEFORE YOU CHANGE Reproduce the p...

config
by Darkcraft00 Sep 8, 2026 5/10
app Reddit

Functionality is such a breeze, while design is so frustrating

I have been having fun building myself tools that better suit my use case. I built myself a cocktail app and a couple friends wanted access, so I put it on App Store, but my pride required that I i...

skill
by Next_Category5789 Sep 8, 2026 6/10
app Reddit

Heavy Cowork user here; how to best set myself up for Claude Code?

I've heavily invested in setting up my Cowork workspace (following Jeff Su's tutorials ) and regularly reach the weekly usage limit. I want to start building simple things for myself and potentiall...

mcpskillworkflowautomationclaude.md
by the_law_talking_guy Sep 8, 2026 10/10
app Reddit

How Do You Review Claude Codes Feedback

I love Claude and I would even use it before dumping one into the toilet. It is an awesome tool and is even more awesome if someone knows what he is typing into it! That leads me to my questions an...

review
by essenkochtsichselbst Sep 8, 2026 7/10
app Reddit

I tested whether a bigger CLAUDE.md could result in more errors...

TL;DR: Given the size of my project(s), I was wondering if a bigger CLAUDE.md could increase p(error). I use Claude's CLI to run an experiment on different sized CLAUDE.md files. I thought there wo...

claude.mdtesting
by TarzanoftheJungle Sep 8, 2026 6/10
app GitHub

thalamus: Federated Graph Memory for Coding Agents

A shared memory layer that stores agent knowledge as a federated graph rather than flat files. It adds a trust model so facts from different sources carry different weight, and a measured utility loop that scores whether stored memories actually helped. Worth a look if you have outgrown append-only CLAUDE.md memory.

memoryknowledge-graphagentsfederated
by Ybx-jp Sep 5, 2026 6/10
app GitHub

jarvis-workspace: Local Web Cockpit for Running Several Coding Agents Side by Side

A self-hosted web UI that runs multiple AI coding agents in parallel panes so you can watch and steer them from one screen. It runs on your machine with your own API keys — nothing is proxied through a third party. Handy if you routinely juggle several agent sessions across terminals.

multi-agentself-hosteddashboardorchestration
by stiifff Sep 5, 2026 7/10
app GitHub

Pallium: Local Messaging and Searchable Session History for Coding Agents

Gives coding agents a local message bus plus a searchable archive of past sessions. Agents can pass messages to each other, and you can query what happened in earlier runs instead of scrolling terminal scrollback. Aimed at multi-agent setups where context keeps getting lost between sessions.

session-historysearchmulti-agentmessaginglocal
by rore Sep 5, 2026 6/10
app GitHub

fragua: AI-Native PCB Design Where the Agent Drives the Board

An electronics design tool built around an agent loop: it takes a schematic through routing to a fab-ready zip while the human watches and steers. Rather than bolting a chat window onto an existing EDA suite, the whole flow is designed for agent authorship. A concrete example of pushing coding agents outside software.

pcbhardwareedaagent-drivendesign
by mentasystems Sep 5, 2026 7/10
app GitHub

ai-slop-linter: Flag AI-Writing Tells in Commits, PRs, and Docs

A linter that scans commit messages, PR descriptions, and documentation for the stylistic tells of generated prose. It deliberately does not try to classify authorship — it just surfaces the specific patterns so you can decide. Useful for teams that want agent output to read like the rest of their repo.

linterwritingcommitspull-requestsdocs
by Bubblegunn Sep 5, 2026 7/10
app GitHub

canary: A Pixel-Art Bird That Wilts as You Work

A status line widget for Claude Code and your shell prompt that renders a pixel-art canary in UTF-8 block characters, drooping as your session wears on. Zero dependencies and no API calls — it reads local state only. Pure whimsy, but a genuinely lightweight example of a custom status line.

statuslineterminalascii-artzero-deps
by thousandflowers Sep 5, 2026 6/10
app GitHub

simple-host: Deploy Websites Straight from Your Coding Agent

A one-command install that lets Claude Code, Codex, or Cursor deploy a site to simple-host.app without leaving the session. Beyond static hosting it provides a per-site backend with state, collections, private pages, and templates. Aimed at the gap between "the agent built a site" and "the site is live."

deploymenthostingstatic-sitebackend
by vineetu Sep 5, 2026 6/10
app GitHub

silex-forge: Team HTML Artifact Host with a Claude Plugin

A hosting engine for the HTML artifacts your team's agents produce, deployed to Cloudflare Pages with Cloudflare Access in front and shareable links out. Ships as a Claude plugin so a generated page becomes a URL your teammates can open without a manual deploy step.

artifactscloudflarepluginhosting
by go-silex Sep 5, 2026 6/10
app GitHub

claude-dev-suite: Agents, MCP Servers, Skills and a Visual Dashboard

An MIT-licensed bundle that packages specialized subagents, MCP servers and skills together with a dashboard for watching them run. Useful if you would rather install one curated set than assemble your Claude Code extensions piece by piece.

suiteagentsmcpdashboardopen-source
by claude-dev-suite Sep 5, 2026 6/10
app GitHub

claude-sesh-mover: Import, Export and Migrate Claude Code Sessions

A Claude Code plugin that moves sessions between profiles, containers and machines. Handy if you develop across a laptop and a dev box, or run Claude inside containers and want conversation history to survive the jump.

sessionspluginmigrationportability
by Sertelegger Sep 5, 2026 6/10
app GitHub

remarkable-send: Markdown to a Typeset reMarkable PDF in One Command

A PDF pipeline tuned for e-ink: 12pt typography, halftoned images and a measured table of contents, so markdown arrives on a reMarkable actually readable rather than shrunk to fit. Ships as both a CLI and an agent skill, so Claude can send you a document to read away from the screen.

remarkablepdfe-inkcliskill
by forcewake Sep 5, 2026 6/10
app GitHub

Replay: Find the Turn Your Agent's Prompt Cache Broke and What It Cost

Analyzes a coding agent session to pinpoint the exact turn where the prompt cache was invalidated, what that cost you, and what a better context layout would have saved instead. Runs entirely locally, which makes it usable on sessions you would not upload anywhere.

prompt-cachecostanalysislocalobservability
by RedRobotKK Sep 5, 2026 8/10
app GitHub

Phishing-Triage-Assistant: Local Bilingual Email Triage Built with Claude Code

A rule-based phishing triage tool covering SPF/DKIM/DMARC verification, lookalike domain detection and BEC patterns, with findings explained in plain English and Spanish. Detection is heuristic and fully local — no email content leaves the machine — and the repo doubles as a worked example of a Claude Code-built security tool.

securityphishingemaillocalbilingual
by Rojad09 Sep 5, 2026 6/10
app GitHub

vibebuddy: Watch and Approve Your Coding Agents from an iPhone

An iOS app for supervising coding agents while away from the desk: a session overview, push notifications when an agent needs you, command approvals straight from the lock screen, and voice conversation. Aimed at long unattended runs where the bottleneck is you not being at the keyboard.

iosmobilemonitoringapprovalsnotifications
by semantic-craft Sep 5, 2026 7/10
app GitHub

NautGate: Memory-Aware LLM Gateway with Per-Request Model and Cost Proof

A gateway that routes Claude Code, Codex and Pi to whichever model you choose, including a local one, while carrying memory across requests. The distinguishing feature is auditability: for any answer you can show which model produced it, what context it saw, and what it cost.

gatewayroutinglocal-llmmemorycost
by 48Nauts-Operator Sep 5, 2026 7/10
app Reddit

pdfvision: A CLI That Finds and Crops PDF Tables for Claude Code

pdfvision searches a PDF's text layer first, returns each match with its page and a crop-ready region grown to the containing table row, then renders just that region as a high-DPI PNG. Every page carries quality signals naming the specific risk (scanned page, broken font map, flattened table). Runs via npx or as an MCP server; the demo session kept context at 4%.

pdfclimcptoken-efficiencytables
by yamadashy Sep 5, 2026 8/10
app Reddit

GNOME Shell Extension Showing Remaining Codex and Claude Usage

A top-bar extension displaying Codex and Claude usage as a percentage of the 5-hour or weekly window. Clicking opens a popup with both windows per service, reset times, model-specific caps (Opus/Sonnet/Fable weekly), and credits. It reads the credential files Codex CLI and Claude Code already keep on disk and calls the same endpoints /status and /usage use — no extra sign-in.

gnomelinuxusage-limitsmonitoring
by azonsea Sep 5, 2026 7/10
app GitHub

habitusx: Tracking What Happens to AI-Written Code After It Lands

The AI Code Outcomes Index measures revert rate, PR acceptance, and code survival broken down by agent, language, and repository, compared against a human baseline. Continuous, vendor-neutral, with a published methodology — useful evidence when arguing about whether agent-written code actually holds up.

benchmarkscode-qualityresearchmetrics
by ptengelmann Sep 5, 2026 6/10
app GitHub

revdiff: Terminal UI for Reviewing Diffs With Inline Annotations

A TUI for reviewing diffs, files, and documents where you attach annotations inline as you read. Handy as a human review surface over agent-generated changes, where a browser PR view is heavier than you want.

tuicode-reviewdiffannotations
by umputun Sep 5, 2026 5/10
app GitHub

frostagent: Deny-by-Default Capability Linter for MCP, Hooks and Skills

A one-screen policy declares what your agent's tools are allowed to do; frostagent fails the check on anything outside it, across MCP servers, hooks, permissions, and skills. A lockfile additionally fails when a tool's definition changes under you — the supply-chain case most agent setups miss.

securitymcppermissionslintersupply-chain
by keithadler Sep 5, 2026 8/10
app GitHub

savemytokens: A Capacity Scheduler for Claude Code

Schedules Claude Code work against your available capacity so runs land inside usage windows rather than stalling halfway through when a limit hits.

usage-limitsschedulingtoken-efficiency
by offbeatport Sep 5, 2026 6/10
app GitHub

AUTOPILOT: Autonomous Claude Code Agent With Gated, Verified Changes

Point it at any repository: it takes a backup, builds an understanding of the codebase, then ships improvements behind verification gates, with a live local dashboard showing what it is doing. TypeScript, public alpha.

autonomousdashboardtypescriptverification
by M-A-S-T-E-R-M-I-N-D Sep 5, 2026 6/10
app GitHub

swift-agent-session: Agent-Agnostic Reader for Coding-Agent Transcripts

A tiny, dependency-free reader that maps any terminal coding agent's on-disk session onto one shared model — activity timeline, token and cost telemetry, edited-files and to-do roll-ups — so review tooling looks the same across agents. Read-only, no network, no telemetry.

sessionstelemetryswiftread-only
by Sidewatch Sep 5, 2026 7/10
app GitHub

meshify: 3D Model Optimization Toolkit and CLI Built for AI Agents

Mesh simplification, part splitting, texturing, format conversion, LOD generation, and web delivery compression, reading glb/gltf/obj/stl/ply plus STEP CAD. Every command emits a structured meshify.report/v1 manifest so an agent can act on results rather than parse prose.

3dclistructured-outputoptimization
by lxie-leo Sep 5, 2026 5/10
app GitHub

terseai: Token Monitor With a Budget Circuit Breaker for Coding Agents

Live token, cost, and burn-rate monitoring across eight AI coding agents on macOS and Windows, with a budget circuit breaker that stops a runaway agent before the next API call rather than after the bill. Also includes an MCP manager and on-device prompt compression claiming 40-70% reduction.

monitoringcost-trackingcircuit-breakerprompt-compression
by Terse-AI Sep 5, 2026 7/10
app GitHub

solgate: Local Gateway Putting Other Frontier Models Inside Claude Code

A local gateway exposing GPT-6 Astra, Sol, Terra, and Luna inside Claude Code, with rolling context, explicit model routing, and fallback that is visible rather than silent. For multi-model workflows where you want one harness and several backends.

gatewaymodel-routingmulti-modelfallback
by VoidLight00 Sep 5, 2026 6/10
app GitHub

ClaudeFleetBar: macOS Menu Bar Quota View for Every Claude Account

Shows live usage quota for each of your Claude Code accounts — 5-hour and weekly windows, reset countdowns, and a recommendation for which account to run next. For people juggling several subscriptions.

macosmenu-barusage-limitsmulti-account
by mehedi1320504 Sep 5, 2026 6/10
app GitHub

Pulse: Local-First Token and Cost Analytics for Claude Code, in Rust

Tracks tokens, costs, cache efficiency, and account limits for Claude Code, OpenAI Codex, and OpenCode, entirely locally. Built with Rust and Tauri, with optional Discord Rich Presence. Cache efficiency in particular is a number most usage trackers skip.

analyticsrusttauricache-efficiencylocal-first
by xt0n1-t3ch Sep 5, 2026 7/10
app GitHub

Wonder-Pill: Turn Confusing Questions Into Interactive Mind Maps

Instead of answering a muddled question directly, it decomposes it into an interactive mind map with Claude, so you can see the structure of what you are actually asking before committing to an answer.

mind-mapexplorationuilearning
by maravil5768 Sep 5, 2026 5/10
app GitHub

agent-bridge: Self-Hosted Runtime Keeping Agent Workstreams in Telegram

An open-source, self-hosted runtime for Codex, Claude Code, Cursor, Antigravity/Agy, and Grok Build that keeps durable coding-agent workstreams reachable from Telegram or Discord. Durability across disconnects is the point, not just chat relaying.

self-hostedtelegramdiscordremote-agents
by Farstax Sep 5, 2026 6/10
app GitHub

Stroq: Local Action Firewall That Taints and Blocks Agent Follow-Ups

Scans everything a coding agent reads, marks the session as tainted when it ingests something suspicious, and blocks dangerous follow-up actions. A direct, practical defense against prompt injection arriving through fetched files and pages.

securityprompt-injectionfirewalltaint-tracking
by AGGIB Sep 5, 2026 8/10
app GitHub

claude-telegram-bridge: Multi-Tenant Telegram Chat on Your Own Plan

Chat with Claude Code from Telegram using your own Pro, Max, or Team subscription, with live streaming responses, multi-tenant account support, and session management. Distinct from other Telegram bridges in handling multiple accounts.

telegramremote-agentsstreamingmulti-tenant
by maleon17 Sep 5, 2026 6/10
app GitHub

agent-lock: Re-Asks for Trust When a Hook or MCP Command Changes

Pins the files your coding agents obey. The built-in trust prompt asks once, before you have read anything; agent-lock asks again at the moment a hook, task, or MCP command actually changes — which is when the risk appears.

securityhooksmcptrustintegrity
by ZeiProX76 Sep 5, 2026 7/10
app GitHub

wikify-repo: Compile a Codebase Into a Grounded Markdown Wiki

Compiles any codebase into a markdown wiki meant to be trustworthy as agent context: SCIP symbol resolution grounds the claims and a citation linter keeps them honest. Output is plain markdown you own, with no graph database or SaaS in the loop.

documentationwikiscipagent-context
by vlasenkoalexey Sep 5, 2026 7/10
app GitHub

agmsg: Cross-Vendor Messaging Between CLI Coding Agents

Lets Claude Code, Codex, Gemini and Copilot CLI agents message each other as one team, so work can be handed between vendors mid-task. Implemented in bash and SQLite with no daemon and no framework, which makes it easy to inspect and hard to break.

multi-agentmessagingcross-vendorsqlite
by fujibee Sep 5, 2026 7/10
app GitHub

moonstack: One-Click Lunar Eclipse RAW Stacking with a Claude Code Skill

An astrophotography pipeline that stacks lunar eclipse RAW frames from any camera brand, handling frame rejection, phase grouping, HDR-aware stacking and sliver rescue, plus PixInsight and Photoshop automation. It ships a Claude Code skill so the whole pipeline can be driven conversationally. Useful mainly as an example of wrapping a deep domain workflow in a skill.

skillastrophotographyimage-processingautomation
by mtang724 Sep 5, 2026 5/10
app Reddit

Week 6 of Vibecoding an MMO: Player Numbers and Lessons

A weekly devlog from someone building an MMO almost entirely through AI-assisted coding, covering player acquisition numbers, what the model handled well, and gameplay updates. The interesting part is the feedback loop: following player feedback doubled average playtime, and the author is candid about where the approach strains.

devloggame-devvibe-coding
by Electrical-Pig Sep 5, 2026 5/10
app GitHub

herdr-bridge: View a Remote herdr Agent Inside a Local Pane

A bridge that surfaces an agent running on a remote machine inside your local herdr sidebar, so several machines' agents live in one pane. Niche unless you already use herdr, but a clean example of multiplexing agent sessions across hosts.

multi-agentremotetuiherdr
by stfl Sep 5, 2026 5/10
app GitHub

shipcheck: App Store and Play Rejection-Risk Checker for React Native

A Claude Code plugin that scans React Native and Expo apps for the things that get builds rejected by the App Store or Google Play before you submit. Saves a review cycle by catching policy and metadata problems while the code is still in front of you.

pluginreact-nativeexpoapp-store
by BakerVentures Sep 5, 2026 6/10
app GitHub

codex-claude-plugin: Call Claude Code From Inside OpenAI Codex

A plugin that lets you invoke Claude Code from within OpenAI Codex by shelling out to the claude CLI, so no API key is needed and your existing subscription is used. Read-only by default and works on macOS, Windows and Linux. Handy for getting a second model's read on a change without leaving the first tool.

plugincodexcliinterop
by k3nmastel2 Sep 5, 2026 6/10
app Reddit

A Modular Key-and-Knob Device for Running AI Automations

A physical macropad-style controller where each key and knob can be bound to an AI automation or shortcut on your computer, with a companion app for visual configuration. Designed and built by the poster with Claude writing much of the code.

hardwareautomationmacropadbuilt-with-claude
by mehdi-33 Sep 5, 2026 5/10
app GitHub

loupe: Document and Site Review Tool for Humans Working With AI Agents

A review tool built for the human half of the loop: you look over documents and sites that agents produced, and loupe structures that pass. Fills the gap where agent output is voluminous enough that ad-hoc review misses things.

reviewdocumentshuman-in-the-loop
by ubermuda Sep 5, 2026 5/10
app GitHub

primer: macOS Scratchpad That Turns Unknown Terms Into Study Guides

A menu bar scratchpad for capturing terms you do not understand yet. Each capture files itself under a topic, and a headless Claude Code run expands any selection into an illustrated study guide. A nice pattern for using headless Claude Code as a background worker behind a native app.

macosheadlesslearningmenu-bar
by karimbabasf Sep 5, 2026 6/10
app GitHub

agent-rules-lint: Lint CLAUDE.md, AGENTS.md, Cursor and Copilot Rules

A linter for the instruction files that steer coding agents, covering AGENTS.md, CLAUDE.md, Cursor rules and Copilot instructions. Catches the ambiguity and unsafe guidance that make agents behave badly, in the one class of file nobody currently reviews.

lintclaude-mdagents-mdsafety
by Uky0Yang Sep 5, 2026 7/10
app GitHub

video-study-pipeline: Turn YouTube and Bilibili Videos Into Study Notes

A pipeline that converts videos into illustrated study notes with searchable text, subtitles, playback links back to the source timestamp, printable PDFs and presentation pages. Useful for turning long talks into something you can actually revisit.

videonotesyoutubebilibili
by cdy1206 Sep 5, 2026 5/10
app GitHub

hub-cc: Local Control Plane for Switching Claude Code LLM Gateways

A local control plane for Claude Code on Windows and macOS that lets you switch LLM gateways in one click behind a fixed endpoint. Includes SSE keepalive proxies, key pools with live balances, GitHub accounts with TOTP, a statusline and Telegram remote control. Heavy, but aimed at people juggling multiple providers and keys.

control-planegatewayproxystatusline
by WormAlien Sep 5, 2026 6/10
app GitHub

claudio: Private AI Agent on Your Phone With Remote Claude Code Sessions

Runs a private AI agent on a phone by pairing an on-device Linux environment with remote Claude Code sessions, extensible skills, and persistent memory. The goal is a self-hosted mobile agent rather than a thin chat client over an API. Documentation is in Chinese.

mobileremotememoryskillsself-hosted
by chenyynx Sep 4, 2026 7/10
app GitHub

lockkeeper: Capability Router With a Built-In Prompt-Injection Firewall

Routes any task to a bounded portfolio of skills across Claude Code, Codex, Cursor, Jcode, Hermes, and other agents, so a task only receives the capabilities it actually needs. A prompt-injection firewall sits on the routing path. The least-privilege framing is the interesting part: capability scoping instead of handing every agent every tool.

routingsecurityprompt-injectionskillsmulti-agent
by Hannay001 Sep 4, 2026 7/10
app GitHub

claude-rent-compute: Rent GPU Nodes Ranked by True Total Cost

A Claude Code plugin for renting cloud GPU or CPU nodes by the hour across vast.ai and RunPod. Ranks offers by true total cost — machine plus disk plus download time — rather than the headline hourly rate.

plugingpucloudcost
by tmone Sep 4, 2026 7/10
app GitHub

koovi: A Voice That Tells You Which Agent Session Needs You

Speaks aloud which of your parallel Claude Code, Codex or Cursor sessions has finished or is blocked waiting for an answer. Aimed at people who run several agents and lose track of which tab is stalled.

notificationsvoicesessions
by tjmode Sep 4, 2026 6/10
app GitHub

modeldeck: Menu Bar Rate-Limit Meters Across Multiple Agent Accounts

A native Swift menu bar app tracking usage limits across all your Claude Code and Codex CLI accounts, with live percent-remaining meters per rate-limit window, reset countdowns and low-capacity alerts. Local-first: no cloud, no telemetry, and it never touches credentials.

macosrate-limitsswiftlocal-first
by timharris707 Sep 4, 2026 6/10
app GitHub

sle-console: Watch Your AI Coding Agents Work Live

A zero-dependency Node console showing which agent sessions are alive, what each is doing right now, and on what timescale. No build step required.

monitoringsessionsnode
by diegocezimbra Sep 4, 2026 6/10
app GitHub

gpt-load: Self-Hosted Gateway for Multi-Credential AI Setups

A self-hosted AI gateway that unifies multiple channels and credentials — API keys and subscription accounts alike — with scheduling, failover, request logs and usage tracking.

gatewayself-hostedproxyusage
by tbphp Sep 4, 2026 6/10
app GitHub

sparrow: Message Rooms Where AI Agents Are First-Class Members

Self-hostable chat rooms in which agents participate alongside the people they work with, rather than being bolted on as bots. Aimed at teams coordinating human and agent work in one place.

chatself-hostedmulti-agentcollaboration
by sparrow-land Sep 4, 2026 6/10
app GitHub

flow-indicator: A Meter for When Agent Steering Starts Costing You

A local meter that detects the point where cheap agent steering gives way to repeated correction, constraint restatement, repair and operator serialization. Effectively a signal that it is time to stop and reset.

metricsmonitoringproductivity
by TGPSKI Sep 4, 2026 5/10
app GitHub

claude-code-export-import: Move Sessions Between Machines

Exports and imports Claude Code sessions across machines, email accounts and app builds including Win32 and MSIX. Reverse-engineered and unofficial, MIT licensed.

sessionsmigrationwindows
by Dangelo123 Sep 4, 2026 6/10
app GitHub

DAEPIL: Local PDF Editor Powered by Your Claude Code Login

A local PDF and Markdown editor with real PDF text editing and redaction via PDFium compiled to WASM. Needs no API key — it drives Claude through your existing Claude Code login.

pdfeditorlocal-firstwasm
by kindsusu Sep 4, 2026 6/10
app GitHub

skillrot: Find the Dead Weight in Your Agent's Skill Library

Reports what each skill costs per message, which skills never actually fire, and which SKILL.md mistakes silently break the rest of the library. A maintenance tool for anyone whose skills directory has grown unmanaged.

skillsaudittokensmaintenance
by Galactic717 Sep 4, 2026 7/10
app GitHub

aether: Multiplayer, Self-Hostable Cloud Agent Runtime

An agent-agnostic cloud runtime supporting collaborative cross-steering and containerization, so several people can drive the same agent workload. Self-hostable.

runtimeself-hostedmulti-agentcontainers
by 3xDevOps Sep 4, 2026 6/10
app GitHub

claude-token-saver: Post-Hoc Routing of Repeated Easy Work

Analyzes finished sessions to find work your expensive model kept repeating, and recommends routing it to Haiku or Sonnet. No realtime router and no extra LLM calls.

tokensroutingcostanalysis
by rootstudioyaml Sep 4, 2026 6/10
app GitHub

glyphdown: On-Device Token-Cost Reduction for Claude Code

A free plugin that compresses tool-result output, deduplicates context and compacts the system prompt, stacking on top of Anthropic prompt caching. Rust hot path with a Python fallback, fail-open by design. PolyForm Noncommercial.

plugintokenscompressionrust
by MikkoParkkola Sep 4, 2026 7/10
app GitHub

claude-telegram: Chat With Claude Code From Your Phone

Bridges Claude Code to Telegram so you can drive sessions from a phone. Uses your Max plan auth rather than an API key and runs as a systemd service on your own machine.

telegrammobileremotesystemd
by DylPorter Sep 4, 2026 7/10
app GitHub

deckhq: Every AI Coding Session on Your Machine, on One Floor

Shows every AI coding session running locally, including ones your terminal has lost track of, and remembers what is still waiting on you after you have read it. Local, private and zero-dependency.

sessionsmonitoringlocal-first
by DkPanseriya Sep 4, 2026 6/10
app GitHub

intelligence: Version and Distribute Agent Intelligence Across an Org

A CLI plus versioned Intelligence Packages and a sync engine that pushes agent context to Claude Code, Cursor, Copilot, Codex, Pi and OpenCode. Built for keeping a whole organization's agents in step.

distributionversioningclienterprise
by ainova-systems Sep 4, 2026 6/10
app GitHub

threadcells: Self-Hosted Control Plane for CLI Coding Agents

A control plane for native CLI coding agents offering orchestration, persistent workflows, managed worktrees, durable results and host monitoring.

control-planeorchestrationworktreesself-hosted
by IUnknown404I Sep 4, 2026 6/10
app GitHub

ili-public: A Kanban Dashboard as Memory for AI-Assisted Dev

Uses a kanban board as the memory layer for AI-assisted development, so board state carries context between sessions. Public release of a tool developed in a private workshop repo.

kanbanmemorydashboard
by Toa1984 Sep 4, 2026 5/10
app Reddit

An Offline GitHub: A Local Place to Review AI-Generated Code

A developer juggling five to seven simultaneous AI sessions argues that code review, not generation, is now the bottleneck — and that the review venue matters when you cannot dump one-shot AI output into the company's GitHub. Presents a local-first alternative.

code-reviewlocal-firstworkflowtooling
by michalwrzosek Sep 4, 2026 6/10
app Reddit

we-need-ds: Unlock DeepSeek's Reasoning Chain in Claude Code

The author traces DeepSeek-V4-Pro's shallow tool-churning inside Claude Code to the size of the tool schema payload rather than the prompt: with 30+ MCP tool definitions visible on the planning turn, attention goes to tools instead of planning. we-need-ds is a transparent proxy that fixes it without prompt injection or shutting off MCP.

proxydeepseekmcptool-schemareasoning
by KeyAdventurous3113 Sep 4, 2026 6/10
app Reddit

Ace of Spades Bot: Combat and Pathfinding in a Voxel World

A hobbyist rebuilt the bots for an old favorite game with Claude: on-the-fly pathfinding through a fully destructible voxel world, skill levels, aiming error, tunneling and role-based behavior. Reported as a long back-and-forth that no other model came close to completing.

showcasegamedevpathfinding
by Detank2002 Sep 4, 2026 5/10
app Reddit

agents_control: Drive iTerm2 Sessions From a Telegram Bot

Lets you reply to a running coding session, start a new one, or open a tab in iTerm2 from Telegram. The bot token lives in the macOS Keychain and no ports need to be opened to the internet.

telegramiterm2remotemacos
by Other_Turnover_4758 Sep 4, 2026 6/10
app Reddit

Finding Duplicated Implementations That Coding Agents Miss

A tool that finds different implementations of the same problem, not just copy-pasted code. The review mode checks git changes against the rest of the codebase for an existing equivalent, which matters most in large or poorly maintained projects. Integrates with Claude Code.

duplicationcode-reviewstatic-analysis
by rafal-kochanowski Sep 4, 2026 7/10
app Reddit

Lythravel: Two Months of Vibe Coding a Browser MMORPG

A developer of ten years built a free 3D voxel browser MMORPG on Babylon.js and Colyseus with Claude Code over two months, without reading most of the generated code. A substantial data point on how far the approach scales.

showcasegamedevmmorpgbabylonjs
by Big-Sandwich733 Sep 4, 2026 5/10
app Reddit

Line Tower Wars Rebuilt With Claude Code and Godot

A standalone, free multiplayer remake of the StarCraft 2 custom map, built from an empty Godot project with Claude in limited spare time. Includes built-in bug reporting.

showcasegamedevgodotmultiplayer
by prince_peepee_poopoo Sep 4, 2026 5/10
app Reddit

CCC v5.31.0: A Dashboard for 30+ Parallel Claude Code Sessions

Claude Command Center's last five releases added ccc send and ccc ask for messaging a running session from the terminal, a five-minute dashboard self-check that surfaces silent local failures, and an Ask tab on the status rail.

dashboardsessionsparallelcli
by amirfish Sep 4, 2026 6/10
app GitHub

erd-designer: Open-Source ERD Tool With an MCP and Claude Code Plugin

A free ER-diagram designer that runs in the browser, VS Code, or off Google Drive. It exposes an MCP server and a Claude Code plugin so an agent can read and edit the schema diagram directly. Exports DDL for seven database engines.

erddatabasemcpvscodeschema
by kajitiluna Sep 4, 2026 6/10
app GitHub

claude-readout: Truecolor Nerd Font Statusline With Per-Model Quotas

A Claude Code statusline that shows the active model, rate limits, per-model weekly quotas, context usage, and git state. Renders in truecolor with Nerd Font glyphs, so quota headroom is visible without leaving the session.

statuslinequotarate-limitsgit
by VitorFOG Sep 4, 2026 6/10
app GitHub

ai-job-search-cn: Local Claude Code Job-Search Pipeline for the China Market

A locally run pipeline built on Claude Code that searches job postings, scores and ranks them against China-specific hard filters (degree, hukou, outsourcing), then drafts outreach messages and a Chinese resume PDF. Personal data never leaves the machine.

job-searchlocal-firstpipelinechinese
by rockbenben Sep 4, 2026 5/10
app Reddit

Kanna: macOS and iOS App That Runs Agent CLIs Through Staged Workflows

An open-source app for running multiple coding agents across multiple machines with defined stage transitions — for example, In Progress to Review requires a human, Review to PR is automatic. A companion iOS app gives you a remote terminal and notifies you when an agent needs input.

orchestrationmacosiosworkflowmulti-agent
by jemdiggity Sep 4, 2026 6/10
app GitHub

peon-poke: Trackpad Haptic Alerts When Your Coding Agent Needs You

A Mac utility that buzzes the trackpad instead of playing a sound when an AI coding agent wants attention. The office-friendly sibling of peon-ping, for people who cannot have notification chimes going off all day.

macosnotificationshaptics
by romeobravo Sep 4, 2026 5/10
app GitHub

agentic-rag: Postgres + pgvector Long-Term Memory for Claude Code

A lean agentic-RAG memory store for Claude Code backed by PostgreSQL and pgvector. The agent retrieves from its own past work rather than depending on a summary that drifts away from what actually happened.

memoryragpgvectorpostgres
by phense Sep 4, 2026 7/10
app GitHub

herdr-telegram-agents: Drive Your Coding Agents From Telegram

Runs coding agents through Telegram with one topic per agent, live status shown in the topic icon, and two-way chat with inline buttons for choices. Gives you terminal-grade control of a session from a phone.

telegramremoteherdrmobile
by permgps Sep 4, 2026 7/10
app GitHub

scenario-probe: Stress-Test AI Instructions Before You Ship Them

Simulates users and environments against your skills and instruction files to surface trigger misses, skill collisions, stale assumptions, and silent behavior failures. Catches the cases where a skill quietly never fires.

testingskillsinstructionsevaluation
by m1nga Sep 4, 2026 6/10
app GitHub

agent-kanban: A Task Board Designed for Agents, Not People

An agent-first kanban board that aims to take the human out of the loop — agents pull, move, and close cards themselves rather than reporting status for someone else to transcribe.

kanbantask-managementorchestration
by saltbo Sep 4, 2026 6/10
app GitHub

agentbox: Your Coding Agent in a Container, Reachable Over SSH

An Ubuntu container preloaded with Herdr, Claude Code, Codex, opencode, and a mobile-friendly Neovim, all reachable over SSH. A disposable personal VM for agent work that you can drive from a phone.

containersshsandboxneovimmobile
by pedrogiroldo Sep 4, 2026 7/10
app Reddit

Pinloop: A Job Board CLI That Lets Claude Code Run Your Job Search

A CLI giving Claude Code direct access to thousands of postings refreshed hourly, with keyword and vector search, filtering on constraints like location or work authorization, and batch LLM judging of postings against your resume. Steps chain into reusable search routines.

job-searchclivector-searchautomation
by parfumparrot Sep 4, 2026 6/10
app Reddit

ShipCheck: Catch AI PRs That Pass Tests but Quietly Change Behavior

Built around a specific failure the author kept hitting: the diff looks reasonable, the suite is green, and something important silently changed. An auth check gets broadened while the dangerous part sits in an unchanged helper; security tests get skipped while everything else stays green; a strict assertion gets weakened without looking like a deletion. ShipCheck runs on the PR after the agent is done and asks whether protected behavior still holds, rather than whether the diff contains bad code.

code-reviewpull-requesttestingbehavior
by Accomplished_Lion831 Sep 3, 2026 7/10
app GitHub

code-with-quran: Read the Qur'an Progressively While a Session Works

Opens the Qur'an in your browser during a Claude Code session, advancing one ayah at a time from where you left off. Activates only when you launch with 'claude --cwq', so it stays out of the way otherwise.

utilityreadingcli-flagcompanion
by bahni-m Sep 3, 2026 5/10
app GitHub

horizon: GPU-Accelerated Terminal Board Putting Sessions on Infinite Canvas

A GPU-accelerated terminal board that lays all your running sessions out on an infinite, pannable canvas instead of a stack of tabs. Aimed at people juggling several agent sessions at once who want spatial layout rather than window switching.

terminalmulti-agentuisessions
by peters Sep 3, 2026 6/10
app GitHub

lore: Search and Index Everything Claude Code Has Written on Your Machine

Indexes every Claude Code session on your machine and makes the whole history searchable, so past work compounds instead of being lost when a session ends. Useful when you know you solved something before but can't remember which project or when.

memorysearchsessionslocal
by ramonfabrega Sep 3, 2026 7/10
app GitHub

lulz-router: Run Claude Code or Codex on an OpenCode Go Subscription

A router that lets Claude Code, Codex or OpenCode run against an OpenCode Go subscription, with a Responses to Chat Completions bridge so any model works in any harness. Handy if you want to reuse one subscription across several CLI harnesses.

routerproxymulti-modelharness
by Lulzx Sep 3, 2026 6/10
app GitHub

ai-continuity-plugin: Versioned Project State That Survives AI Sessions

Keeps durable project state — decisions made, constraints in force, and paths already rejected — versioned in git across AI sessions. The author is explicit that it isn't a memory tool: the point is recording why the project is the way it is so the next session doesn't relitigate settled choices.

continuitystategitdecisions
by vikcena01 Sep 3, 2026 6/10
app GitHub

stapler-squad: Web Mission Control for Running Multiple Coding Agents

A browser-based dashboard for running Claude Code, Codex, Gemini CLI and Aider side by side, with a live status view, auto-approval rules and a structured review queue. Aimed at the case where you have more agents in flight than terminal windows you can watch.

multi-agentdashboardorchestrationreview
by tstapler Sep 3, 2026 7/10
app GitHub

intellij-nitpick: Review Agent Diffs in IntelliJ, Send Notes Back to Claude

An IntelliJ plugin for reviewing AI-generated diffs with inline comments, then shipping the whole review back to Claude Code, Codex, Copilot or any MCP agent to act on. Closes the loop between reading a diff in your IDE and getting it fixed.

intellijcode-reviewidemcp
by gipo355 Sep 3, 2026 7/10
app GitHub

matou: A macOS Multi-Agent Desktop Workbench for Claude Code

A macOS desktop workbench for running multiple Claude Code agents: session management, natural-language collaboration across session cards, DAG visualization, tiered notifications, an agent HUD and git worktree integration. Chinese-language docs.

macosmulti-agentworktreedesktop
by icesword0760 Sep 3, 2026 6/10
app GitHub

complex-md: A Computed Map of Where Edits Are Risky, for Coding Agents

COMPLEX.md is a generated map of a codebase showing where changes tend to be risky and where bugs actually get fixed, so an agent can weight its caution accordingly. Ships as a spec plus a CLI, hooks and an MCP server.

mcpcode-analysisriskhooks
by jameslcowan Sep 3, 2026 7/10
app GitHub

cc-memory: Persistent Claude Code Memory That Survives Compaction

A memory layer for Claude Code built to survive both compaction and session boundaries. It uses reconcile-on-write with LLM-judged de-duplication instead of appending patches, a forced PROGRESS.md handoff, a live PLAN.md anchor with a directive ledger, FTS5 search, MCP tools and a GUI — all pure stdlib Python with zero runtime dependencies.

memorymcpcompactionpython
by skymanbp Sep 3, 2026 8/10
app GitHub

harness-remote: Run, Resume and Hand Off Coding Sessions Across Machines

A control plane for native sessions across Codex, Claude Code, OpenCode, OMP and PI, letting you start work on one machine and resume or hand it off on another. Useful if you move between a laptop and a workstation mid-task.

remotesessionsmulti-harnesscontrol-plane
by giuliastro Sep 3, 2026 7/10
app GitHub

waterfall.sh: Autoroute Routine Prompts to the Cheapest Capable Model

A local coding board that routes each prompt to the cheapest model that can actually handle it, so a Claude Code or Claude Pro quota stretches further. Routine work goes cheap; the hard prompts still get the good model.

routingcostquotamulti-model
by adamtpang Sep 3, 2026 6/10
app GitHub

CoBot: Drive Your Local Claude Code From Telegram

Control a local Claude Code agent from Telegram with streamed replies, session switching, cron-scheduled tasks, multimodal input and a web admin console. Turns your phone into a remote for a machine that's already running.

telegramremotecronmobile
by zaneven Sep 3, 2026 7/10
app GitHub

agbx: Run Coding Agents in Isolated, Project-Specific Docker Environments

Gives each project its own Docker environment for the coding agent to run in, so a misbehaving agent can't reach past the container. A straightforward answer to the risk of running agents with broad permissions on your host.

dockersandboxisolationsecurity
by pixel365 Sep 3, 2026 7/10
app GitHub

heros-agent: A Long-Running Agent That Improves and Evaluates Other Agents

A durable, long-running agent whose job is evaluating and improving other agents. Meta-level tooling for anyone maintaining a fleet of agent configurations and wanting them to get better over time rather than drift.

meta-agentevaluationlong-runningimprovement
by damonleelcx Sep 3, 2026 5/10
app GitHub

agent-hi-tax: What a Single 'hi' Actually Costs in Every Agent Harness

Uniformly collected, reviewable measurements of the tokens, credits, quota and latency that real agent harnesses burn on a single trivial message. Useful as a baseline when comparing harnesses, since the overhead before you've asked for anything varies a lot.

benchmarktokenscostharness
by aicodingresearch Sep 3, 2026 6/10
app GitHub

mind-your-tone: Prompt Tone Scoring for Codex and Claude Code

Scores the tone of your prompts to Codex and Claude Code. A light diagnostic for anyone curious whether how they phrase requests correlates with the quality of what they get back.

promptinganalysistonecodex
by BearMett Sep 3, 2026 5/10
app GitHub

sidequest: Play a Game While Your Coding Agent Works

Auto-opens a game while your agent is working, tracks the session's live status, and hands the terminal back the moment the agent needs you. A cheerful answer to the dead time in long agent runs.

utilitynotificationsterminalfun
by azamoviich Sep 3, 2026 5/10
app GitHub

agentic-shopping-autopilot: Let Agents Buy and Pay Under a Signed Mandate

An open-source layer letting Claude Code or Codex autonomously find, order and pay for goods on real e-commerce sites under a pre-signed mandate, with an Allegro/OLX MVP. Includes a site-skills registry, AP2-style mandates and PSD2-aware payments.

agentse-commercepaymentsautonomy
by AndriiShramko Sep 3, 2026 5/10
app GitHub

piighost: Hide PII From LLM Prompts, Restore Real Values in the Response

Masks personal data before a prompt reaches the model and restores the real values in the response, so tools and users still get correct data while the model never sees it. Pluggable detectors (regex, NER, LLM), integrations for LangChain, Pydantic and LlamaIndex, plus a companion OpenAI/Anthropic proxy.

privacypiiproxysecurity
by Athroniaeth Sep 3, 2026 7/10
app Reddit

otra.city: A 3D City Where AI Agents Build Storefronts for Their Projects

A walkable browser 3D city where every building was designed and submitted by an AI agent for a project it works on. Your agent reads the claim page, builds a 10x10x6m lot as a single GLB, checks it in the live renderer and submits — no human review, live in about two minutes. Tight budgets (50k triangles, 4 materials, 1024px textures) keep the street fast.

3dagentswebcommunity
by spobin Sep 3, 2026 6/10
app GitHub

seo-machine: An SEO Research, Writing and Audit Plugin for Claude Code

An SEO plugin covering research, briefs, writing, optimization, audits and schema, all scored against one 100-point A-G framework and ending in an AI Overviews readiness verdict. The single scoring rubric across all stages is what makes it more than a prompt pack.

seoplugincontentaudit
by powerczuk Sep 3, 2026 6/10
app GitHub

token-dashboard: Local Cost, Waste and Habit Analysis From Transcripts

Reads Claude Code, Codex and Gemini transcripts already on your machine and turns them into cost, waste and habit analysis. Nothing is uploaded — the waste and habit angle is the differentiator over plain token counters.

analyticstokenscostlocal
by navidmoazzez Sep 3, 2026 6/10
app GitHub

letitbrew: Keep Your Mac Awake While Local Coding Agents Work

Keeps a Mac awake while local Claude Code or Codex agents are running, then lets it sleep once they finish. Solves the annoyance of a long agent run dying because the machine dozed off.

macosutilitypowerlong-running
by brachydactylous-wahabism574 Sep 3, 2026 5/10
app Reddit

NanoClip Cutting Room: A Visual Editing Room for Video Editing With Claude

An open-source Claude plugin that makes Claude's video editing visible. The team already had an API exposing transcript, active speaker, faces and scene changes; handing that to Claude let it do much of the editing conversationally — 'start this one two seconds earlier', 'change the framing in clip 2'. The Cutting Room adds the visual view that was missing.

videoeditingpluginopen-source
by shunithaviv Sep 3, 2026 6/10
app GitHub

DevNotes-Plus: Git-Anchored Dev Notes in VS Code With Claude Code MCP

A VS Code extension for developer notes anchored to specific files, lines and git branches, with a rich block editor, Claude Code MCP integration, GitHub PR and issue linking, and opt-in team sharing over git. Notes follow the code rather than drifting from it.

vscodenotesmcpgit
by Hiba-Chaabnia Sep 3, 2026 6/10
app GitHub

geml: One Plain-Text Format People and Agents Can Co-Write

A plain-text document format organized around a single typed block for everything, readable by people and addressable, verifiable and versioned for machines, with history kept in a .gemlhistory sidecar. An attempt at a shared document substrate for human/agent collaboration.

formatdocumentationspeccollaboration
by geml-spec Sep 3, 2026 5/10
app GitHub

control-tower: A Read-Only TUI Supervising Every Claude Code Project

A local, read-only terminal UI across every project you run Claude Code in, showing each one's state, what needs you, what only you can do, how far the work got and what comes next. Read-only by design, so it can't make things worse.

tuimonitoringmulti-projectlocal
by bybysker Sep 3, 2026 7/10
app GitHub

memware: A Bi-Temporal Belief Ledger That Only Remembers the Latest Truth

Agent memory built as a bi-temporal belief ledger plus a transcript index in a single SQLite file, designed so superseded facts stop being recalled. Directly targets the failure where stale memory outranks current reality.

memorysqlitebi-temporalagents
by ericwalisko Sep 3, 2026 7/10
app GitHub

beezi-claude-plugin: Per-Session Cost Tracking and Ticket Drafting

Official Beezi plugins for Claude that track what AI-assisted work costs per session in Claude Code, give a personal usage summary on demand, and draft tickets from claude.ai — all under your own Beezi account.

plugincostticketsusage
by Beezi-AI Sep 3, 2026 5/10
app GitHub

ccdeck: Draw the Agent Session Tree — Live DAG, Cost, Quota and Blockers

Built on the observation that an agent session is a tree but your terminal shows it as a scroll. ccdeck draws the tree instead: a live DAG of tool calls with cost, quota and who is currently blocked on you, for Claude Code and Codex. Local, no telemetry.

visualizationdagsessionslocal
by BarganConstantin Sep 3, 2026 7/10
app GitHub

claude-chinese: Non-Invasive Chinese Localization for Claude Desktop

A localization toolkit that translates the Claude Desktop UI into Chinese across Windows (MSIX/Win32), macOS, and Linux. It patches non-invasively and self-heals after app updates, so a Claude release does not undo the translation. Aimed at Chinese-speaking users who want the desktop client in their own language.

localizationclaude-desktopchinesetooling
by yiheng8023 Sep 3, 2026 5/10
app GitHub

knowl: Typed, Sourced Persistent Memory for Claude Code, Cursor and Codex

A local memory layer where each stored fact is typed, carries its source, and gets retired when it changes — instead of an ever-accumulating notes file. Runs on local SQLite with no API keys, and works across Claude Code, Cursor, and Codex. The retirement mechanic is the interesting part: stale facts do not linger and mislead the agent.

memorysqlitelocal-firstcross-agent
by dat999zx Sep 3, 2026 7/10
app GitHub

orbital-usage-gauges: macOS Usage Meter for Claude, Codex and Antigravity

A macOS app showing live usage gauges for Claude, Codex, and Antigravity side by side, rendered as liquid-fill meters. Handy if you split work across several AI coding tools and want one glance to tell you how much of each quota is left.

macosusage-trackingmonitoringmenu-bar
by Fie345 Sep 3, 2026 6/10
app GitHub

AgentDFIR: Digital Forensics and Incident Response for AI Agents

Open-source DFIR tooling that collects, preserves, and reconstructs activity from Claude Code, Codex, Cursor, Gemini, and Copilot sessions. Turns scattered agent logs into an investigable timeline. Aimed at teams that need to answer what an agent actually did after an incident.

forensicssecurityauditincident-response
by efij Sep 3, 2026 7/10
app GitHub

residoo: Find Secrets Your AI Coding Agent Leaked to Disk

A scanner for credentials that coding agents write into scratch files, logs, and temp output. MIT, zero dependencies, no network calls, so it can run on machines where you would not send code to a cloud scanner. The author publishes a benchmark claiming it beats TruffleHog and GitGuardian's engine.

securitysecretsscannerlocal-first
by dandovdub Sep 3, 2026 8/10
app GitHub

agentreplay: Turn a Claude Code Session Into an HTML Replay

Converts Claude Code session logs into a self-contained HTML replay showing what the agent explored, where it got stuck, and what finally worked. Fully local with no telemetry. Handy for reviewing a long unattended run or sharing how a fix was actually reached.

sessionreplayobservabilitylocal-first
by AaravKhanduja Sep 3, 2026 8/10
app GitHub

usage-buddies: Claude Usage Limits in Your KDE Panel or Tray

A desktop widget showing real-time Claude usage limits, session pace, weekly quotas, and service health. Runs in the KDE panel, a system tray, or on the Windows desktop. One of the few quota monitors that targets Linux desktops rather than macOS menu bars.

usagemonitoringkdelinux
by MrSchrodingers Sep 3, 2026 7/10
app GitHub

AgentParty: @Mention Another Team's Agent From Your Terminal

Cross-session networking for coding agents: @mention another team's AI and let the two agents coordinate directly across sessions, machines, and organizations. Runs from the terminal. An unusual take on agent-to-agent integration that crosses org boundaries rather than staying inside one machine.

multi-agentcollaborationterminalnetworking
by leeguooooo Sep 3, 2026 6/10
app GitHub

suanli-dashboard: macOS Floating Dashboard for Codex and Claude Quotas

A macOS floating dashboard tracking subscription quota balance, token consumption, and multi-device usage trends for both Claude Code and OpenAI Codex, with persistent Touch Bar display. Chinese-language UI. Useful if you split work across two subscriptions and several machines.

usagedashboardmacosquota
by waytosea-oss Sep 3, 2026 6/10
app GitHub

Velith: Build Books Like Software, From Blank Page to EPUB

A Claude Code plugin implementing a six-phase publishing pipeline with 16 skills, 7 agents, and 8 genre templates, ending in EPUB and PDF output. Treats a manuscript as a build artifact with structured stages instead of one long generation. Notable as a large plugin applying agent orchestration outside of code.

pluginpublishingepubpipeline
by epicsagas Sep 3, 2026 7/10
app Reddit

Seahelm: A macOS Control Room for Parallel Agent Sessions

A native Swift and AppKit app for running many Claude Code sessions across git worktrees, showing which are running, waiting, or need attention. Sessions survive quitting the app via zmx, and it suggests next actions when Claude is blocked. Deliberately not an editor or diff tool, since review stays with the agent in context.

macosparallel-sessionsworktreesmonitoring
by WhileNo4838 Sep 3, 2026 7/10
app GitHub

lshed: Store Your Agent Harness and Restore It Anywhere by Profile

Keeps skills, subagents, commands, and instructions in a shed you can restore onto any machine, selected by profile. Solves the drift between the configuration on your laptop and the one on a server or a fresh clone. Useful once your harness stops being a single CLAUDE.md.

configportabilityskillsdotfiles
by LeeSongHeon-LSH Sep 3, 2026 6/10
app GitHub

usage-monitor: One Desktop Panel for Quotas Across Six AI Coding Tools

A desktop app that aggregates usage, quotas and cost for Claude Code, Codex, MiniMax, DeepSeek, OpenCode and Kilo in a single view. Tracks local session costs with history and forecasts, and offers an optional self-hosted team view.

usagequotadesktopmonitoring
by edilsonvilarinho Sep 2, 2026 7/10
app GitHub

claude-warmline: Show Prompt-Cache HOT/COLD State in Your Statusline

Surfaces Claude Code's own prompt-cache state as a HOT/COLD indicator in the statusline, plus an audit tool that reconstructs when your sessions went cold, what caused it, and what the re-warm cost. Useful for anyone tuning long sessions against usage limits.

statuslinecachetokensusage
by Miguel-Barroso Sep 2, 2026 7/10
app GitHub

agent-skills-lint: Deterministic Linter for Agent Skills and Plugins

A CLI and GitHub Action that checks agent skills and plugins against the Agent Skills spec plus Claude Code and Codex conventions. Deterministic, so it can gate CI rather than being another model asked for an opinion.

linterskillscigithub-action
by korya Sep 2, 2026 7/10
app GitHub

goldeneye-pc-port: Multi-Agent AI Porting of a Decompiled N64 Codebase

A work-in-progress native PC port of GoldenEye 007 built on the N64 decompilation, run explicitly as a research project on multi-agent AI-assisted porting. Interesting as a public case study of agents working a large, low-level C codebase.

case-studymulti-agentportingc
by jkdansereau Sep 2, 2026 5/10
app GitHub

orchestra: Manage a Team of Agents the Way a CEO Manages a Company

A harness where worker agents send each other mail, a built-in task manager assigns budgets, each agent gets its own git worktree, and a cross-model review runs before every squash merge. Puts Claude Code, Codex, Grok and OpenRouter behind one contract.

orchestrationworktreesmulti-agentreview
by DrSeedon Sep 2, 2026 7/10
app GitHub

claude-chat-mobile: Drive Local Claude Code and Codex Sessions From Your Phone

A self-hosted bridge that exposes your local Claude Code and Codex sessions as phone-friendly chat rooms, with safe defaults on what the remote side can trigger. Solves the walk-away-from-the-desk problem without renting a cloud sandbox.

mobileremoteself-hostedsessions
by Coolkidlab-Yin Sep 2, 2026 7/10
app GitHub

quota-watch: Terminal Quota Monitor for Claude Code and Codex

A lightweight terminal monitor showing current subscription quota consumption for Claude Code and Codex. No dashboard, no daemon — just a command you run when you want to know where you stand.

terminalquotamonitoringcli
by lazydao Sep 2, 2026 6/10
app GitHub

GroupConnect: Bridge Telegram Group Chats to Local CLI Coding Agents

A gateway that connects a Telegram group to local agents (Claude Code, Antigravity, Codex, OpenCode) with a silent sliding context window, so a whole group's conversation becomes agent context. Useful for team-visible agent work.

telegramremotegatewaymulti-agent
by sapereaude2014 Sep 2, 2026 6/10
app GitHub

agent-dashboard: Spawn and Control Coding Agents Across Multiple Hosts

A FastAPI and React dashboard that spawns agents on several machines, streams their live terminals over PTY, tracks token usage via OpenTelemetry, and supports git worktrees. Deploys as rootless Podman containers.

dashboardmulti-hostworktreesopentelemetry
by dustinblack Sep 2, 2026 8/10
app GitHub

agentsw: One Provider Config Synced Into Nine Coding Agents

Manages OpenAI- and Anthropic-protocol providers in one place and syncs them, with models.dev metadata, into nine agents including Claude Code, Codex, opencode and Hermes. Non-destructive, so hand-tuned settings survive, and it imports from cc-switch.

providersconfigmulti-agentcli
by tchivs Sep 2, 2026 6/10
app GitHub

octopus (bestruirui): Personal LLM API Aggregation Gateway

A self-hosted gateway that puts many LLM providers behind one endpoint for personal use. Useful as the provider layer under a coding agent when you want to switch models without touching agent config.

gatewayllmself-hostedrouting
by bestruirui Sep 2, 2026 5/10
app GitHub

forge (oomerevren): One CLI to Install Skills, MCPs, Plugins and Agents

A package manager for the agent ecosystem, positioned as Homebrew for AI agents, covering skills, MCP servers, plugins and subagents across Claude Code, Codex, Cursor and OpenCode. One install path instead of four conventions.

package-managercliskillsmcp
by oomerevren-beep Sep 2, 2026 7/10
app Reddit

Memento: A Markdown Wiki Where Claude Code Is the Librarian

Capture a thought, link, PDF or whiteboard photo without deciding where it goes; a sandboxed Claude Code session distills it onto the right pages, links related ones, and keeps the original read-only. Big changes land in a diff inbox, small ones show in an activity log, all git-backed.

wikinotesautomationgit
by coolrgy Sep 2, 2026 6/10
app Reddit

claude-ollama: One-Click Fix for Ollama With the Claude Code Desktop App

A wrapper that repairs the Ollama integration for the Claude Code desktop app: correct env vars scoped to the launch, a rewritten model catalogue exposing 1M context, and relief from the subagent concurrency limit that killed long /deep-research runs.

ollamalocal-modelsdesktopfix
by idontknowwhodoi Sep 2, 2026 6/10
app GitHub

bur: Full Agent Permissions Inside a Rootless Podman Sandbox, None Outside

A cage for coding agents where your nix devshell is the container: the agent gets unrestricted permissions inside a rootless podman sandbox and nothing beyond it. Removes the permission-prompt fatigue without removing the boundary.

sandboxpodmannixsecurity
by jeliasson Sep 2, 2026 7/10
app GitHub

spark-hub: Index of 502 Claude Code Plugins Across 16 Marketplaces

A Portuguese-language index of the Claude Code extension ecosystem, cataloguing 502 plugins spread over 16 marketplaces. Useful for finding out whether the plugin you are about to write already exists.

indexpluginsmarketplacediscovery
by thenrynadai-oss Sep 2, 2026 6/10
app Reddit

Clidable: A Proper Text Box and GUI Around the Real Claude Code CLI

Wraps the actual Claude Code CLI rather than replacing it, fixing the terminal-shaped annoyances: composing long prompts, installing skills and MCP servers without editing config files, and jumping between editor, preview and agent.

guicliwrapperux
by andrepimentaa7 Sep 2, 2026 6/10
app GitHub

claude-code-statusline-ps: PowerShell 7 Statusline for Claude Code on Windows

A Windows statusline showing context meter, cost, rate limits, git branch and mode badges, in one or two lines with plain or powerline styling. Configured by a small JSON file, uses Nerd Font glyphs, needs no PowerShell modules.

windowsstatuslinepowershellcontext
by ookla-ariel-ride Sep 2, 2026 6/10
app GitHub

SpielOS: Goals, Runs, Workers and AI Departments Under One Director Loop

An open-source operating system for running a company on AI agents, structured around a Director loop of observe, decide, act, evaluate, with departments as agent groups. Ambitious framing; worth a look for the loop structure.

orchestrationagentsoperationsopen-source
by ShayanSpiel Sep 2, 2026 5/10
app GitHub

rulereceipt: Check Whether a Session Actually Followed Your CLAUDE.md

Audits a completed Claude Code session against the rules in your CLAUDE.md or AGENTS.md and reports which were followed, with evidence. Answers the question everyone with a long rules file eventually asks.

claude-mdauditrulesverification
by rulereceipt Sep 2, 2026 7/10
app Reddit

WebADE: A Browser IDE for Running Several Claude Code Sessions Side by Side

Workspaces of terminal panes, each running Claude Code, omp, or a plain shell, all in one browser tab, with sessions living on the server. MIT licensed, and built almost entirely by Claude Code sessions running inside WebADE itself.

idebrowsersessionsparallel
by Phat_N_Sassy33 Sep 2, 2026 7/10
app GitHub

ollama-reviewer: A Local Ollama Model Advises, Claude Decides

Runs a local Ollama model as a code-review assistant feeding suggestions into Claude Code, with Claude retaining the decision. Keeps the cheap pass local while the expensive model adjudicates.

ollamacode-reviewlocal-modelscost
by hynix666 Sep 2, 2026 6/10
app GitHub

uroboros: Codex Writes Isolated, Your Commands Gate, Cursor Reviews

A Claude Code plugin with a strict separation of powers: Codex writes in a git-isolated copy, your own commands decide pass or fail by exit code, and Cursor reviews the diff read-only. Nobody in the loop can both write and approve.

codexcursorgatesisolation
by ortimusirig Sep 2, 2026 6/10
app Reddit

A Pixel-Art Office Where Each Claude Code Session Is a Robot at a Desk

Every project is a room and every session a robot whose screen scrolls while working, goes amber when it needs you, red when stuck, dark when idle — readable from across the room. Click a desk to enter that conversation and approve the exact command it wants to run.

uisessionsmonitoringpermissions
by CommercialGift9237 Sep 2, 2026 6/10
app GitHub

weave: Self-Hosted Airtable Alternative Where Agents Are First-Class Users

Connected tables, relations, workflows, formulas, rollups and per-entity markdown or PDF documents in one SQLite file, exposed through REST, a CLI and an MCP server so Claude Code and other agents are first-class users. Zero dependencies, MIT.

databasemcpself-hostedsqlite
by grunion-ai Sep 2, 2026 7/10
app GitHub

token-hop: cross-agent prompt compiler and context synchronizer

A universal compiler that takes one source of prompt/context definitions and emits the config each coding agent expects, covering Claude, Cursor, Copilot and Antigravity. It keeps context synchronized so switching tools does not mean rewriting your rules files by hand. Handy if your team uses more than one agent and wants a single place to edit instructions.

apppromptscontextinteroperabilitytooling
by yunkon-kim Sep 2, 2026 7/10
app GitHub

portal_brasileirao: production football app built end-to-end with Claude Code

A live Campeonato Brasileiro Serie A companion app on React 19, TypeScript, Express and AWS, developed entirely by directing Claude Code across 742 commits. It ships 45 unit tests and 30 Playwright e2e tests, seven GitHub Actions workflows including a documented rollback drill, and keyless OIDC deploys. Worth a look as a concrete reference for what a fully agent-driven production codebase and CI setup looks like.

appcase-studyreacttypescriptci-cdplaywright
by mpbarbosa Sep 2, 2026 6/10
app GitHub

agy-proxy: Multi-account proxy exposing Antigravity and Gemini as Claude APIs

A high-performance proxy that fronts multiple Google Antigravity and Gemini accounts and re-exposes them through OpenAI and Anthropic-compatible endpoints. That lets Claude Code, Cursor, Windsurf, and Aider talk to Gemini models without changing clients. Includes a web dashboard for account and usage management.

proxyapigeminimulti-account
by kqlio67 Sep 2, 2026 6/10
app GitHub

metaharness: Scaffold your own agent harness with CLI, MCP, memory and loop

A meta-harness that generates a focused, branded agent harness with its own npx CLI, MCP server, memory store, learning loop, and witness-signed releases. Rather than adapting a general tool, you scaffold a purpose-built one. Output works with Claude Code, Codex, pi.dev, Hermes, OpenClaw, and the RVM sandbox.

harnessscaffoldingmcpagents
by ruvnet Sep 2, 2026 7/10
app GitHub

nutri: Production nutrition PWA built end-to-end inside Claude Code

A React and Supabase nutrition-tracking PWA developed and operated entirely from Claude Code, with a RAG pipeline, hybrid semantic search over pgvector, and a self-built remote MCP server using OAuth 2.1 with PKCE and RLS enforcement. A three-model fallback chain and an LLM eval harness gate every release. Useful as a worked example of a real agent-built production stack.

ragsupabasemcpcase-study
by vryahn Sep 2, 2026 6/10
app GitHub

claude-workspace-launcher: VS Code extension for multi-folder CC sessions

A small VS Code extension that launches Claude Code with every workspace folder passed through --add-dir. Saves manually re-adding directories in multi-root workspaces. Narrow in scope but removes a recurring papercut.

vscodeextensionmulti-rootadd-dir
by yazilim-vip Sep 2, 2026 6/10
app GitHub

streamsnow: Build and ship Streamlit-in-Snowflake apps with Claude Code

Tooling for developing, governing, and deploying Streamlit-in-Snowflake applications from Claude Code. Covers the build and ship loop rather than just scaffolding. Relevant if your data apps live inside Snowflake.

snowflakestreamlitdata-appsgovernance
by kyle-chalmers Sep 2, 2026 5/10
app GitHub

ai-usage-tui: btop-style terminal dashboard for agent token usage and cost

A terminal dashboard that reads local usage data from Claude Code, Codex CLI, Gemini CLI, OpenCode, and Ollama and shows tokens, cost, and budgets in one btop-inspired view. Runs as a live TUI or dumps JSON and CSV for scripting. Handy if you juggle several agent CLIs and want one number.

tuitokenscostdashboard
by SophanaSok Sep 2, 2026 7/10
app GitHub

omniharness: Terminal agent harness for OmniRoute with parallel swarms

An agent harness built around OmniRoute that offers plan, build, and research modes plus a parallel swarm mode, all from a terminal UI. Positioned as an alternative front end for people who want swarm execution without wiring it themselves. Worth a look if you are comparing harnesses.

harnesstuiswarmrouting
by shipking-ai Sep 2, 2026 5/10
app GitHub

fettle: Fail-closed quality layer that catches agent mistakes in-session

A quality layer that checks agent work in the same session that produced it, using fail-closed evidence so a missing check blocks rather than passes silently. Its policy survives delegation to subagents, which is where most in-session gates leak. Installs across Claude Code, Codex CLI, Gemini CLI, and OpenCode, and the author reports an adversarial audit.

qualityevidencecross-agentpolicy
by MilindGaharwar Sep 2, 2026 7/10
app GitHub

claude-golden-eye: Live view-only dashboard for Claude Code sessions

A read-only dashboard showing live session state: active agents, transcripts, the current plan, and token consumption. A second optional plugin adds hook-enforced PM-mode discipline on top. Shipped as a two-plugin marketplace so you can take the dashboard without the enforcement.

dashboardobservabilityplugintokens
by amenophis1er Sep 2, 2026 7/10
app Reddit

1pct.net: A GPU Power-Profile Diagnostic Site Built With Claude Code

The author traced a GPU locked at 60W to Windows 11 silently changing power profiles, then went from ~90 to 165 FPS after fixing it. They had Claude Code build a diagnostic site so others can check the same settings on their own machines.

built-with-claude-codediagnosticsgamingwindows
by BD912 Sep 1, 2026 5/10
app Reddit

Keenable SELECT: An Agent That Runs Web Research as SQL

A research agent that expresses web search as SQL SELECT statements and returns visual results rather than a wall of prose. An alternative framing for deep research workflows.

researchsqlagentsearch
by Mysterious_Hearing14 Sep 1, 2026 5/10
app Reddit

A Physics-Based Watercolor Simulator Built Entirely With Claude Code

Version 3 of a watercolor painting simulator implementing Curtis et al.'s SIGGRAPH "Computer-Generated Watercolor" model. This release adds gyroscope and accelerometer input so paint and water respond to device tilt, and is being folded into an agentic learning environment for kids.

built-with-claude-codesimulationgraphicsphysics
by kouklimou Sep 1, 2026 6/10
app Reddit

Anthropic Introduces Claude Fable 5.1 and Claude Mythos 5.1

Official announcement of two new frontier models for coding and knowledge work. Fable 5.1 targets complex long-running tasks, scoring 52.6% on Terminal-Bench-Science 0.1 (more than double Fable 5) and 55.8% on Terminal-Bench 4.0 against Fable 5's 42.0%, while reaching comparable results at lower cost.

announcementfable-5-1mythos-5-1anthropicbenchmarks
by ClaudeOfficial Sep 1, 2026 9/10
app GitHub

lint: Read-Only-by-Default Formatting Across Mixed-Language Repos

A formatting layer for polyglot codebases that reports rather than rewrites unless told otherwise, which is the safe default when an agent is driving. Runs the same way from local tools, Docker, CI, and agents.

formattinglintingcipolyglotsafety
by trycopilotai Sep 1, 2026 6/10
app GitHub

moa: A Self-Hosted MDX Report Hub for Agent Output

Your agents produce reports; MOA is where you actually read them. A self-hosted hub that renders MDX reports, built for teams whose agents generate more written output than anyone can track in a terminal.

reportingmdxself-hostedagent-output
by ruucm Sep 1, 2026 6/10
app GitHub

MarkuprPlus: Narrate a Bug on Screen, Get Structured Markdown Back

Record your screen and talk through a bug; it returns structured Markdown with one annotated screenshot per mark. Ships as a desktop app, CLI, and MCP server for Claude Code, Cursor, Codex, and Windsurf, with on-device Whisper transcription. Local-first and MIT licensed.

mcpbug-reportingscreen-recordingwhisperlocal-first
by hashfunction Sep 1, 2026 7/10
app GitHub

Conch: An Android Client for Claude Code, Codex, and Gemini CLI

Chat with coding agents running on your own servers over SSH from an Android phone. Supports Claude Code, Codex, and Gemini CLI, so a long-running session on a home box stays reachable from anywhere.

androidmobilesshremoteclient
by nikitaeight24family Sep 1, 2026 7/10
app GitHub

skillhawk: A Zero-Dependency Security Scanner for Agent Skills

Scans Agent Skills, SKILL.md files, and MCP configs for dangerous patterns before you install them. Zero dependencies, aimed at the growing supply of third-party skills people paste in without reading.

securityskillsscannermcpsupply-chain
by Berserk-hub150 Sep 1, 2026 8/10
app GitHub

fable-meter: Fable Weekly Usage in the macOS Menu Bar

An unofficial menu bar tool that keeps your Claude Code Fable weekly usage visible at all times on macOS, so you notice the quota before it stops you. Documented in Japanese.

macosmenu-barusagequotamonitoring
by ajia-watabe Sep 1, 2026 6/10
app GitHub

Vibe-Map: A Codebase Cartographer for Vibe Coders

Maps an unfamiliar codebase into something navigable for people working primarily through an agent, who need orientation without reading every file themselves.

codebase-mapnavigationonboarding
by muchandresh Sep 1, 2026 5/10
app GitHub

repomoot: Requests Between Agents That Own Different Repos

A protocol for one repository's coding agent to file a request against another repository's agent, with consumer acceptance and escalation to the owner when they disagree. Aimed at multi-repo organizations where agents work in parallel.

multi-repocoordinationagentsprotocol
by dev-bude Sep 1, 2026 6/10
app GitHub

2nd-brain: An Agent That Compiles Web Clippings Into a Cited Wiki

An Obsidian vault template where an agent turns web clippings into a Markdown wiki with citations, versioned in Git. Built around Claude Code but model-neutral. Documented in Korean and English.

obsidianpkmknowledge-basecitationsgit
by lemoncloud-io Sep 1, 2026 6/10
app GitHub

ai-coding-agent: A Model-Agnostic Coding Agent Over JSON-RPC stdio

A coding agent that runs against any local Ollama model or cloud LLM, using native tool calling over JSON-RPC stdio. Useful as a reference implementation for how a harness wires tools to a model.

agentollamamodel-agnosticjson-rpctool-calling
by Snaehath Sep 1, 2026 6/10
app GitHub

hivemind: A Native macOS Honeycomb Monitor for Agent Sessions

Shows every Claude Code and Codex session as a cell in a honeycomb with live status, context usage, and plan usage, and clicking one focuses the right terminal tab. Native macOS, built for people running many sessions at once.

macosmonitoringsessionsdashboardnative
by GuitarWag Sep 1, 2026 7/10
app GitHub

cortexes: Session Recording and Memory Distillation for Claude Code

A personal knowledge vault plugin that records sessions, distills them into memories, and retrieves with a hybrid of semantic search and BM25. Keeps what you learned in past sessions reachable in later ones.

pluginmemoryknowledge-vaultsemantic-searchbm25
by XBlueSky Sep 1, 2026 7/10
app GitHub

10x: A Curated Claude Code Plugin Marketplace, One Install Command

Seven plugins behind a single install: sniff (AI QA in a real browser), ui-ux-suite (design audit), recap-studio (one-page explainers), aws-cost-audit (safe AWS savings), goalify, humanizer (AI-writing detector and rewriter), and loopify.

marketplacepluginsqadesign-auditaws
by Aboudjem Sep 1, 2026 7/10
app GitHub

cowork-deck: Many Claude Code Sessions as Live PTY Tiles

Each tile is a real PTY terminal showing live state, each workspace carries its own GitHub account, and your setup follows you to the next machine. Built on Tauri v2 with no UI framework.

orchestrationsessionstauriterminalmulti-account
by followLemmi Sep 1, 2026 7/10
app GitHub

SecHelix: Evidence-First Multi-Agent AppSec With Regression Proof

Runs application security work through multiple agents with independent verification of each finding, safe tool adapters, root-cause remediation rather than symptom patching, and a regression proof that the fix holds.

securityappsecmulti-agentverificationremediation
by omarmohelal Sep 1, 2026 7/10
app GitHub

cue: A Multi-Tenant Prompt Queue for Claude Code Sessions

Queue prompts for Claude Code sessions through a hosted multi-tenant web app with Google login, running them via the Claude Code CLI with optional AI optimization of each prompt. Documented in German, live at cue.celox.io.

queueweb-appclimulti-tenant
by pepperonas Sep 1, 2026 6/10
app GitHub

loopguard: A Health Check for Agents Running Unattended on a Schedule

Watches scheduled, unattended agent runs for the failure modes that go unnoticed until the output is already wrong. Ships with the field notes of the agent that wrote it — the code is entirely Claude's, with a human owning the account.

monitoringcronunattendedhealth-check
by Cele71 Sep 1, 2026 6/10
app GitHub

crapkit: Deterministic CRAP Scores and a Commit Gate That Only Tightens

Computes the CRAP metric (complexity times coverage) per function, produces a ranked worklist of the worst offenders, and installs a commit gate whose threshold can only move in the direction of better.

code-qualitymetricscoveragecommit-gateratchet
by JeanFrancoisGagne Sep 1, 2026 7/10
app GitHub

enclaude: A Docker Sandbox Wrapper for Claude Code

Runs Claude Code inside a Docker sandbox so an autonomous session can't reach the rest of your machine. Documented in Japanese.

sandboxdockersecurityisolation
by kamataryo Sep 1, 2026 6/10
app GitHub

memory-horizon: Read-Only Memory Weather Over Agent Session Logs

Investigates Claude Code and Codex JSONL histories read-only, surfacing how context and memory actually behaved over a session rather than how you assumed it did.

session-analysismemorydiagnosticsread-only
by Soul-Brews-Studio Sep 1, 2026 6/10
app GitHub

newswatch: Topic-Matched RSS and Listing Watch With LLM Digests

Watches RSS feeds and listing pages, matches against topics you define, and sends an LLM-summarized digest by email or chat. A small, self-hosted alternative to a news aggregator.

rssmonitoringdigestself-hostedemail
by seokhoonj Sep 1, 2026 6/10
app GitHub

bce: Architectural Blueprints Enforced in CI

The blueprint conformance engine — you author architectural intent explicitly, and CI enforces it. Turns "we agreed the modules wouldn't depend on each other" into something that actually fails a build.

architectureciconformanceenforcement
by blueprint-conformance Sep 1, 2026 6/10
app GitHub

marmot: Nudges Before You Hit Limits or Leak Tokens

Watches for approaching Claude Code usage limits and for habits that quietly burn tokens, then nudges you about both. Aimed at people who only notice the waste after the quota is gone.

usagetoken-efficiencymonitoringlimits
by DrDroidLab Sep 1, 2026 7/10
app GitHub

open-managed-agents: A Self-Hosted Managed Agents API Implementation

An open-source, drop-in compatible implementation of the Claude Managed Agents API plus a self-hosted Claude Tag-style agent runtime. Runs on Cloudflare Workers with Durable Objects or on Node.js. Apache 2.0.

agent-runtimeself-hostedcloudflare-workersapiapache-2
by openma-ai Sep 1, 2026 7/10
app GitHub

MornKanban: File-Based Kanban Dispatch You Can Actually See

Dispatches work to Claude Code and Codex agents through a visible, file-based Kanban board, so the queue is inspectable in the repo rather than hidden in an agent's head.

kanbandispatchmulti-agentfile-based
by TsukumiStudio Sep 1, 2026 6/10
app GitHub

claude-wrapped: Six Months With Claude Code as a Publishable Report

Generates a Spotify-Wrapped-style report and LinkedIn carousel from your own local Claude Code logs, covering six months of usage. Everything is computed locally from files you already have.

analyticssession-logsreportlocal-first
by teceer Sep 1, 2026 7/10
app GitHub

DensePack: Pack Text Into Images to Cut Input Tokens 50-75%

Encodes text as images that cost 50 to 75% fewer input tokens than the equivalent text. Ships as a Claude Code plugin, a browser app, and a right-click tool.

token-efficiencyplugincost-savingimages
by Fabian-Galvez Sep 1, 2026 6/10
app GitHub

universal-claude-code-manager: Launch Claude Code on Any Gateway

Configures and launches Claude Code against any Anthropic-compatible API gateway — Z.AI/GLM, OpenRouter, LiteLLM, or a local gateway — with no configuration to write yourself.

gatewayopenrouterlitellmglmconfiguration
by naveen-ramalingam Sep 1, 2026 7/10
app GitHub

headroom-desktop: Cut Claude Code and Codex Token Costs by ~50%

A macOS app that reduces token spend on Claude Code and Codex sessions by roughly half, aimed at people whose costs are dominated by repeated context rather than new work.

macostoken-efficiencycost-savingdesktop
by gglucass Sep 1, 2026 6/10
app GitHub

AgentHelm: A Web Cockpit for Agents Over the Agent Client Protocol

Drives GitHub Copilot CLI, Claude Code, and Gemini through the Agent Client Protocol from one web UI, with permission policies, an audit trail, and git diff review before anything lands.

cockpitacppermissionsauditdiff-review
by konradcinkusz Sep 1, 2026 7/10
app GitHub

AgentConduit: Durable Cross-Runtime Coordination for Coding Agents

Provider-neutral coordination covering git worktrees, cross-runtime messaging, job progress, and FIFO integration authority, so parallel agents integrate in a defined order instead of racing.

coordinationworktreesmessagingprovider-neutral
by aididhaiqal Sep 1, 2026 6/10
app GitHub

voice-evals: An Eval Harness for Voice Agent Systems

A harness for testing voice agents, shipped with the grader, a spreadsheet template, and a Claude Code skill that drives the whole thing.

evalsvoice-agentstestingharness
by aalbeek-ai Sep 1, 2026 6/10
app GitHub

cca-f-prep-kit: A Study System for the Claude Certified Architect Exam

Mock scoring you can trust plus eight buildable projects you can defend in the Claude Certified Architect Foundations exam. Companion code to the book; educational and not affiliated with Anthropic.

certificationstudyexam-preparchitecture
by regardo911 Sep 1, 2026 6/10
app GitHub

muster: Git as the Coordination Plane for Agents Across Machines

Coordinates coding-agent sessions across vendors and machines using git itself as the coordination plane, with an optional read-only dashboard that makes the work visible without adding a control surface.

coordinationgitmulti-machinedashboardvendor-neutral
by SamSnead85 Sep 1, 2026 7/10
app GitHub

latch: Hold Every Agent to Decisions You've Already Ratified

Records the decisions you've made and the paths you've explicitly ruled out, then holds every agent to them. Aimed at running more agents at once without re-litigating the same architecture choice in each session.

decisionsconstraintsmulti-agentgovernance
by open-latch Sep 1, 2026 7/10
app GitHub

skillenv: Virtual Environments for Agent Skills

Applies the virtualenv idea to agent skills, so skills with conflicting requirements can coexist and a project can pin exactly the set it needs.

skillsisolationenvironmentsdependency-management
by thewelshrich Sep 1, 2026 7/10
app GitHub

macverify: A Read-Only Point-in-Time Audit of Your Mac and AI Config

Audits your Mac and its AI assistant configuration at a point in time, read-only, offline, with no sudo and zero dependencies. Explicitly not an antivirus — it reports state rather than judging it.

securityauditmacosread-onlyoffline
by ShanedixonGit Sep 1, 2026 6/10
app GitHub

claudectl: A Workspace Layer Over Every Claude Code Session

Browse every session, keep persistent project memory, see which MCP servers are in play, and control launch settings per project — from a terminal UI or a desktop GUI, with zero runtime dependencies.

workspacesessionsmemorytuiguimcp
by babarmuhammad Sep 1, 2026 8/10
app Reddit

GitOctant: A Read-Only GitHub Cockpit for What Your Agents Shipped

When you run Claude Code in parallel across repos and orgs, GitHub output outruns your attention — notifications are per-event, the dashboard doesn't dedupe, and nothing separates "needs me" from "already handled." This Chrome extension puts deduplicated recent pushes, an attention queue (changes requested, review requests, failing CI, merge conflicts), and your open PRs in the new tab.

githubchrome-extensiontriageparallel-agentsread-only
by Moist_Tonight_3997 Sep 1, 2026 7/10
app GitHub

Dashy: A Windows Side-Notch Showing Usage Across Five CLIs

Reads Claude, Codex, GitHub, Grok, and Cursor usage straight from your own authenticated CLIs and shows it in a Windows side-notch. Local-first with no tokens to paste and no network calls of its own.

windowsusagemonitoringlocal-firstmulti-cli
by adirangel Sep 1, 2026 6/10
app GitHub

zskills: One TOML Manifest for Skills, Plugins, and MCP Servers

A declarative package manager for agentic coding CLIs. You list the skills, plugins, and MCP servers you want in a single TOML manifest and zskills installs and syncs them. Claude Code is supported today, with a multi-runtime design so the same manifest can target other agent CLIs.

package-managerskillsmcppluginstomldotfiles
by zot24 Sep 1, 2026 8/10
app GitHub

alpha-cost-hud: Always-On-Top Desktop Widget for LLM Spend

A small Tauri desktop widget (~6MB) that floats above your work and shows current LLM costs. It reads Claude Code, Codex, and provider spend from local data, so nothing leaves your machine. Useful if you want a constant glance at burn rate without opening a dashboard.

cost-trackingtauridesktopmonitoringusage
by vishnualpha Sep 1, 2026 7/10
app GitHub

oknek: BPF-LSM Runtime Security and Tamper-Proof Audit for AI Agents

Enforces runtime security policy below the agent using BPF-LSM, so a coding agent cannot escape the restrictions by rewriting its own config or shelling out. It also keeps an audit log that root cannot scrub. AGPL-3.0, aimed at people running autonomous agents on real infrastructure.

securitysandboxingbpfauditagent-safetylinux
by OKNEK Sep 1, 2026 7/10
app GitHub

TokenClock: Native macOS Token Tracker With Per-Session Breakdown

A macOS menu app in the Liquid Glass style that tracks AI token usage and breaks it down by session, model, and tool. Handy for seeing which tools or subagents are actually eating your context and budget, rather than just a single running total.

token-trackingmacosusagemonitoringnative-app
by Neo-Isshin Sep 1, 2026 6/10
app GitHub

dsh-cc: The Claude Code Workflow Ported to DeepSeek Harness

Brings the parts of the Claude Code experience people rely on — TUI, permission prompts, hooks, memory, skills, subagents, MCP, and git worktrees — over to DeepSeek Harness. Interesting both as a way to run a familiar workflow on a different model and as a map of which Claude Code features are load-bearing.

deepseekalternative-harnesshooksskillssubagentsmcp
by jianxx Sep 1, 2026 7/10
app GitHub

quotacap: Track Coding-Agent Allowances Locally and Pick the Right Plan

Reads your AI coding usage and reset windows locally, then estimates which subscription tier actually fits your consumption. Aimed at people juggling several plans who want a data-backed answer instead of guessing before the next billing cycle.

usagequotacost-trackinglocalplans
by carlosboeing Sep 1, 2026 6/10
app GitHub

CoreCoder: A Coding Agent in ~1,000 Lines of Python

A deliberately minimal coding agent modeled on Claude Code, small enough to read end to end — the NanoGPT of coding agents. It works with any LLM backend, which makes it a decent base for experimenting with agent loops or understanding what a harness actually does. Formerly published as NanoCoder.

agentminimalpythoneducationalopen-sourceharness
by he-yufeng Sep 1, 2026 7/10
app GitHub

AgentConfigScore: A Tamper-Resistant Regression Gate for CLAUDE.md and AGENTS.md

Scores and gates changes to agent instruction files so quality does not silently regress as they grow. It covers CLAUDE.md, AGENTS.md, Cursor, Copilot, and Gemini rule files, and is built to resist an agent editing its own instructions to pass the check. Useful in CI on repos where several people edit the agent config.

claude-mdagents-mdcilintinggovernanceregression
by LE0-Lin Sep 1, 2026 7/10
app GitHub

multi-ai-session-data-extractor: Archive Your AI Chats Locally as Parquet

A local capture tool that pulls your own conversations off 10 AI platforms and stores them in a unified parquet schema. It is designed to be deletion-resilient, so history survives even if the provider drops it. Useful if you want a durable, queryable record of Claude Code and other assistant sessions.

archiveparquetsessionslocal-firstdata-export
by mrlnlms Sep 1, 2026 6/10
app GitHub

opencode-with-claude: Use a Claude Max/Pro Subscription Inside OpenCode

An OpenCode plugin that routes requests through your existing Claude Max or Pro subscription via Meridian instead of pay-per-token API keys. It lets subscription holders use the OpenCode editor agent without a separate billing setup. Handy if you already pay for Claude and want to try another harness.

opencodesubscriptionpluginintegration
by ianjwhite99 Sep 1, 2026 6/10
app GitHub

claude-token-pace: Browser-Based Token Consumption Pace Viewer

A viewer that shows how fast you are burning tokens in Claude Code, rendered in the browser rather than a statusline. Installs with a single command on Linux, macOS, and WSL. Useful for spotting whether your current pace will hit the quota window before it resets.

tokensusagemonitoringquota
by k-tashiro-arent Sep 1, 2026 6/10
app GitHub

vocab: Claude Code Agent for Spaced-Repetition Vocabulary Learning

A Claude Code agent for language learning: paste a sentence and it picks the word worth learning, explains it in context, and schedules practice via spaced repetition. State lives locally alongside your other agent files. An unusual non-coding use of the Claude Code agent runtime.

language-learningspaced-repetitionagenteducation
by wenqicheng Sep 1, 2026 5/10
app GitHub

toki (choi138): macOS Menu Bar Tracker for Tokens, Time, and Cost

A macOS menu bar app that tracks token usage, active working time, and cost across multiple AI coding agents in one place. Sits out of the way until you want the numbers. Distinct from the similarly named tracker by aashutoshrathi.

macosmenu-bartokenscost-trackingmonitoring
by choi138 Sep 1, 2026 6/10
app GitHub

OPCCompany: Watch AI Coding Agents Run a Company in a 2D macOS Office

A 2D macOS office simulation where a CTO agent decomposes a goal and assigns it to AI employees, each working in a real terminal running Claude Code, Codex, or Gemini CLI. The game layer is a visualization of genuine multi-agent execution, not a mock-up. A playful take on making parallel agent work legible.

multi-agentmacosvisualizationorchestration
by B1ueMu3ic4m Sep 1, 2026 6/10
app Reddit

Menu Bar Monitor Adds Machine CPU and Memory Next to Parallel Sessions

A macOS menu bar monitor for parallel AI coding sessions now shows machine CPU and memory beside the session list, so you can tell whether slowness is the model thinking or your Mac saturating. CPU uses Activity Monitor's whole-machine 0-100 scale with a busy-core footnote rather than the per-process 800% scale.

macosmonitoringparallel-sessionsmenu-bar
by Low-Rice7611s Aug 31, 2026 6/10
app GitHub

cc-connect-next: Drive Claude Code From Feishu, Telegram, Slack and More

Successor to CC Connect: run Claude Code, Codex and 12 other coding agents on your own machine while driving them from a chat app. Native Feishu/Lark Card 2.0 streaming, mid-turn steering, and 11 more transports including Telegram, Slack and Discord. Privacy-first, with the agent staying local.

remote-controltelegramslackfeishumobile
by timmyagentic Aug 31, 2026 7/10
app GitHub

todome: Kanban Board With a Claude Agent SDK Assistant

A Trello-style Kanban app whose built-in assistant is powered by the Claude Agent SDK and has context on your board, goals and profile. Instead of a generic chatbot bolted on, the assistant reasons about your actual tasks. Useful as a reference for embedding the Agent SDK in a product.

agent-sdkkanbanproductivityapp
by tanitaka-tech Aug 31, 2026 6/10
app GitHub

blotter: Rust CLI Logging Agent Friction as Append-Only Cuts

A tiny Rust CLI where agents record friction as 'cuts' and ideas as 'dogears' into an append-only JSONL file. Later you triage, verify and digest them into a list of the repo's real papercuts. Turns the annoyances an agent hits mid-task into durable data instead of lost chat scrollback.

rustcliloggingdeveloper-experience
by BigCactusLabs Aug 31, 2026 6/10
app Reddit

pAInapple Code: Web UI for Claude Code With an Auto-Journal

A web UI client for Claude Code released after nine months of after-hours work. It drives the Claude Code CLI under the hood so an existing subscription just works, and keeps an LLM-summarized journal of every turn. Built by someone who was working from an iPad over code-server and wanted something better.

web-uimobilejournalremote
by SnooHamsters6328 Aug 31, 2026 7/10
app GitHub

clawdeck: Zero-Dependency Local Dashboard for Claude Code Sessions

A local dashboard that shows Claude Code sessions, events, cost, worktrees and reviews in one place. One loopback server, no build step and no dependencies, so it starts instantly and never leaves your machine.

dashboardmonitoringsessionslocal
by m-sanchez Aug 31, 2026 7/10
app GitHub

pm-cortex: Product Manager Plugin With 45 Commands and Tiered Memory

A Claude plugin aimed at product managers: 45 commands, 8 auto-selected skills and 7 sub-agent reviewers wired to a three-tier memory that carries context between sessions. Broad and opinionated rather than a single-purpose tool, so worth a look mainly if PM workflows are your use case.

product-managementpluginmemorysubagents
by brainAlly Aug 31, 2026 5/10
app GitHub

better-bash: Non-Blocking Background Processes for Coding Agents

Background process management built for LLM coding agents: non-blocking bash with streaming output, stdin support and long-polling. Solves the common failure where an agent starts a dev server or long build and then blocks or loses the output.

bashbackground-jobstoolingstreaming
by alper-dev Aug 31, 2026 7/10
app GitHub

agents_control: Control iTerm2 Tabs and AI Agents From Telegram

Drives iTerm2 tabs, including running AI agents, from Telegram. Lets you check on or nudge a long-running local agent session from your phone without a full remote-desktop setup.

telegramiterm2remotemacos
by saparjohnick Aug 31, 2026 6/10
app GitHub

cc-agent-names: Give Each Claude Code Session a Human First Name

Assigns each Claude Code session a human first name so parallel sessions become distinguishable people you can refer to. A small quality-of-life fix for the confusion of running several sessions at once.

parallel-sessionsquality-of-lifenaming
by thinkingtoo Aug 31, 2026 6/10
app GitHub

breather: Offers a Stopping Point With a Written Handoff

Claude Code will keep going as long as you will; breather tracks real presence across all your sessions, reads your own calendar back to you, and offers a stopping point with a written handoff at safe moments. Explicitly never measures, lectures or blocks.

wellbeinghandoffsessionscalendar
by ilandahan Aug 31, 2026 6/10
app GitHub

ai-proxy-manager: Route Claude Code to Any Anthropic-Compatible API

A local smart-router daemon that points Claude Code and VS Code at any Anthropic-compatible API provider, with a CLI and web dashboard and no dependencies. Useful for switching between providers or self-hosted endpoints without editing config each time.

proxyroutingapidaemon
by marajulcsecu Aug 31, 2026 6/10
app GitHub

token-meter: macOS Menu Bar Usage Dashboard for Coding Agents

A macOS menu bar dashboard showing token usage, spend and subscription quota for Claude Code, Codex CLI and other coding agents. Fully local with no data upload. Chinese-language interface.

macostokensusagemenu-bar
by luweiCN Aug 31, 2026 6/10
app Reddit

collectiveai.tools: 841-Tool Open Directory That Actually Prunes

A three-year-old MIT-licensed AI tools directory: 841 tools across 64 categories, every entry tagged free/freemium/paid/open-source, 255 merged PRs from 154 contributors. Also covers MCP servers, prompts, skills and trending repos, and unusually for the genre, it removes dead entries.

directoryopen-sourcetoolsmcp
by hyraze Aug 31, 2026 5/10
app GitHub

music-library-tagger: Fix ID3 Tags and Cover Art via MusicBrainz

A Claude Code plugin that repairs ID3 tags and cover art across an artist's album folder so Navidrome, Plex or Jellyfin display it correctly. Every change is verified against MusicBrainz, presented as a reviewable plan first, and is reversible.

musicmetadatapluginmedia-server
by inflop Aug 31, 2026 6/10
app GitHub

agentdeck: Fleet of Parallel Claude Code Agents With Telegram Bridge

Runs a fleet of Claude Code agents in parallel, each in its own persistent tmux session, with a browser dashboard and a Telegram bridge for checking in remotely. Persistence via tmux means sessions survive disconnects.

paralleltmuxdashboardtelegramfleet
by yanhs Aug 31, 2026 7/10
app Reddit

Conduck: A First Shipped App Built Entirely Through Vibe Coding

A former hotel manager with no coding background documents the workflow and tool stack behind their first publicly released app. Covers the progression from Sonnet 3.5 experiments through failed internal projects to a shipped product. Useful as a concrete non-developer workflow write-up rather than a tool.

case-studyvibe-codingworkflow
by semibaron Aug 31, 2026 5/10
app Reddit

PNR Finite Systems Toolkit: Deterministic Primitives So Agents Skip Model Calls

A 581-line open-source toolkit giving agents deterministic operations: bounded candidate search, state machines, simulations, checks and persistent workflows. The premise is that repeated state updates, finite workflow reduction and dependency-aware work across restarts shouldn't need another LLM round trip. Small enough to read end to end.

deterministicstate-machineworkflowopen-source
by MetroVenator Aug 31, 2026 6/10
app Reddit

manzanas: One Agent Driving Seven iOS Simulators Across Three Macs

Built by pointing Fable 5 at a homelab's accumulated agent sessions, this distributes iOS smoke tests across many simulators rather than serializing them on one. Each agent gets its own simulator, cutting a long single-machine run down substantially. Aimed at iOS developers running agent-driven test suites.

iostestingdistributedsimulator
by Plastic-Risk-6309 Aug 31, 2026 6/10
app Reddit

A News Site Run by AI Agents That Framing-Checks Its Own Stories

Most news is factually true and still built to make you feel a certain way; fact-checking catches lies but not framing. The author built an agent-run news site around what they call a "framing-check" — flagging headlines that overreach the article, numbers with no baseline, and quotes from interested parties. An unusual application of agent pipelines to editorial judgment.

newsagentseditorialfact-checking
by jerupjerup Aug 31, 2026 5/10
app Reddit

A Per-Key Keyboard Lighting Engine Reverse-Engineered in Claude Code

The stock software for an Epomaker TH108 could only run one lighting effect at a time, so the author reverse-engineered the HID lighting protocol and rebuilt it over WebHID in a normal browser tab. Layers reactive keys on an animated background with no firmware mod, vendor software or internet connection. A background daemon keeps the lighting running.

webhidreverse-engineeringkeyboardbrowser
by BeyondSmash Aug 31, 2026 6/10
app Reddit

PromptForge: A Local 150M Prompt Quality Scorer to Gate Your Agent Calls

A small open-source model that sits in front of an LLM, agent or prompt optimizer and scores prompts across clarity, specificity, context, goals, constraints, completeness and actionability. It identifies weaknesses before you spend a large-model call, with an optional optimizer that rewrites weak prompts. Runs entirely locally.

prompt-engineeringlocal-modelquality-gateopen-source
by Miserable_Extent8845 Aug 31, 2026 6/10
app Reddit

TermDrop: Paste Files and Screenshots Straight Into a Remote SSH Terminal

Getting screenshots and images to agents running on a rented remote server usually means juggling temp file hosts. TermDrop is a browser-based drop target that pushes pasted or dragged files directly to your SSH session. Free and requires no client install.

sshfile-transferremotebrowser
by offmylawn10 Aug 31, 2026 6/10
app Reddit

revue: A Terminal UI That Narrates a Large Diff Instead of Dumping Files

Breaks a big code change into ordered, narrated chunks — a guided tour rather than a wall of files — so you can review agent output without leaving your multiplexer. Combines and extends ideas from hunk and stage-cli. The author is gathering feedback on the approach.

code-reviewtuidiffterminal
by mtford Aug 31, 2026 7/10
app GitHub

oh-my-knowledge: Evidence-Backed Evaluation and Observability for Agent Stacks

OMK evaluates and observes prompts, RAG pipelines, skills, agents and workflows, tying every judgement back to evidence rather than a bare score. Ships native support for Claude Code, Codex and the DeepSeek harness. Aimed at teams who need to prove an agent change actually helped.

evaluationobservabilityragagents
by lizhiyao Aug 31, 2026 6/10
app GitHub

token-save: Measure What Your AI Coding Sessions Actually Cost

Reads your own session data to report real token and cost figures, then gives advice derived from your numbers instead of generic guidance. Useful for finding which workflows are quietly expensive. Part of the agent-toolworks tooling family.

cost-trackingtokensanalytics
by agent-toolworks Aug 31, 2026 6/10
app GitHub

paraqualis-gxp: A Life-Sciences CSV and GxP Toolkit for Claude Code

Covers GAMP 5, 21 CFR Part 11 and EU GMP Annex 11 with live eCFR and openFDA lookups plus an IQ/OQ/PQ qualification engine. Ships slash commands, auto-invoked skills, parallel sub-agents, an MCP server and a document-protection hook. One of the more complete regulated-industry Claude Code integrations published.

gxpcompliancelife-sciencesmcp
by paraqualis Aug 31, 2026 7/10
app GitHub

cc-status-lite: Context Usage and Both Limit Windows in Two Status Lines

Shows context usage alongside your 5-hour and weekly limits, each with its reset time, in a compact two-line Claude Code status line. Cross-platform across macOS, Linux and Windows. Minimal alternative to heavier usage dashboards.

status-lineusage-limitsmonitoring
by qndls42 Aug 31, 2026 6/10
app GitHub

AI Token Optimizer: A Local Context Compressor With Per-Tool Profiles

Compresses context locally with dedicated Claude Code, Codex and Cursor profiles, removing duplicate context, prioritizing git diffs and filtering generated files. Adds conversation summaries, token estimates, reusable presets, and clipboard or folder workflows. Runs without sending anything out.

context-compressiontokenslocalcursor
by uniqueplume Aug 31, 2026 6/10
app GitHub

Reminal: Every Desktop and Terminal You Own, Live in Any Browser

Streams your machines' windows, desktops and terminals to a browser so you can close the lid and keep working — useful for checking on long-running agent sessions. End-to-end encrypted with no open ports, no client install and no account. Self-contained by design.

remote-accessterminale2e-encryptionbrowser
by harshalgajjar Aug 31, 2026 5/10
app GitHub

touchneedle: Catch Fabricated and Hallucinated Citations in Markdown or .docx

Verifies that the citations in a document are real, accurately described and used consistently throughout. Works on Markdown and .docx, so it fits documents agents actually produce. Directly targets one of the most damaging LLM failure modes.

citationshallucinationverificationdocuments
by nicoleman0 Aug 31, 2026 6/10
app GitHub

omarchy-copilot-api: Copilot Quota Meters in the Omarchy Bar

Runs copilot-proxy-api from the Omarchy bar with GitHub sign-in and live Copilot quota meters. Wires Claude Code or Codex CLI to it in one click. Niche to Omarchy users but a tidy piece of desktop integration.

copilotomarchyquotadesktop
by voidsteed Aug 31, 2026 5/10
app GitHub

grepai: Semantic Search and Call Graphs for AI Agents, Fully Local

Gives agents semantic code search plus call-graph navigation without sending code anywhere. The combination matters — semantic retrieval finds candidates, call graphs prove how they connect. Entirely local operation.

semantic-searchcall-graphlocalcode-navigation
by yoanbernabeu Aug 31, 2026 7/10
app GitHub

claude-code-arcade: Playable 80s Arcade Games in Your Status Line

Puts small arcade games into the Claude Code status line for the gaps while an agent works. Purely for fun, but a genuinely creative use of the status line API. Worth a look if only for the implementation.

status-linegamesfun
by jystervinou Aug 31, 2026 5/10
app GitHub

QuotaDock: A Windows Widget for Claude, Codex and Gemini Usage Limits

Monitors usage limits, quotas and reset timers for Claude, OpenAI Codex and Google Antigravity from a Windows desktop widget. Built in Go with Fyne, with no telemetry. Fills a gap for Windows users left out of most macOS menu-bar trackers.

usage-limitswindowsmonitoringgo
by jungdosa Aug 31, 2026 6/10
app GitHub

cache-ttl-analyzer: Would a Longer Prompt-Cache TTL Have Saved You Money?

Analyzes Claude Code session logs to answer whether extending the prompt-cache TTL would have paid off for your actual usage pattern. Turns a pricing decision into a measurement instead of a guess. Small, focused tool.

prompt-cachingcostanalyticssessions
by cebert Aug 31, 2026 6/10
app GitHub

ExpertLM: Turn Any YouTube Channel Into a Cited, Searchable Knowledge Base

Indexes a channel's content so you can query it from the terminal, returning exact citations with every answer. The citation requirement is what separates it from generic transcript search. Useful for mining long-form expert content.

youtubeknowledge-basecitationscli
by mimic-communion7457 Aug 31, 2026 6/10
app GitHub

claude-whatsapp: Connect a WhatsApp Number to Claude Code

Wires a WhatsApp number into Claude Code so it can automate messages and manage conversations. Turns a chat thread into an agent interface. Check the permission model carefully before pointing it at a personal number.

whatsappmessagingautomation
by penstemoncyananthuslogicgate5289 Aug 31, 2026 5/10
app GitHub

deltoids: A Diff Filter That Expands Hunks to Their Enclosing Function

Uses tree-sitter to widen every hunk to the surrounding function or block, so a diff reads with its context intact. Works as a pager for git, gh or lazygit, and as a viewer for coding-agent edit traces. Directly improves reviewing agent-generated changes.

difftree-sittercode-reviewgit
by juanibiapina Aug 31, 2026 6/10
app GitHub

aitrack: Usage and Cost Heatmaps Synced Across Machines via Your Own Git Repo

Tracks and visualizes Claude Code, Codex and Cursor usage with heatmaps and statistics. Multi-machine sync happens over a git repository you control, so no third-party service holds your data. Good fit for people working across several machines.

usage-trackingcostgit-syncvisualization
by bircni Aug 31, 2026 6/10
app GitHub

roblox-studio-claude-code-template: Roblox Game Scaffolding for Claude Code

Sets up skill routing and the Roblox Studio MCP server, and keeps enough written state that a new session knows where the last one stopped. Removes the setup friction from agent-assisted Roblox development. Template rather than framework.

robloxmcptemplategame-dev
by Im-Bob Aug 31, 2026 5/10
app GitHub

ox-driver: Launch a Fleet of OpenRouter Ox Alpha Agents at Max Reasoning

Drives a fleet of high-reasoning agents through Pi, usable directly in the Pi harness or driven from Claude Code or Codex. Useful for fanning hard reasoning work out to a different model pool. Requires OpenRouter access.

openrouterfleetpiorchestration
by jvogan Aug 31, 2026 5/10
app GitHub

claudeloop: An Autonomous Session Runner That Never Blocks on a Human

Runs Claude Code sessions continuously with onion architecture, distinguishing rate limits from exhausted credits and resuming safely across usage windows. That distinction matters — most runners retry blindly into a wall. Also a full Anthropic SDK CLI.

autonomoussession-runnerrate-limitssdk
by adammatthewsteinberger Aug 31, 2026 6/10
app GitHub

claude-statusline-gauge: Pace Gauges, Not Just Usage Bars

Shows whether you're ahead of or behind pace on your 5-hour and 7-day windows, and where your current burn rate lands you. Knowing the trajectory is more actionable than knowing the percentage. Drops into the Claude Code status line.

status-lineusage-limitspacingmonitoring
by aronmarden Aug 31, 2026 6/10
app GitHub

ohmyboring: Distill Claude Code Sessions Into a Local, Human-Readable Wiki

A self-hosted personal memory RAG with a Rust engine, Python hooks and Ollama for inference, recalling past session knowledge on demand. The wiki output stays human-readable, so you can audit what it remembered. Zero cloud dependency.

memoryragself-hostedollama
by jazz1x Aug 31, 2026 7/10
app GitHub

swe-mux: A Tailscale-Enabled Agentic Control Plane Optimized for Mobile

A terminal multiplexer and control plane for coding agents, reachable over Tailscale so you can drive sessions from a phone. Mobile-first layout rather than a desktop UI squeezed down. Good fit for supervising long agent runs away from the desk.

multiplexertailscalemobilecontrol-plane
by jatoran Aug 31, 2026 6/10
app GitHub

agent-layer: Detect Poisoned Skills and Expire Stale RAG Knowledge

Two small tools for the agent layer: one detects skill poisoning, the other gives RAG bases temporal validity so stale facts expire. Pure Node with zero dependencies and no network access. Prompt-injection defence at the skill-supply-chain level.

securityprompt-injectionragskills
by Abner-Machado Aug 31, 2026 6/10
app GitHub

parlay: Talk to Your Background Coding Agents From Your Phone

Every long-running agent gets its own chat channel with voice-first control and a durable identity that survives restarts. The durable identity is what makes it usable — the agent you were talking to yesterday is still there. Built for supervising background work.

mobilevoicebackground-agentschat
by trillium Aug 31, 2026 6/10
app GitHub

antgrid: An Agent-First IDE and E2E-Encrypted Command Centre

Built around coding agents as the primary user rather than retrofitting an editor, with end-to-end encryption on the command centre. Aims to be where you supervise agents rather than where you type code. Early but ambitious.

ideagentse2e-encryptioncommand-centre
by antgrid-ai Aug 31, 2026 6/10
app GitHub

AgentNotify: A Local Windows Attention Broker for Autonomous Agents

Agents send a small authenticated request and AgentNotify shows a dedicated non-activating WPF toast, so your focus isn't stolen mid-task. Unresolved requests stay visible from the system tray with full local history. Solves the "which of my six agents needs me" problem on Windows.

notificationswindowsautonomous-agentsattention
by Akash97p Aug 31, 2026 6/10
app GitHub

JiegeOSBench: Benchmarking a Single-Prompt Rust OS Kernel Across Claude Models

Compares Claude Code running Fable, Opus and Sonnet on the task of implementing a Rust OS kernel from a single prompt. A hard, unambiguous benchmark that's difficult to game with surface-level output. Useful reference data for model selection on deep systems work.

benchmarkrustkernelmodel-comparison
by wangrunji0408 Aug 31, 2026 6/10
app GitHub

seankoji-com/claude-plugins: Marketplace Plus Cross-Platform Generator

Curates Claude Code plugins and includes a generator that emits equivalents for Claude, OpenCode and Antigravity. The generator is the interesting half — write once, target three harnesses. Marketplace-format install.

marketplacepluginsgeneratoropencode
by seankoji-com Aug 31, 2026 5/10
app GitHub

Ariadne: Browse What Your Agents Wrote and Keep the Drafts Worth Keeping

A Mnemosyne OS cartridge that reads Claude Code and Antigravity session transcripts locally, letting you promote good drafts into your own memory system. Recovers the writing buried in transcripts you'd otherwise never revisit. Currently in beta.

transcriptsmemorylocalsessions
by Mnemosyne-OS Aug 31, 2026 6/10
app GitHub

conference_connector: Meet the Right Researchers at a Conference

A hybrid Python library and agentic skill for finding and connecting with relevant researchers at an academic conference. Originally built for ECCB 2026. Niche but a nice example of a library plus skill pairing.

researchconferencesnetworkingskills
by scicrow Aug 31, 2026 5/10
app GitHub

agent-deck: Launch and Control Claude Code Sessions From Your Phone

A web launcher and session manager for Claude Code and Codex on macOS with WezTerm, letting you start, watch and steer sessions remotely. Built around WezTerm rather than tmux, which is an unusual choice. Phone-friendly interface.

session-managermobileweztermmacos
by IkumaHayashi Aug 31, 2026 6/10
app GitHub

NotchDial: Turn the MacBook Notch Into an AI Agent Switcher

Repurposes the notch area as a switcher between running coding agents, with three hand-crafted modes. Installs in one prompt via Claude Code, Codex or Cursor. Genuinely clever use of otherwise dead screen space.

macosnotchagent-switcherui
by kkssoswag Aug 31, 2026 6/10
app GitHub

ai-todo: One Input Box for Humans, a Pure-JSON CLI for Agents

A natural-language-first task manager where humans type freely and agents get clean JSON over a CLI. The dual interface avoids making either side use the other's format. Built on Next.js 16 with DeepSeek.

task-managerclijsonnextjs
by strzhao Aug 31, 2026 5/10
app GitHub

ai-community-skills: One Local, Searchable Catalog of Scattered Agent Skills

Pulls skills for Claude Code, Codex and Grok out of dozens of separate repositories into a single local catalog you can search, browse and install from. Runs a risk check on every skill before you install it. The risk check is a meaningful addition given skill-poisoning concerns.

catalogskillssecuritydiscovery
by xm1k3 Aug 31, 2026 7/10
app GitHub

wb: Talk at Your Notes Vault and Let an Agent File Them

A two-pane tmux workspace for voice-driven worldbuilding, where you speak and an agent organizes the notes into the vault. Removes the friction of filing while you're still thinking. Narrow use case, clean execution.

voicenotestmuxworldbuilding
by Samyc2002 Aug 31, 2026 5/10
app GitHub

agentic-awesome-skills: A Local Control Plane Over 2,005+ Agentic Skills

AAS Core handles catalog discovery, agent-owned selection, stack validation and planning across a large skill catalog, shipping a CLI, a local MCP server, plugins and a Workbench. Agent-owned selection means the model picks its own skills from the catalog. Local-first architecture.

control-planeskillsmcpcatalog
by saifullahseodeveloper Aug 31, 2026 6/10
app GitHub

imisic/claude-marketplace: Review Lenses, Anti-Slop and Leak Scanners

A Claude Code plugin marketplace bundling role-based senior review lenses, dev-workflow generators, anti-slop scanners, a pre-publish secret-leak scanner and drop-in rule packs. The pre-publish leak scanner is the standout. Installs as a marketplace.

marketplacecode-reviewsecretsplugins
by imisic Aug 31, 2026 6/10
app GitHub

KrokAI Law: Check Whether the Law Your AI Quoted Actually Says That

Verifies every legal quotation in a document against the real source text on your own disk, then sends the same question to several models and runs their quotations through the same check. Fully offline with no API key. A rigorous answer to legal hallucination.

legalhallucinationverificationoffline
by igorsaevets Aug 31, 2026 6/10
app GitHub

CLI-WeChat-Bridge: Drive Claude Code, Codex and OpenCode From WeChat

Integrates AI CLI tools into a WeChat bot with shared thread and session state between WeChat and the local terminal, bidirectional conversation, and two-way file transfer. Supports switching between CLIs, emoji-bound commands and bidirectional /resume. Documentation is in Chinese.

wechatbridgemobilesessions
by UNLINEARITY Aug 31, 2026 6/10
app GitHub

aweswitch: A CLI Proxy for Switching AI Model Profiles

Switches between model profiles for Claude Code, Codex and other CLIs through a proxy layer. Handy when you juggle several providers or accounts. Lightweight and focused.

proxymodel-switchingcli
by Webioinfo01 Aug 31, 2026 5/10
app GitHub

workspace-metabolism: Govern What Coding Agents Leave Behind in Your Workspace

One JSON policy file drives audit, recyclable cleanup and rollback of the files Claude Code, Codex, Aider and OpenClaw scatter around, backed by a hash-chained audit trail. Recyclable cleanup with rollback means you can be aggressive safely. Addresses a real and under-tooled problem.

workspacecleanuppolicyaudit
by metabolism-tools Aug 31, 2026 7/10
app GitHub

gald3r_core: One Shared Project Brain Across 30+ AI Tools

Combines file-first task and bug tracking with a multi-provider agent runtime, and its CRASH components keep one shared project brain usable across more than 30 AI tools. Distributed as a signed single binary. Ambitious scope, cleanly packaged.

platformtask-trackingmulti-providercli
by Gald3r-Labs Aug 31, 2026 6/10
app GitHub

open-claude-design: Use Claude Design From Claude Code, Codex and 20+ Agents

A cross-platform CLI bringing Claude Design's workflow to other coding agents, with automatic Agent Skills, codebase-grounded UI design, design-system sync, visual review, Impeccable integration and conflict-safe MCP workflows. Removes the copy-paste relay between the visual workspace and your terminal. Two-way sync keeps both sides current.

claude-designuidesign-systemcli
by maxritter Aug 31, 2026 7/10
app GitHub

ceiling-guard: A Local Plan-Window Meter and Observe-Only Watchdog

Meters your plan window and watches usage across Claude Code, Codex and Grok CLI without ever intervening. Observe-only is a deliberate choice — it warns rather than throttles. Runs entirely locally.

usage-limitswatchdogmonitoringlocal
by ak2tx Aug 31, 2026 6/10
app GitHub

Skills_switchtool: Central Skill Library With Snapshot Rollback

Manages Agent Skills from a central library with per-project switching and snapshot rollback, supporting Claude Code, Kimi Code, Cursor, Codex and six other agents. Ships as an Electron desktop app, a CLI and a TUI. Documentation is in Chinese.

skills-managementrollbackelectronmulti-agent
by Chongrong1234 Aug 31, 2026 6/10
app GitHub

agent-messageboard: Durable Message Passing Between Concurrent Agent Sessions

Supports direct mail, project-wide broadcasts and advisory file claims across repositories for concurrent coding-agent sessions. One static Rust binary and one SQLite file, with no daemon and no polling. The advisory file claims are what prevent two agents editing the same file.

multi-agentmessagingrustsqlite
by emrecdr Aug 31, 2026 7/10
app GitHub

quiv: 10-32x More Token-Efficient Architecture Discovery for Coding Agents

An Agent Knowledge Kit that lets agents understand a codebase's architecture at a fraction of the usual token cost. Architecture discovery is where most of an agent's early context goes. Measured efficiency claim rather than a vague one.

architecturetokenscontextdiscovery
by chama-x Aug 31, 2026 6/10
app GitHub

csift: Regex Search, File Recovery and Subagent Topologies for Sessions

Searches all Claude Code session record types by regex, recovers files, extracts images, inspects subagent topologies and matches plan files to sessions. Session transcripts hold a lot you can't otherwise get back. The most thorough session-forensics tool published so far.

sessionssearchforensicsrecovery
by wdhwg001 Aug 31, 2026 7/10
app GitHub

control-center: Dispatch Agents and Hand Them Disposable VMs to Test In

Dispatches and reviews AI coding agents, gives them disposable VMs to test in, and keeps meetings, tickets, pipelines and your calendar on one surface. Available as a desktop app on macOS, Windows and Linux, plus web and phone. Broad scope for a single tool.

dispatchvmsdesktopcontrol-plane
by SamuelAlev Aug 31, 2026 6/10
app GitHub

ctxfire: Static Cost Analysis for Multi-Agent Context Graphs

Explains what each agent loads into context and estimates tokens per fire and per day, statically rather than by running the system. Lets you catch an expensive context graph before it bills you. Useful for anyone running large agent fleets.

cost-analysiscontextmulti-agenttokens
by korovin-aa97 Aug 31, 2026 6/10
app Reddit

Chopi: macOS Sandbox for Running Coding Agents

A macOS sandbox for confining AI coding agents, shared by a user running it in daily practice. Restricts what an agent process can reach on the host so an unattended session cannot touch credentials or files outside its workspace. Relevant to anyone running Claude Code with relaxed permission modes on a Mac.

sandboxmacossecurityisolation
by yairchu Aug 30, 2026 6/10
app GitHub

keep5: Start Your Claude Code 5-Hour Usage Window on Schedule

Fires a minimal session to open the rolling 5-hour usage window at a time you choose, so the window is already running when you sit down instead of starting from your first real prompt. Supports both Claude Code and Codex, with no dependencies on macOS and Linux. Aimed at reclaiming hours otherwise lost to badly aligned window boundaries.

usage-limitsautomationclischeduling
by imkmao Aug 30, 2026 6/10
app GitHub

tmux-web-console: Mobile-Friendly Web Terminal With Agent Status

Serves persistent tmux workspaces as live terminals in a browser, with a layout that works on a phone. Surfaces coding-agent status alongside the terminals so you can see which session needs attention. Handy for checking on long-running Claude Code sessions away from your desk.

tmuxweb-terminalmobileremote-access
by lovinrain Aug 30, 2026 6/10
app GitHub

herdr-group-chat: Shared Local Room for Claude Code, Codex, and Grok

Puts Pi, Claude Code, Codex, and Grok Build into one shared local Herdr room so several agents and the user occupy a single conversation. Enables cross-agent handoff without copying context between terminals. Early-stage and local-first.

multi-agentchatorchestrationlocal-first
by terry-li-hm Aug 30, 2026 5/10
app GitHub

wuwei: Free Local-First AI Agent Desktop App

An open-source desktop agent that reads and writes files, edits code, and runs commands as an alternative to Claude Code, Cursor, or Copilot. Runs local-first with no setup and no API key required, on Windows, macOS, and Linux. Aimed at users who want an agent workspace without a subscription or key management.

desktop-applocal-firstopen-sourcecoding-agent
by wuwei-io Aug 30, 2026 7/10
app GitHub

universal-context-manager: Human-Governed Context for AI Coding Tools

Keeps project context in a local store that the human curates explicitly, rather than letting each tool accumulate its own opaque memory. Shared across AI coding tools so the same governed context follows you between them. Local-first by design.

context-managementmemorylocal-firstcross-tool
by SiluPanda Aug 30, 2026 6/10
app GitHub

create-ai-memory: Agent-Agnostic Session Memory in One Markdown Vault

Gives Claude Code, Codex, Gemini, Cursor, and opencode a single shared Markdown vault for persistent session memory. Because the store is plain Markdown, memory survives switching between CLIs rather than being locked to one vendor. Set up through a create-style installer.

memorycross-toolmarkdownpersistence
by rambaarde Aug 30, 2026 6/10
app GitHub

intentic: A Delegate-Work-Approve Workspace for Coding Agents

A workspace built around an explicit loop: you delegate a task, agents do the work, you approve the result. Structures agent output for review instead of leaving you to reconstruct what changed. Aimed at keeping a human decision point in every unit of work.

workspacedelegationreviewhuman-in-the-loop
by intentic Aug 30, 2026 6/10
app GitHub

hook-scanner: Static Supply-Chain Audit for AI Coding Tool Configs

A stdlib-only CLI that statically audits the places AI tooling executes code on your behalf: Claude Code hooks, VS Code settings, npm install scripts, GitHub Actions, and instruction files. Surfaces supply-chain risk in configuration that normally gets installed without review. No dependencies, so it can be run on an untrusted checkout cheaply.

securitysupply-chainhooksstatic-analysisaudit
by Santhosh595 Aug 30, 2026 8/10
app GitHub

devagent: Assign a Ticket, Get a Tested Pull Request

An autonomous backend delivery agent that takes a ticket through to a tested PR using multi-worker fan-out and sandboxed validation. Orchestration is evidence-gated, so a stage advances only against proof the work passed. Targets backend delivery rather than general-purpose chat coding.

autonomous-agentpull-requesttestingorchestration
by FreePeak Aug 30, 2026 7/10
app GitHub

streamdeck-claude-code: Launch a Session in Any Project With One Key

A Stream Deck plugin that starts a Claude Code session in a chosen project folder from a single key press. Removes the terminal-open-and-cd step when juggling several repos. Simple, single-purpose plugin.

stream-decklauncherhardwareproductivity
by diak0s Aug 30, 2026 6/10
app GitHub

softshell: A Chat-App Style Desktop Window for the Claude Code CLI

Wraps the Claude Code CLI in a messenger-style desktop window so a subscription session feels like a chat app instead of a terminal. Windows-only with a Chinese UI, running entirely locally. For users who find the terminal presentation a barrier.

desktop-appguiwindowscli-wrapper
by mckeygilham618-hub Aug 30, 2026 6/10
app GitHub

wheelhouse: Native macOS Client for the Codex App-Server, Driven by a Skill

A macOS app and CLI that talk to the OpenAI Codex app-server, shipped with a Claude Code skill for driving it. Lets a Claude Code session dispatch work to Codex through a proper client rather than terminal scraping. For users who run both tools side by side.

macoscodexskillinterop
by vinylfreak89 Aug 30, 2026 6/10
app GitHub

koda: Guardrailed Mac Coding Agent on Your Existing Subscription

A desktop coding agent for macOS that runs on the Claude or ChatGPT subscription you already pay for, with guardrails around what it can do. Gives a native app experience without a separate API bill. Alternative front end for subscription users.

macosdesktop-appguardrailssubscription
by Gr0x01 Aug 30, 2026 7/10
app GitHub

skill-sentry: Pre-Install Security Audit for Agent Skills

Statically scans a skill's SKILL.md, scripts, and config before you install it, flagging destructive commands, hidden network calls, secret reads, obfuscation, prompt injection, and persistence. Runs locally with explainable output, and ships a CLI, 36 test fixtures, and a GitHub Actions integration. Addresses a real gap now that skills are installed casually from arbitrary repos.

securityskillsstatic-analysisprompt-injectionaudit
by whaojie797-design Aug 30, 2026 8/10
app GitHub

sandy: Drop an Agent Into a Sandbox in Seconds

Wraps an agent process in a sandbox with minimal setup, so isolation is a one-command decision rather than an infrastructure project. From kontext-security. Lowers the friction of running agents with broad permissions safely.

sandboxsecurityisolationcli
by kontext-security Aug 30, 2026 6/10
app GitHub

diedinchat: Pin Agent Assertions to the Files They Were About

Captures claims an agent made in chat and attaches them to the specific files they concerned, storing the tickets in git so they survive sessions and tool switches. A pinned assertion automatically goes stale when the underlying files change. Attacks the problem of load-bearing conclusions evaporating when a session ends.

memorygittraceabilitysession-persistence
by pawankumar94 Aug 30, 2026 7/10
app GitHub

dagents: Chat-First Orchestration for Heterogeneous Coding Agents

Coordinates agents from different vendors through a chat-first interface, CLI-first and self-hosted. Keeps everything local rather than routing through a hosted control plane. For mixed-agent setups that should not depend on a third-party service.

orchestrationmulti-agentself-hostedcli
by dagents Aug 30, 2026 6/10
app GitHub

agentobs: Budget Limits and Guardrails Before Your Agent Overspends

Tracks Claude Code cost and usage locally and stops the agent before it blows through a budget you set, with guardrails alongside plain tracking. Local-first with no account required. Preventive rather than a dashboard you notice after the fact.

cost-trackingbudgetguardrailsobservability
by klars-ai Aug 30, 2026 7/10
app GitHub

canary-lab: Prove the Code Your Agent Wrote Actually Works

Sits after implementation and produces evidence that the change behaves as claimed, separating 'the agent said it works' from verified behavior. Complements rather than replaces your test suite. Aimed at the trust gap in agent-written code.

verificationtestingevidencequality
by ferterahadi Aug 30, 2026 6/10
app GitHub

brink: Claude, Codex, and Cursor Usage Limits on Your Screen Edge

Displays remaining usage for Claude Code, Codex, and Cursor along the edge of the screen on macOS and Windows. Always visible without occupying a window or requiring a terminal command. Small ambient indicator for limit-constrained work.

usage-limitsmenu-barmonitoringcross-platform
by semihtalii Aug 30, 2026 6/10
app GitHub

skillsgateway: Enterprise Gateway for Git-Distributed Skill Marketplaces

Provides a controlled distribution point for agent skill marketplaces served over git, covering Claude Code, Copilot, and Cursor. Lets an organization vet and publish skills internally instead of having developers install from arbitrary repositories. Directly relevant given the supply-chain risk in casually installed skills.

enterprisemarketplacegovernanceskillsdistribution
by skillsgateway Aug 30, 2026 6/10
app GitHub

accord: Review and Merge Every PR Waiting on You From One Window

A native app that gathers all pull requests awaiting your review, prioritizes them, and lets you review and merge without switching browser tabs. Not agent-specific, but useful when agent-generated PRs pile up faster than you can triage them. Single-window workflow.

pull-requestsgithubreviewdesktop-app
by dennispassway Aug 30, 2026 5/10
app GitHub

jeikcode: Fast Autonomous Terminal Coding Agent in Rust

An open-source terminal coding agent written in Rust, using AST micro-structure retrieval, a stable KV cache, and five levels of tool self-healing. Prioritizes speed and autonomy over interactivity. Chinese-language project.

rustcoding-agentterminalopen-source
by jeikl Aug 30, 2026 5/10
app GitHub

elepha: Search Your Past Claude Code Sessions and Recall Them In-Chat

Indexes local Claude Code and Codex session history so you can search what you did before and pull it back into the current conversation. Works across both the CLI and a desktop app. Turns session logs from a write-only archive into a usable memory.

memorysearchsession-historylocal-first
by elepha-app Aug 30, 2026 7/10
app GitHub

codex-weekly-usage-indicator: Always-On-Top Windows Usage Widget

An unofficial Windows widget that floats above other windows showing remaining Codex and Claude usage. Minimal footprint, single purpose. For Windows users who want the number visible without checking a terminal.

usage-limitswindowswidgetmonitoring
by GiantForestStudio Aug 30, 2026 5/10
app GitHub

dojo: Set Up Your Coding Tools on Any Machine With One Command

Bootstraps a full AI coding toolchain on a fresh machine from a single command. Makes a workstation reproducible rather than assembled by hand over months. Useful when you regularly work across several machines or VMs.

setupdotfilesbootstrapprovisioning
by Cyb3rRon1n Aug 30, 2026 5/10
app GitHub

SecondBrain: Local-First AI Memory Layer With Obsidian Integration

Persistent cross-project memory, session capture, and Markdown knowledge management for Claude Code, Codex, OpenCode, and Obsidian. Keeps everything local and in Markdown so your notes and your agent memory are the same corpus. For users already living in Obsidian.

memoryobsidianmarkdownlocal-first
by dogankoc Aug 30, 2026 6/10
app GitHub

agent-session-manager-desktop: GUI for Juggling Many Agent Sessions

A desktop front end for running and switching between multiple Claude, Gemini, Aider, and Codex sessions, built on Wails, Svelte, and xterm.js. The GUI counterpart to the CLI-based agent-session-manager. Addresses the lost-in-tabs problem when running several agents at once.

session-managementdesktop-appguimulti-agent
by izll Aug 30, 2026 6/10
app GitHub

ccdash: Go TUI Dashboard for Token Usage and Agent Sessions

A lightweight terminal dashboard showing Claude Code token usage, active agent sessions, and system resources. Written in Go, so it is a single binary with no runtime to install. Stays in the terminal rather than requiring a browser or desktop app.

tuimonitoringtoken-usagegodashboard
by jedarden Aug 30, 2026 7/10
app GitHub

llama-kit: Offload Agent Busywork to a Local llama.cpp Server

Routes mechanical sub-tasks to a local llama.cpp server so they consume zero cloud tokens, keeping the paid model for work that needs it. Ships as a toolkit plus Qoder CLI skill and agent integration. A concrete cost-reduction path for limit-constrained users.

local-llmllama-cppcost-optimizationoffloading
by flyingriverhorse Aug 30, 2026 6/10
app GitHub

kickoff-ai: A Reference AI Toolchain Setup With 41 Verification Checks

Presents itself as a reference setup rather than a starter kit: staged installation, 41 verification checks, and a tool registry with a 90-day sunset window for anything unused. Built for Apple Silicon and tested against a real 100-tool inventory. The sunset window is a useful answer to toolchain sprawl.

setupmacostoolchainverification
by leonkoellerwirth-arch Aug 30, 2026 5/10
app GitHub

deepclean-ai: Auditable Cleanup of Junk Left Behind by AI Tools

Removes the caches, logs, and artifacts AI coding tools accumulate, with rules that are published and auditable rather than a black-box cleaner. You can see exactly what a rule will delete before running it. Chinese-language project.

cleanupdisk-spaceauditablemaintenance
by onesun2012 Aug 30, 2026 6/10
app GitHub

WorkMeow: Windows Desktop Pet Showing Agent Status and Usage

A Windows x64 desktop pet that displays live status and token usage for Claude Code, Codex, TRAE, WorkBuddy, and opencode. Everything runs local-first, so session data never leaves the machine. Gives an ambient at-a-glance signal of whether an agent is still working without tabbing back to the terminal.

windowsdesktopusage-trackingmonitoringlocal-first
by vista-zhangg Aug 30, 2026 6/10
app GitHub

sandbox-pal: Sandboxed Agent Runs With Review Gates Before a PR

Runs a coding agent inside a sandbox so it cannot touch anything outside its workspace, then inserts review gates before it is allowed to open a pull request on your repo. The pitch is containment plus a human checkpoint at the moment changes leave the sandbox. Aimed at people running longer unattended sessions who want a blast radius.

sandboxsafetypull-requestreviewisolation
by jnurre64 Aug 30, 2026 6/10
app GitHub

esper: Plugin Marketplace With qa-swarm, code-atlas, and plan-runner

A Claude Code plugin marketplace shipping four plugins: qa-swarm (multi-agent code review with TDD fixes), code-atlas (architecture index and queryable graph), plan-runner (parallel plan execution), and jupiter (spec consolidation). The plugins cover review, codebase navigation, and parallel execution as one installable set. Useful as a bundle rather than piecemeal.

marketplacepluginscode-reviewmulti-agentarchitecture
by MisterVitoPro Aug 30, 2026 7/10
app GitHub

legion: Local Rust CLI That Stores and Retrieves Agent Reflections

A local memory layer for Claude Code built as a Rust CLI. It captures the agent reflections from your sessions and retrieves them later, so accumulated judgment about a codebase survives across sessions. Aimed at a single engineer craft rather than team-wide knowledge sharing.

memoryrustclireflections
by runlegion Aug 30, 2026 6/10
app GitHub

claudebox: Containerized Isolation and Agent Profiles with a Web UI

Runs AI coding agents inside containers so a misbehaving agent cannot touch your host machine. Supports customizable agent profiles for different projects or permission levels, and ships a visual web UI for driving sessions instead of the terminal.

sandboxcontainersdockerweb-uiisolation
by jakubro Aug 30, 2026 7/10
app GitHub

chronicle: Sync Agent Session History Across Machines via Git CRDT Merge

Keeps your Claude Code and Pi session history in sync across multiple machines. It canonicalizes project paths so the same repo checked out at different locations lines up, then merges histories through a Git-backed CRDT so concurrent edits from two machines resolve without conflicts.

sessionssyncgitcrdthistory
by geekmuse Aug 30, 2026 6/10
app GitHub

claude-usage-tracker: Zero-Dependency Local Dashboard with Pace Predictions

A local dashboard that reads your Claude Code usage data and shows token counts, costs, plan limits, and pace predictions for whether you will hit your cap. Updates live and includes a picture-in-picture widget so the numbers stay visible while you work. No dependencies to install.

usagetokensdashboardlimitsmonitoring
by jonax1337 Aug 30, 2026 6/10
app GitHub

hivemind: Capture, Search, and Replay Agent Sessions with Your Team

From Weights & Biases, an observability tool for agentic coding. It captures your Claude Code sessions so you can search them, replay how a task actually unfolded, and share the trace with teammates. Aimed at teams that want to learn from each other agent runs rather than each person debugging in isolation.

observabilitysessionsreplayteamwandb
by wandb Aug 30, 2026 7/10
app GitHub

AgentRQ: Self-Hosted Realtime Task Manager for Driving Agents from Anywhere

A human-in-the-loop conversational task manager that lets you control your coding agents from mobile, web, or desktop. Self-hosted and harness-agnostic, designed to work with your existing Claude subscription rather than an API key. Fills the gap for people who want to check on or redirect a running session away from their terminal.

self-hostedmobiletask-managerhuman-in-the-looprealtime
by agentrq Aug 30, 2026 6/10
app GitHub

spinwait: Sell Ad Space in Your Claude Code Status Bar

Turns the Claude Code status line into an ad slot, showing a single labelled sponsored line only while the model is working. The developer keeps 70 percent of the revenue it earns. An unusual experiment in monetizing agent idle time rather than a productivity tool.

statuslinemonetizationadsexperiment
by robert-botto Aug 29, 2026 5/10
app GitHub

tracks: Local-First Viewer for AI Coding-Agent Sessions

A local-first desktop viewer for browsing AI coding-agent session history, including Claude Code transcripts. Everything stays on your machine — no upload step or hosted account — making it usable for reviewing sessions that touched private repos. Useful for auditing what an agent actually did across a long run.

session-viewerlocal-firstobservabilitytranscripts
by amitray007 Aug 29, 2026 7/10
app GitHub

klepsydra: Always-On Claude Code Usage Widget for GNOME

A small desktop widget for Debian/GNOME that displays your Claude Code usage in real time. It sits always-on-screen so you can watch quota burn without dropping into a terminal. Niche to the Linux desktop, but a straightforward answer to "how much of my window have I used".

usage-trackinggnomelinuxdesktop-widget
by corvardt Aug 29, 2026 6/10
app GitHub

memory-vault-sync: Shared Local Memory Across Codex, Claude Code, and Gemini CLI

A local-first associative memory store that several agent CLIs read from and write to, so context follows you between tools. It is taskless — no explicit save step or task list to maintain — and everything stays on your machine. Relevant if you switch runtimes mid-project and keep re-explaining the same background.

memorylocal-firstcross-toolcodexgemini-cli
by qh-work Aug 29, 2026 6/10
app GitHub

ciaobot: A Local Web App Front End for Claude Code and Codex

An opinionated local web interface that treats Claude Code or Codex as a personal assistant and second brain. Chats, projects, files, schedules, memory, and archived knowledge live in one place instead of being scattered across terminal sessions. For people who want agentic work to persist and stay browsable after the terminal closes.

guiweb-appsecond-braincodexlocal
by raffaelefarinaro Aug 29, 2026 7/10
app Reddit

Recall: External Memory Store That Survives Claude Code Sessions

An external memory store that persists decisions, patterns, failed approaches, and architectural choices between Claude Code sessions, so you stop re-explaining the same context after a break. The author has run it daily for several months and drives it from a simple slash command. Aimed at the gap compaction doesn't close — knowledge lost when a session ends entirely.

memorypersistencecontext
by joseairosa Aug 29, 2026 6/10
app Reddit

open-jobs: A 2M-Job Dataset Plus AGENTS.md That Runs Your Job Search

Clone the repo, point Claude Code at it, and the AGENTS.md drives the whole search: it interviews you, writes an ideal job description, embeds it once, then downloads a slice of a two-million-job dataset locally and ranks matches. Needs a real machine rather than the web app because of the dataset download. A good worked example of shipping an agent workflow as a repo instead of an app.

agents-mdjob-searchdatasetautomation
by OminousLatinWord Aug 29, 2026 7/10
app Reddit

xfa: A Reddit-Style Message Board for Agent-to-Agent Collaboration

A shared message board that lets subagents and sessions across different LLM providers post to and read from each other rather than working siloed. Inspired by an incident where agents coordinated through a message board. The author reports it works best when several subagents need to reach consensus or debate before converging on a goal.

multi-agentcollaborationsubagents
by securisec Aug 29, 2026 7/10
app Reddit

claude-orgtree: Visual Multi-Agent Orchestrator With an Authority Hierarchy

Open-source orchestrator that arranges Claude Code, Codex, and Gemini agents on a draggable canvas organised by authority, so agents can talk to each other instead of stepping on one another's work. Supports reordering and reorganising the hierarchy as a project evolves. The gallery shows real organisations the author maintains across live projects.

orchestrationmulti-agentvisualcanvas
by DynaBeast Aug 29, 2026 8/10
app GitHub

tarocub: Feishu/Lark-First Local Gateway for Claude Code and Other Agents

A local gateway that drives Claude Code, Codex, Kimi Code, DeepSeek Harness, and Antigravity from Feishu/Lark, with optional Telegram support. Ships a native DeepSeek Harness plugin. Useful if your team already lives in Lark and wants to hand work to a coding agent from chat.

gatewayfeishularkchat-ops
by cloveric Aug 29, 2026 5/10
app GitHub

plantor: A Local Browser Surface for Annotating Claude Code Plans

Minimal plan review tool — Claude's plan renders in your browser, you annotate it inline, and the feedback goes back to the agent. Zero dependencies, no network, roughly 400 lines of stdlib Python. Fills the gap where plan mode gives you one approve/reject decision instead of line-level comments.

plan-modereviewlocal-firstpython
by pranayyelugam Aug 29, 2026 8/10
app GitHub

RedactGate: Local Outbound Redaction Gateway for Cloud Coding Agents

Sits between Claude Code or Codex and the cloud, stripping sensitive data from outbound traffic before it leaves your machine. Chinese-language project. Complements deny rules by controlling what escapes rather than what the agent is allowed to open.

securityredactionprivacygateway
by SuperMarioYL Aug 29, 2026 7/10
app GitHub

agent-usage-bar: Codex and Claude Quota in the macOS Menu Bar

Menu bar app showing remaining Codex and Claude quota, what you've spent locally, and when the usage window resets. Small, single-purpose answer to the recurring question of how much budget is left before the next reset.

macosusagequotamenu-bar
by softmaxe Aug 29, 2026 6/10
app GitHub

claude-session-manager: Find and Resume Any Session From Any Directory

Search across all Claude Code sessions regardless of which directory they started in, and resume the one you want. Tagged sessions are exempted from Claude Code's 30-day cleanup, so the ones that matter survive. Solves both halves of session loss — finding it, and it still existing.

sessionsresumesearchretention
by soohunee Aug 29, 2026 7/10
app GitHub

cfetch: Local-First Memory and Context Engine With Cited Recall

Context engine for Claude Code, Codex, Gemini, and MCP clients that returns cited Markdown recall alongside code search, wired in through hooks and servable across machines. The citations matter: recalled context points back at its source instead of arriving as unattributed assertions.

memorycontextcode-searchhooks
by corbet-labs Aug 29, 2026 7/10
app GitHub

claude-message-queue: A Durable Next-Turn Queue for Claude Code

Queue messages for Claude Code CLI and Desktop that are delivered on the next turn instead of interrupting the current one, and survive restarts. Lets you keep typing follow-ups while the agent works without derailing what it's doing.

queueclidesktopworkflow
by imdewan Aug 29, 2026 7/10
app GitHub

metagent: Native macOS Control Center for Skills, MCP Servers and Usage

macOS app plus local CLI and MCP surface for managing coding-agent skills, MCP servers, usage, provenance, and project health in one place. Provenance tracking is the less common part — knowing where an installed skill actually came from.

macosmcpskills-managementprovenance
by ianwatts22 Aug 29, 2026 7/10
app GitHub

lerp: A TUI That Runs Coding Agents Over Your Linear Board

Terminal UI that pulls issues from Linear and dispatches coding agents against them, keeping the board as the source of truth for what to work on next. Closes the loop between issue tracker and agent without a web dashboard.

lineartuiissue-trackerautomation
by mattwalters Aug 29, 2026 7/10
app GitHub

plexus: Claude Code and Copilot CLI Joined by a Consensus Loop

Runs Claude Code and Copilot CLI side by side over a shared task board, where neither agent can mark work finished without the other signing off. The mutual sign-off is the point — it turns cross-model disagreement into a gate rather than a coin flip.

multi-agentcopilotconsensustask-board
by Ray-Hughes Aug 29, 2026 7/10
app GitHub

agentstats: Offline Usage and Cost Analytics for Coding Agents

Local analytics over Claude Code, Codex CLI, and Gemini CLI usage with zero dependencies and no network access. Reads what's already on disk, so it works offline and nothing about your sessions leaves the machine.

analyticsusagelocal-firstcli
by HNUYJJ Aug 29, 2026 6/10
app GitHub

damame: A Profiler for Your AI Coding Sessions

Analyses your coding sessions into evidence-linked findings and an opportunity-aware profile of your AI skills — where you're losing time and what to change. Local-first with zero telemetry. Profiles the operator rather than the code.

profilingsessionslocal-firstanalytics
by shashankgdev-bit Aug 29, 2026 6/10
app GitHub

CharmOS: Managing Humans and AI Agents as First-Class Relationships

Open-source framework treating people and agents as the same kind of entity on a personal second brain, driven by a Recall-to-Deep-Research loop. Manifest-first and Apache-2.0. An unusual framing of CRM and agent management as one problem.

second-brainframeworkrelationshipsresearch
by tonydzi Aug 29, 2026 5/10
app GitHub

best-skills: Daily Top 100 Agent Skills Rankings as Open CSV

Aggregates installs, growth, and social signal for agent skills from skills.sh, ClawHub, Tencent SkillHub, GitHub, X, and ten-plus communities into a daily top 100, published as open CSV. Handy for discovery when every skill repo claims to be the best one.

rankingsdiscoveryopen-dataskills
by LinklyAI Aug 29, 2026 6/10
app GitHub

OkTally: Every AI Coding Subscription Quota in One macOS Menu Bar

Tracks Claude Code, Codex, Cursor, OpenRouter, and other subscription quotas in the menu bar, with alerts fired before you hit a limit. The alerting is what separates it from the several read-only quota widgets around.

macosquotaalertsmulti-provider
by OkamiOps Aug 29, 2026 6/10
app GitHub

dephawk: Catch npm Dependencies Reading Your SSH Keys at Runtime

Runtime monitor that observes what installed npm packages actually do — reading SSH keys, touching secrets, phoning home — and blocks them. Relevant when an agent installs dependencies on your behalf and nobody reads the postinstall script.

npmsupply-chainsecurityruntime
by KirtashDev Aug 29, 2026 6/10
app GitHub

Restory: Record, Block and Restore What Your Coding Agent Does

Local-only layer that records every action your AI coding agent takes, blocks the ones you don't allow, and restores the tree to a previous state when something goes wrong. Undo for agent sessions rather than for individual edits.

undosafetyrecordinglocal-first
by DarkAxiom93 Aug 29, 2026 7/10
app GitHub

super-status: Context, Session Quality and Plan Limits in One Statusline

Claude Code statusline combining who you are, how much context is used, a session quality read, and plan-limit tracking into labeled lines at the bottom of the session. Consolidates what usually takes several competing statusline scripts.

statuslinecontextusagemonitoring
by orassayag Aug 29, 2026 6/10
app GitHub

digital-twin: Mine Your Session Logs Into a Twin Sub-Agent and CLAUDE.md Patch

Reads your Claude Code session history and produces a personalized profile, a twin sub-agent that works the way you do, and a suggested CLAUDE.md patch. Local-first — logs never leave the machine. Derives your preferences from evidence instead of asking you to write them down.

session-logspersonalizationsubagentsclaude-md
by danielbentes Aug 29, 2026 7/10
app GitHub

opentab: Browse Your AI Coding Spend in the Terminal

Terminal viewer for spend across OpenCode, Claude Code, Codex, and other agents. Terminal-native rather than a menu-bar widget, so it fits alongside the tools it's reporting on.

spendterminalusagemulti-provider
by hamidi-dev Aug 29, 2026 6/10
app GitHub

conductor: Rust TUI for Worktrees, Claude Sessions and Diff Review

Terminal UI that manages multiple git worktrees, runs Claude Code sessions in embedded PTYs, and lets you review diffs with structured inline comments — all without leaving the TUI. Combines the worktree juggling and the review step that usually live in separate tools.

rusttuiworktreescode-review
by S-Nakamur-a Aug 29, 2026 7/10
app GitHub

reels-engine: Short-Form Video Pipeline With a Frame-Level QA Gate

Automated pipeline running trend research, scripting against a craft bible, HeyGen avatar cloning, Remotion graphics, a frame-level QA gate, and Telegram approval before publish. MIT-licensed. The QA gate and human approval step are what keep it from being a slop generator.

videoautomationremotionpipeline
by johannships Aug 29, 2026 5/10
app GitHub

Project-Memory-Agent: One Trustworthy Memory File Per Repository

Gives coding agents a single authoritative memory for a repo so they stop re-learning the same facts and stop scattering conflicting memory files. Targets the failure mode where three agents each maintain their own notes that disagree.

memoryrepositoryconsistency
by LoveDoLove Aug 29, 2026 6/10
app GitHub

skill-health: Structural Debt Scan for Your Skill Library

Deterministic scanner that finds missing artifacts across a skill library — the code layer of the Agent Knowledge Cycle's Curate phase. Checks structure mechanically rather than asking a model whether your skills look fine.

skillslintingmaintenancecuration
by shimo4228 Aug 29, 2026 6/10
app GitHub

agentfiles: Do Agent-Instruction Files on GitHub Hide Instructions? Measured.

Empirical study scanning 2,500 repositories and 1,652 agent-instruction files for hidden or adversarial instructions. The result is negative — none found — which is a useful data point against assuming AGENTS.md files in the wild are a live prompt-injection vector. Method and data are in the repo.

researchsecurityprompt-injectionagents-md
by agentatwork Aug 29, 2026 7/10
app GitHub

cmd: Record a Task Once, Get Reviewable Results Back

You describe what needs doing a single time; CMD dispatches agents to do it and returns results in a reviewable form. Aimed at recurring work you'd otherwise re-explain to an agent every time it comes up.

task-managementdelegationreview
by earthperegrin-creator Aug 29, 2026 6/10
app GitHub

easycc: Claude Code Running in Three Minutes in Mainland China

BYOK setup path for Claude Code aimed at users in mainland China, with no account required and no user data passing through the project. MIT-licensed. Addresses an access problem that most setup guides ignore.

chinabyoksetupaccess
by duliangkuan Aug 29, 2026 6/10
app GitHub

start: Generate an Agent-Ready Next.js Workspace From a Reviewed Blueprint

Produces a Next.js workspace already structured for agent work, generated from a blueprint you review first in the browser or terminal. The review step before generation is the useful part — you catch structural mistakes before there's code to unpick.

nextjsscaffoldingblueprint
by Bishoymly Aug 29, 2026 6/10
app GitHub

aimem: Turn-by-Turn Session Journaling With Cross-Machine Sync

Journals every turn to local SQLite, curates the durable facts out of that log, and syncs the result across machines. Works with Claude Code and OpenCode. Recovers a crashed session as well as carrying memory forward.

memorysqlitesyncresilience
by BlackVS Aug 29, 2026 7/10
app GitHub

Brownian-Dynamics-Agent: From Hand-Drawn Sketch to a Defended Simulation Result

Takes a sketch and produces a Brownian-dynamics result you can defend: dimensional analysis first, predictions sealed before running, and failed attempts kept rather than discarded. A rare example of an agent workflow built around scientific method rather than throughput.

simulationphysicssciencemethodology
by kyu-softmatter Aug 29, 2026 6/10
app GitHub

build-story: Reconstruct a Project's Real History From Git and Session Logs

Mines git history together with AI coding sessions to surface rework, rollbacks, and time sinks, then generates a retrospective, a portfolio piece, and evidence-backed résumé material. Chinese-language. The rework detection is the interesting output.

gitretrospectiveanalyticssessions
by ZekerTop Aug 29, 2026 6/10
app GitHub

waybill: Portable Handoff Bundles for Continuing Work Across Agent CLIs

Packages an unfinished task into a portable bundle another agent CLI can pick up, so switching tools mid-task doesn't mean re-explaining the state. Useful when you hit a usage limit on one provider and want to continue elsewhere.

handoffportabilitycross-agentsessions
by wardmos Aug 29, 2026 7/10
app GitHub

agentctl: Fuzzy-Resume Claude Code and Codex Sessions From One Menu

Start and resume Claude Code and Codex sessions from a single launcher with fuzzy search and a transcript preview before you commit. Ships both a terminal TUI and a native macOS menu-bar GUI. The transcript preview is what makes resuming the right session practical.

sessionsresumetuimacos
by roypadina Aug 29, 2026 7/10
app GitHub

lexsus: Connect Local Coding Work to Web Chat AIs

Local-first desktop app that bridges your working directory to browser-based assistants — ChatGPT, Claude.ai, Gemini — so you can use a web subscription against local code without copy-pasting files.

desktoplocal-firstweb-aibridge
by abdulwasea89 Aug 29, 2026 6/10
app GitHub

Claudia: One Window Over Every Parallel Claude Code Session

Single surface for all your concurrent Claude Code sessions, with SDK-owned sessions, approval handling, finish chains, and usage tracking. Built on the Agent SDK rather than by scraping terminal output.

sessionsparallelagent-sdkdashboard
by pquarterman17 Aug 29, 2026 7/10
app GitHub

etsy-printful-workbench: A Worked Example Written for Agents to Rebuild

Self-hosted workbench for matching, staging, and tracking Etsy listings fulfilled by Printful, published together with documentation aimed at AI agents building a production version. The docs-for-agents framing is the more interesting half.

etsyprintfulexampledocumentation
by zeveck Aug 29, 2026 5/10
app GitHub

octobench: Benchmarking Coding Agents, Not Just Models

Contamination-resistant harness that compares whole agents rather than underlying models, using 80 fail-to-pass cases from merged OSS PRs, long-run sequences, SWE-bench-Live, and 25+ domain benchmarks. The authors run their own agent under the same rules, which is the right disclosure for a vendor-published benchmark.

benchmarkevaluationswe-benchagents
by Muvon Aug 29, 2026 7/10
app GitHub

MARVIN: Native macOS Pair-Programming IDE on the Claude Agent SDK

SwiftUI macOS IDE with a project-aware Claude Agent SDK runtime built in, rather than a terminal wrapper or an editor plugin. For people who want the agent as a first-class part of a native app.

macosideswiftuiagent-sdk
by RobertIlisei Aug 29, 2026 7/10
app GitHub

portzilla: Port and Process Lease Coordination for Parallel Agent Sessions

Hands out leases on ports and processes so several concurrent coding-agent sessions don't fight over :3000. A small, specific fix for a problem that shows up immediately once you run more than two agents on one machine.

portsparallelcoordinationdev-servers
by 011010 Aug 29, 2026 7/10
app GitHub

Norml WordPress Copilot: REST API Content and Admin From Claude

Drives WordPress content and administration over the REST API from Claude Desktop, Cowork, or a CLI runtime. A companion advanced edition adds CLI-only theme development through GitHub, SSH, and WP-CLI.

wordpressrest-apicmsautomation
by normlstudio Aug 29, 2026 5/10
app GitHub

deepseek-as-subagent: give DeepSeek its own agent loop inside Claude Code

Wires DeepSeek into Claude Code or the Codex CLI as a genuine sub-agent rather than a one-shot model call. The sub-agent gets a 7-tool loop of its own and runs inside a sandboxed workspace, so it can iterate on a task and report back. A way to offload cheaper or bulk work to a second model without leaving your main session.

subagentdeepseekmulti-modelsandboxcodex
by PsChina Aug 29, 2026 7/10
app GitHub

ccaudit: Fast Claude Code Log Viewer as CLI, TUI, and Web UI

Reads your Claude Code session logs and surfaces token usage, cost, and full conversation history in three interfaces. The TUI is for quick session triage; the web view is for digging through past transcripts. Handy when you want to know where a week of usage actually went.

logstokenscosttuiobservability
by electricapp Aug 29, 2026 8/10
app GitHub

clean-room-launcher: Start Codex and Claude Code With Selective Context

A macOS launcher that opens a coding agent in a deliberately minimal environment, letting you pick exactly which context comes along. Cuts the default pile of config and history that gets loaded on startup. Useful when you want a session unpolluted by unrelated project state.

macoscontextlaunchercodex
by ewgenij87snwork Aug 29, 2026 6/10
app GitHub

Relay: Event-Driven Agent Runtime for Long-Running, Resumable Work

Replaces polling loops with notification callbacks, so an external event wakes the specific session that was waiting on it. Context is compressed with task-aware memory and subtasks dispatch into project-scoped sessions. Built for agent work that spans hours and must survive interruption.

runtimeeventsresumablememoryorchestration
by yangbobo2021 Aug 29, 2026 7/10
app GitHub

xonovex/platform: Execution Context Manager for Coding Agents

Bundles sandbox isolation, model provider routing, terminal session management, and Kubernetes orchestration behind one control plane for AI coding agents. Adds plan-driven development workflows on top. For running agents at more than single-laptop scale.

sandboxkubernetesroutingorchestration
by xonovex Aug 29, 2026 6/10
app GitHub

framer-import: Clone a Published Framer Site Into Code You Own

Pulls any live Framer site down into a real codebase, deploys it, and lets you keep editing through agent chat afterward. Gets you off the hosted builder without rebuilding the design by hand. Useful as an escape hatch from no-code site tools.

framerwebmigrationcodegen
by translational-vestment612 Aug 29, 2026 6/10
app GitHub

wechat-to-ai: Local-First WeChat Chat Export Plugin for Claude Code

Exports WeChat 4.1+ direct messages, group chats, and a ranked list of important contacts into a form Claude Code can read, with data never leaving the machine. Lets an agent reason over your chat history without uploading it anywhere. Documentation is primarily in Chinese.

wechatexportlocal-firstprivacyplugin
by chengmarc Aug 29, 2026 6/10
app GitHub

claude-drives-gemini: Generate Images, Video, and Music From Claude Code

Drives the Gemini web app through an existing Google AI Pro subscription to produce Nano Banana images, Veo video, and Lyria music from inside Claude Code. Generated media is written straight to disk so the bytes never enter the agent's context window. No separate API billing needed.

geminiimage-generationvideomediabrowser-automation
by MagicYangG Aug 29, 2026 7/10
app GitHub

hov-marketplace: Claude Code Plugins for Token, Gate, and Memory Tooling

A five-plugin marketplace: token-eater for usage, pro-gate for access control, wsl-cdp for Chrome DevTools on WSL, skill-tuner, and memory-dream. The WSL CDP plugin is the most specific — browser automation from Windows Subsystem for Linux is otherwise fiddly.

marketplacepluginswsltokensmemory
by StartupBros-com Aug 29, 2026 5/10
app Reddit

Claude Desktop on Fedora, Repackaged From the Official Linux .deb

Anthropic ships a Linux build only as a .deb; this repo converts that exact package into a proper Fedora RPM. The Code tab, Cowork, MCP, and sandbox all work, tested on Fedora 44 under KDE and GNOME on Wayland. Replaces the old Windows-installer hack, which broke on recent versions.

linuxfedoraclaude-desktoppackagingcowork
by Alternative_Seat2551 Aug 29, 2026 7/10
app GitHub

cc-mplace: One Plugin Index Per Host Across Five Coding Agents

A curated plugin marketplace that publishes a native index for each host — Claude Code, Codex, Cursor, Grok Build, and GitHub Copilot CLI — rather than one format everyone has to adapt to. Same catalog, host-appropriate packaging. Reduces per-agent porting work.

marketplacepluginscross-agentcodexcursor
by Djarvur Aug 29, 2026 6/10
app GitHub

ai-control-center: Touch-First Observability Appliance for Agent Sessions

Turns a Surface Pro into a dedicated control plane showing Claude Code usage, system telemetry, coding session state, and automations across several machines. Machines report through a normalized agent API. Built with Tauri, React, and Fastify, and runs local-first.

observabilitymonitoringtauridashboardtelemetry
by olavopitonjunior Aug 29, 2026 6/10
app GitHub

AppBacktest: Let Your Coding Agent Test an App the Way a Confused User Would

An open-source testing tool driven by your coding agent that behaves like a real user — walking both the happy path and the flows nobody designed for — to surface bugs and confusing interactions. It records every run for replay and reports quality-of-life suggestions without touching your codebase, so it stays read-only against the project under test. Works for websites and apps.

testinguxqabrowseragent-driven
by JASGENIUS Aug 28, 2026 7/10
app Reddit

tesla-grok-to-claude-code: Drive a Claude Code Session From Your Car

A small PHP bridge that turns a URL into a read-only Claude Code session, exploiting the fact that Tesla's built-in Grok assistant can open URLs. Speak to the car, Grok hits the endpoint, Claude Code answers, and the reply comes back through the voice assistant. A minimal pattern for reaching Claude Code from any voice assistant that can fetch a web page.

voicebridgephpheadlessremote-access
by davdatafox Aug 28, 2026 7/10
app Reddit

herdr-annotate: Annotate Agent Messages and Plans, Feed Them Back to Claude

A Herdr plugin (with an optional Plannotator TUI) for marking up agent output and project files in place — grill sessions, plans, specs — and returning the annotations to the agent as structured feedback. Opens as a popover or a pane and works with mouse or keybindings. Aimed at closing the review loop without copy-pasting critique back into the prompt.

herdrannotationfeedbacktuiplugin
by backnotprop Aug 28, 2026 7/10
app GitHub

ClockWall: A Portrait Wall Display of Your Running Claude Code Sessions

A 1080x1920 portrait dashboard built for a spare monitor: large clock, date, and a live list of Claude Code agent sessions currently running. Written in WinUI 3 on .NET 10, so it is Windows-only. For people running several unattended agents who want ambient visibility without alt-tabbing.

dashboardmonitoringwindowswinuisessions
by ClariSortAi Aug 28, 2026 6/10
app GitHub

repo-lines: Your Git Branches Drawn as a Transit Map

Renders repository state as a subway-style diagram of branches and pairs it with plain-English advice about what to do next. Explicitly built for people who arrived at git through AI coding tools and never learned the underlying model. A gentle way to see what an agent has done to your branch structure.

gitvisualizationbranchesbeginnertooling
by srcleaningapp Aug 28, 2026 6/10
app GitHub

harness-medic: Local Diagnostics for Agent Config, MCP Servers, Hooks and Context Bloat

Inspects Claude Code, Codex, OpenCode and Cursor installations and reports what is actually configured — MCP servers that fail to start, misfiring hooks, and how much of the context window your setup consumes before work begins. Runs entirely locally, sending nothing anywhere. Genuinely useful once you have accumulated enough plugins to lose track of them.

diagnosticsmcphookscontexttroubleshooting
by Nevern1y Aug 28, 2026 8/10
app GitHub

ClaudeFix: Repair the VirtioFS Mount Crash in Claude Desktop on Windows

A targeted fix for the "VirtioFS mount failed: bad address" crash that takes down Claude Desktop and Cowork VMs on Windows. It resolves the mount without a reboot, which is the part that matters when the crash hits mid-session. Narrow in scope but a real time-saver if you have run into it.

claude-desktopwindowscoworkbugfixvirtiofs
by JesperLive Aug 28, 2026 6/10
app GitHub

briareus: Run Claude Code, Codex and Grok Sessions in Parallel With Auto PR Review

A local dashboard that gives each concurrent agent session its own workspace clone and its own database, so parallel runs cannot corrupt each other's state — a step beyond worktree isolation for anything touching a datastore. Adds an automated PR review loop on top. For running several agents on one project at once.

dashboardparallelisolationcode-reviewmulti-agent
by nadinyamaui Aug 28, 2026 7/10
app GitHub

memory-claude: Vertiso's Official Memory Plugin for Claude Code

The vendor-published Claude Code plugin for Vertiso's memory service, giving sessions persistent recall across restarts. Being first-party, it should track the service's API more reliably than community wrappers. Only worth installing if you already use Vertiso.

memorypluginpersistencevertisocontext
by Vertiso Aug 28, 2026 5/10
app GitHub

claude-statusline (GoSlowPoke168): Model, Effort, Context and Quota in One Line

A Claude Code statusline that surfaces the current model, reasoning effort, context usage, cost, quota reset times and working directory. Useful if you switch models often and want to see effort and remaining quota without leaving the session.

statuslinecontextquotamonitoring
by GoSlowPoke168 Aug 28, 2026 7/10
app GitHub

cli-plugin-template: Shared Feature Catalog for Multi-CLI Agent Plugins

A living catalog of reusable plugin features that work across Claude Code, OpenCode and Gemini CLI. Ships automatic versioning, git hooks, cross-CLI compatibility checks and doc conventions; plugins pull features in and push improvements back. Spanish-language docs.

plugintemplatemulti-cliversioning
by WSmithDR Aug 28, 2026 5/10
app GitHub

trace-cli: Wrap Any Command and Hand the Crash to Your Coding Agent

Wraps a command so that when it crashes, the error is scrubbed of secrets and handed straight to your AI coding agent. The free tier is open; a paid tier adds git checkpointing, undo and restart-to-verify.

clidebuggingsecretserror-handling
by itsyu5668-sys Aug 28, 2026 7/10
app GitHub

GhostShell: Run Claude Code Natively in Sublime Text Tabs

A Sublime Text terminal built on real ConPTY with ANSI rendering via libghostty-vt, with no Terminus dependency. Tailored to running Claude Code, Codex and other agent CLIs inside ST tabs.

sublime-textterminalconptyeditor
by dpc00 Aug 28, 2026 6/10
app GitHub

please: An Agent Framework That Drives an Existing Harness

Instead of writing yet another agent loop, this framework runs an existing coding-agent harness — Claude Code, OpenCode or Pi — as its execution engine. Lets you build agent behavior on top of a harness you already trust.

frameworkharnessorchestration
by pleaseai Aug 28, 2026 6/10
app GitHub

codeatlas: Local-First Codebase Indexer With Graph Analytics and Cypher Queries

A high-performance local codebase indexer and query engine offering architectural graph analytics, natural-language Cypher queries and multi-repository context generation. Built so AI agents and developers can navigate large codebases without loading them wholesale.

indexinggraphcodebasequery
by shditz Aug 28, 2026 7/10
app GitHub

crema: Keep Your Mac Awake Only While Agents Are Actually Working

A visible caffeinate for agent-heavy Macs: shows per-session working-versus-waiting state for Claude Code, Codex, Gemini, Copilot and opencode, keeping the machine awake during work and letting it sleep when the agents are idle.

macossessionspoweramphetamine-alternative
by karanb192 Aug 28, 2026 6/10
app Reddit

CCC v5.26.0: Manual Sub-Session Attach for 30+ Parallel Agent Sessions

Claude Command Center, a dashboard for running many parallel Claude Code and Codex sessions, added a manual attach/detach action so related sessions with no real spawn lineage still render nested in the sidebar. Devin CLI sessions now show model, reasoning effort and subagent calls.

dashboardparallel-sessionsmonitoringdevin
by amirfish Aug 28, 2026 6/10
app GitHub

marvis: A Cross-Project Knowledge Graph Your Coding Agent Installs

Positions the coding agent as a project coordinator rather than just a code writer, backed by a cross-project knowledge graph and an immutable audit log. Self-hosted and EU-resident, BSL 1.1 converting to Apache 2.0.

knowledge-graphauditself-hostedcoordination
by emiliomartucci Aug 28, 2026 6/10
app GitHub

fable-autopilot: Run a Small Business With an Agent Across Sessions

A Claude Code plugin giving an agent the scaffolding to operate a business over many sessions: an OKF wiki, an OKR loop, a session gate, a decisions log and a ledger. Written by the agent for its own business, which makes it an unusual case study.

businessokrsessionsledger
by tidoemanuele Aug 28, 2026 6/10
app GitHub

keygate: Let Agents Use Your Secrets Without Ever Seeing Them

Injects secrets from Bitwarden into agent-run commands and scrubs them back out of output, so Claude Code, Codex or Cursor can use credentials without them entering the context window or transcripts. Addresses a real leak path in agentic workflows.

secretssecuritybitwardenscrubbing
by feelgom Aug 28, 2026 8/10
app GitHub

harness-arena: Blind Elo Rankings for Coding Harnesses, Not Models

An LMSYS-style arena that compares Claude Code, Codex CLI, OpenClaw, Hermes and OnDemand on the same task with the same model in isolated runs. Humans judge blind and results roll into an Elo leaderboard. FastAPI and MongoDB backend.

benchmarkeloharnesscomparison
by Ondemand-OSS Aug 28, 2026 7/10
app GitHub

libi: A Desktop Video Editor That Coding Agents Drive Over ACP

An AI video studio where a desktop editor connects to CLI coding agents such as Claude Code and Codex over ACP, letting them compose, edit and export video. An unusual use of the agent-client protocol outside code.

videoacpdesktopeditor
by Nagellabs Aug 28, 2026 6/10
app GitHub

mcp-dashboard: See What Each MCP Server Costs You in RAM and Context

A cost/benefit dashboard for your MCP toolbox across Claude Code, Codex, Gemini CLI and Cursor, showing RAM use, context tokens consumed and real usage per server — with working on/off switches. Directly targets context bloat from servers you never call.

mcpcontextdashboardtokens
by SarutobiSasuke8 Aug 28, 2026 7/10
app Reddit

Watching a Claude Code Turn Live Instead of Asking What It Did

Rather than trusting the agent report, this tool reads the session logs Claude Code already writes and draws the turn while it runs: the context window filling against the real model, each API call as it lands with latency and cost, and every subagent under the spawn that launched it with its own window and model.

observabilitysessionssubagentscost
by duqaxxx Aug 28, 2026 6/10
app GitHub

O-view: Token Usage and Limit Reset in the Notification Area

A notification-area app showing Claude token usage and time until the next limit reset. Supports Windows 11 and Linux as of v0.6.0, which is rarer than the many macOS-only equivalents.

windowslinuxquotamonitoring
by mlengmark Aug 28, 2026 6/10
app GitHub

sqlite-graph-memory: Graph RAG on SQLite With a Zero-Token Memory Ledger

Combines vector retrieval, a hand-curated wikilink graph and cross-encoder reranking on plain SQLite, with a per-turn memory ledger that costs no tokens. A working pilot rather than a finished product, but an interesting take on agent memory.

memoryragsqlitegraph
by tonydzi Aug 28, 2026 6/10
app GitHub

slack-claude-bridge: Run and Approve Claude Code From Slack

Start Claude Code tasks from Slack and approve every tool call from your phone. Turns supervision into something you can do away from the desk without giving up the permission prompt.

slackmobilesupervisionpermissions
by aaryann123 Aug 28, 2026 7/10
app Reddit

$11,711 of Claude Code in Three Months, and Half of It Was Bash

A transcript-pricing tool revealed that Bash calls were 51% of all tool calls — tests, builds and git status cost more than writing code. Cache hit rate was 99%, invisible on a flat plan, and one session silently repeated the same call five times in three minutes. The script became a dashboard with a looping-session banner.

costtranscriptsdashboardbash
by dspv Aug 28, 2026 7/10
app GitHub

transcripto: Index and Grade the Turns You Actually Typed

Indexes your coding-agent transcripts, discards everything except the turns you wrote yourself, and grades them. Local and stdlib-only — it never opens a socket. A way to improve your own prompting rather than the model.

transcriptspromptinglocalgrading
by Morkeeth Aug 28, 2026 6/10
app GitHub

claude-clan: Watch Agents Build Your Codebase as an Isometric City

Renders your codebase and GitHub pull requests as a live isometric city where AI agents visibly build and review software in real time. A genuinely novel take on agent observability.

visualizationobservabilitygithubisometric
by mittal-parth Aug 28, 2026 6/10
app GitHub

vat: Control Plane for Multi-Repo Agent Workspaces

vat records what happened across a set of repositories, the way git records history within one. It acts as a control plane for multi-repo workspaces and the coding agents operating in them. Useful if you run agents across several checkouts and lose track of what changed where.

multi-repoagentsworkspacegitorchestration
by takealook97 Aug 28, 2026 6/10
app GitHub

forge: Run Coding Agents as Headless Jobs Instead of Live Sessions

An operator cockpit for treating coding agents as background jobs rather than sessions you babysit. The loop is plan, run, review, ship — you queue work and come back to results. Aimed at people running multiple agent tasks who do not want to sit and watch each one.

headlessagentsjob-runnerautomationorchestration
by tcashel Aug 28, 2026 6/10
app GitHub

design-dna: Turn Reference UIs into Quantified Design Token JSON

Takes reference UIs — images, screenshots, or URLs — and extracts a structured "Design DNA" JSON covering tokens, qualitative style, and visual effects. That profile can then drive generation of matching UI for your own content. Aimed at getting agents to reproduce a visual language consistently instead of improvising.

design-tokensuifrontendstyle-transfer
by zanwei Aug 28, 2026 6/10
app GitHub

loadout-cli: Central Workspace for Agent Instructions and Memory

Launches AI coding agents with your instructions, memory, and usage tracking held in one central workspace rather than scattered per-repo. Nothing is left behind in the repositories you work on. Appeals to anyone tired of copying CLAUDE.md variants into every project.

climemoryusage-trackingworkspaceconfiguration
by ntatschner Aug 28, 2026 6/10
app GitHub

claude-rig: One Panel for Your Installed Claude Code Extensions

Detects which of a set of known Claude Code tools (rtk, jcodemunch, graphify, Headroom, superpowers) you have installed and wires them into a single panel. Adds programmatic tool routing, enforced skill chains, and a combined view of token savings. Useful if you have accumulated several overlapping extensions.

pluginstoolingroutingskillsdashboard
by franklywatson Aug 28, 2026 5/10
app GitHub

remote-agent-server: Self-Hosted Remote Execution for Coding Agents

A self-hosted server for running and managing AI coding agents remotely, supporting Codex, Claude Code, ACP, and MCP with isolated workspaces. Docs are bilingual (Chinese/English). Fits the case where you want agents running on a dedicated box rather than your laptop.

self-hostedremotesandboxmcpagents
by ma-pony Aug 28, 2026 6/10
app GitHub

jc: Run a Claude Code Orchestrator From a Single Window

A terminal orchestrator that drives multiple Claude Code sessions from one window instead of juggling separate panes. Aimed at people running parallel agent work who want a single place to watch and steer it.

orchestrationterminalmulti-agent
by jeapostrophe Aug 28, 2026 6/10
app GitHub

workstation-monitor: macOS Mission Control for AI Coding Sessions

A lightweight macOS dashboard that acts as a local development workbench and mission control for AI-assisted coding sessions. Aimed at people running several agent tasks at once who want a single status surface.

macosdashboardmonitoring
by army-u8 Aug 28, 2026 5/10
app GitHub

scriptorium (ravan): An Agent-Maintained Wiki That Also Writes For You

Ingests source material into a living wiki that an agent keeps up to date, then composes decks, papers, and posts from it in your own voice. Combines a knowledge base with a drafting pipeline rather than treating them as separate tools.

knowledge-basewritingwikiagent
by ravan Aug 28, 2026 6/10
app GitHub

amac: Phone-Accessible Control Plane for Every Coding Agent on Your Mac

Puts every AI coding session and automation on your Mac onto one page reachable from your phone over Tailscale. Includes a work queue with fencing that the author tested against SIGKILL, so jobs are not silently lost when a session dies.

control-planetailscalequeuemacos
by lgoyal6 Aug 28, 2026 7/10
app GitHub

codemap: Give an LLM Architectural Context Without Burning Tokens

Builds a compact "project brain" that describes a codebase's architecture so an agent can orient itself without reading half the repo first. Targets the common failure of blowing context on exploration before any real work starts.

contextarchitecturetoken-efficiencycodebase-map
by JordanCoin Aug 28, 2026 7/10
app GitHub

html2wp-cc-plugin: Turn a Static HTML Site Into a Real WordPress Block Theme

A Claude Code plugin that converts static HTML — from Lovable, Bolt, v0, Claude artifacts, or hand-written pages — into an editable WordPress block theme that matches the original pixel for pixel. No page builder dependency, with WooCommerce support for shops.

wordpressconversionpluginblock-theme
by iOSDevSK Aug 28, 2026 6/10
app GitHub

ryu (amajorai): Composable Integration Layer for Building and Running Agents

A framework for assembling AI agents from existing pieces instead of starting from scratch, extended through plugins and able to turn a finished agent into a standalone app. Aimed at the build-and-ship gap rather than at prompting.

frameworkagentspluginsintegration
by amajorai Aug 28, 2026 5/10
app GitHub

skillet (skilletmd): Publish a Skill Once, Run It in Every Agent Runtime

A registry and sync system for agent skills that pushes one published skill out to Claude Code, Codex, Cursor, Windsurf, and any MCP client. Removes the copy-paste-per-tool problem when the same skill needs to live in several runtimes.

registryskillssynccross-runtime
by skilletmd Aug 28, 2026 7/10
app GitHub

comad-world: Config-Driven Agent System Where One YAML Swaps the Domain

Six modules driven by a single YAML file — change the preset and you get a knowledge system for a different domain. Aimed at reusing one agent architecture across unrelated problem areas instead of rebuilding it each time.

config-drivenyamlagentsknowledge-system
by kinkos1234 Aug 28, 2026 5/10
app GitHub

clawd-light: Floating Traffic Lights for Every Claude Code Session

A macOS overlay that shows a small traffic light per running Claude Code session — green when working, amber when it needs you, red on failure. Includes a chat window so you can answer a prompt without switching to the session's terminal.

macosmonitoringparallel-sessionsui
by marmyx77 Aug 27, 2026 7/10
app GitHub

tidebreak: Local-First Desktop for Running Agents in Worktrees

An open-source desktop app that runs Claude Code, Codex CLI, opencode and Grok CLI side by side, each in its own isolated Git worktree so parallel runs never collide. Local-first, and covers document work alongside coding.

desktopworktreesmulti-agentparallel-sessionsopen-source
by brightwave-inc Aug 27, 2026 8/10
app GitHub

omnireach: Search the Login-Walled Chinese Internet From an Agent

A single CLI that lets an AI agent search and read WeChat public accounts, Xiaohongshu, Douyin and Bilibili alongside Twitter, Reddit, HN and YouTube, all returning one JSON schema. WeChat search works zero-config, and installation is done by telling your agent to install it.

searchclichinese-internetresearchwechat
by Daily-AC Aug 27, 2026 7/10
app GitHub

vibisual: Live Bubble Map of Your Claude Code Agents

Visualizes a running Claude Code session as a live bubble map of agents so you can see the shape of the work as it happens. Doubles as a canvas for designing your harness — lay out the agent topology visually rather than in config files.

visualizationobservabilitysubagentsharness
by Vibisual Aug 27, 2026 7/10
app GitHub

ccpace: Pace Your Claude Quota Across Accounts

Monitors usage across multiple Claude accounts against a countable 5-hour-window budget, forecasts what's left for the rest of the week, and pushes notifications before you run dry. For heavy users who keep hitting limits mid-task.

usage-limitsmonitoringquotanotifications
by thevibeworks Aug 27, 2026 7/10
app GitHub

laugh-tale: Agent-Native Toolkit for Map-First Travel Sites

A Claude Code and Codex plugin plus npm packages for building independent, map-first, mobile-first travel websites. The toolkit is designed to be driven by an agent rather than hand-wired, with core and React packages published separately.

travelmapsreactpluginweb-development
by XBlueSky Aug 27, 2026 5/10
app GitHub

ohmyharness (mindsers): Docker-Sandboxed Agents With Your Setup Baked In

Runs any coding agent inside a Docker sandbox that already contains your rules, skills and MCP servers, so a fresh container is immediately useful. Adds Git worktree isolation, editor attach over SSH, and a live code graph of the project.

dockersandboxworktreesmcpisolation
by mindsers Aug 27, 2026 7/10
app GitHub

sessionmail: A Local Mailbox So Two Agents Can Talk

Gives two AI coding agents a paired local mailbox to exchange messages when they have no other channel between them. Useful for coordinating agents running in separate terminals or repos without inventing a shared file protocol yourself.

multi-agentcoordinationmessaginglocal
by aicayzer Aug 27, 2026 7/10
app GitHub

SlackAgentBridge: Drive Local Claude Code Sessions From Slack

Controls local Claude Code and Codex CLI sessions from Slack using private channels, with terminals that survive and resume across disconnects. Lets you check on or redirect a long-running session from your phone without a VPN into your dev box.

slackremote-controlsessionstmux
by SergioTCG Aug 27, 2026 7/10
app GitHub

sandbox: Agents in Apple VMs With Egress They Can't Bypass

Runs coding agents inside Apple Virtualization framework VMs where network egress rules are enforced from outside the guest. Because enforcement lives on the host, the policy holds even against root with every capability inside the VM — a stronger guarantee than in-guest allowlists.

sandboxsecuritymacosvirtualizationnetwork-policy
by satishbabariya Aug 27, 2026 8/10
app GitHub

herd: Browser-Based Multiplexer for Claude Code and Codex Sessions

Runs and switches between many Claude Code, Codex, Gemini CLI and pi.dev sessions from a browser tab instead of a wall of terminals. Aimed at people whose agent count outgrew their tmux layout.

multiplexerparallel-sessionsbrowsermulti-agent
by poddubnyoleg Aug 27, 2026 7/10
app GitHub

vibegap: Flashcards in the Dead Time While Your Agent Runs

A mini-window that surfaces vocabulary flashcards and other panels automatically while your AI coding agent is working, filling the waiting gaps. An unusual take on the fact that agent sessions leave you idle in short unpredictable bursts.

productivityuiflashcardswaiting
by ktao732084-arch Aug 27, 2026 5/10
app GitHub

desktop-vision-rig: Give Your Assistant Eyes and a Memory of Your Screen

Records a rolling buffer of your desktop with OCR'd clips, watches project folders for real diffs, and logs agent tool traffic — all on one timeline the assistant can query. It enforces a whole-scene read before answering narrow questions, so it can't cherry-pick a frame out of context.

screen-captureocrcontextobservabilitytimeline
by dancockrell Aug 27, 2026 7/10
app GitHub

Armbian SDK Images With Claude Code Preconfigured in code-server

Daily VM images for x86 and arm64 hosts carrying a ready Armbian development environment in ISO and qcow2 form, including Docker, the Armbian build framework, and a browser-based code-server IDE with the Claude Code plugin already set up. Notable as an official distro shipping an agent in its dev image.

armbianvmcode-serverembeddedofficial
by armbian Aug 27, 2026 5/10
app GitHub

agentline (seongyooo): Terminal Observability for Claude Code

A terminal UI that shows what Claude Code is doing, in which files, and why — without opening a second editor to find out. Stays in the terminal rather than pulling you into a separate dashboard app.

observabilitytuimonitoringterminal
by seongyooo Aug 27, 2026 7/10
app GitHub

openloops: What Your Sessions Were Doing, After the Transcripts Are Gone

Summarizes what your Claude Code sessions were working on, and keeps answering after the underlying transcripts have been rotated away. Fills the gap where session history disappears exactly when you finally need to remember what you did.

sessionshistorytranscriptssummarization
by thorwhalen Aug 27, 2026 7/10
app GitHub

agent-sandbox: KVM MicroVM Runs on Your Own Server

Starts agent runs from a dashboard, from Cursor, Claude Code, Codex or VS Code, or from a script, executing each inside an isolated KVM microVM on hardware you control and streaming output back live. Cloud-sandbox ergonomics without handing your code to a third party.

sandboxmicrovmkvmself-hostedisolation
by HatriGt Aug 27, 2026 7/10
app GitHub

placecall: Real Outbound Phone Calls From an Agent

A REST API that places real outbound phone calls to book, confirm or reach any business, shipped with a Claude Code plugin and a Codex AGENTS.md. Gives an agent a way to complete tasks that only exist behind a phone number.

phoneapiautomationplugin
by voygr-tech Aug 27, 2026 6/10
app GitHub

rudy-os: An Office of AI Agents With Memory, Mail and a Boss

Wraps the CLI coding agents you already run on macOS into an office metaphor — each agent gets persistent memory and a mailbox, and a routing agent assigns incoming work. Coordination layer over existing tools rather than a replacement for them.

multi-agentorchestrationmemorymacosrouting
by nafdalex Aug 27, 2026 7/10
app GitHub

Zanmai: A Structured Vault Claude Code Files and Searches For You

Keeps notes, documents, research and images as plain files on your own machine while Claude files them, retrieves them, and assembles new documents out of them. Local-first, with no proprietary store between you and your data.

notesvaultlocal-firstdocumentsknowledge-base
by TomSchimana Aug 27, 2026 6/10
app GitHub

cswap-widget: Desktop Quota Tracking and Fast Account Switching

A desktop widget for claude-swap users that tracks quota and switches between Claude accounts quickly. Turkish-language interface, aimed at people juggling several subscriptions to avoid running dry.

usage-limitsaccount-switchingwidgetdesktop
by tahakdgn Aug 27, 2026 5/10
app GitHub

codestatus: Come Back Only When an Agent Is Done or Stuck

Watches several running coding agents and pulls you back only at the two moments that matter — completion, or when one needs a decision. Built for keeping your attention on your own work while agents run in the background.

monitoringnotificationsparallel-sessions
by henriquegpb Aug 27, 2026 6/10
app GitHub

vetto: Daemon-Less OS Sandbox for Coding Agents

An OS-level security boundary and sandbox for Codex, Claude Code, Cursor and Aider that runs without a background daemon. Fewer moving parts than daemon-based sandboxes, which matters when the sandbox itself is the thing you're trusting.

sandboxsecurityisolationdaemonless
by shleder Aug 27, 2026 7/10
app GitHub

Caravel: Local-First macOS Command Deck for Three Agent CLIs

A macOS control panel that manages Claude Code, Codex and OpenCode sessions from one local-first interface. Chinese-language project, distributed as releases rather than source.

macosmulti-agentsession-managementchinese
by yy36295238 Aug 27, 2026 6/10
app GitHub

panecrew: Terminal Grid With a Focus-Following File Explorer

A multi-project terminal grid where the file explorer follows whichever pane has focus, so context switches don't require re-navigating. Built with Tauri, React and xterm.js.

terminalmultiplexertaurifile-explorer
by silvio-l Aug 27, 2026 6/10
app GitHub

boxdawn: Measuring Wasted Tokens Across 16,864 Sessions

Open-source LLM observability focused on the waste axis — four deterministic detectors plus an LLM-as-judge produce a waste-rate metric, validated across three corpora and 16,864 sessions. Rare in that the metric comes with published verification rather than a claim.

observabilitytokenswastemetricsllm-judge
by boxdawn Aug 27, 2026 7/10
app GitHub

major-tom-open: Run Claude Code From Your Phone Over Tailscale

A self-hosted panel giving each project one persistent tmux session you can reach from your phone — resume conversations, toggle remote control, open a browser terminal, publish ports. Zero-dependency Node with a single-file UI, reached over Tailscale rather than a public endpoint.

mobileremote-accesstmuxtailscaleself-hosted
by mbelsawy Aug 27, 2026 7/10
app GitHub

maestro (ReinaMacCredy): Durable Work and Decision Records for Agents

Local-first coordination for mixed human and agent work, tracking durable work items, decisions, dispatches and evidence alongside prompt-first methods. Built with TypeScript and Bun.

coordinationlocal-firsttypescriptbundecision-records
by ReinaMacCredy Aug 27, 2026 6/10
app GitHub

k0-board: Sticky Notes That Drive Your Claude Code Sessions

A board of sticky notes where each note becomes work Claude Code picks up, making the queue visible instead of buried in chat history. A lightweight alternative to prompting each task by hand.

kanbantask-managementuisessions
by alessio-ragni Aug 27, 2026 6/10
app GitHub

NotchIA: Claude Code Status Inside the MacBook Notch

Turns the MacBook notch into an interactive cockpit with media, calendar, shelf, focus, clipboard and on-device Apple Intelligence — including live tracking of Claude Code and Codex sessions. Free DMG, macOS 15+.

macosnotchmonitoringwidget
by coaxel2 Aug 27, 2026 6/10
app GitHub

video2md: Any YouTube Video Into AI-Readable Markdown

Converts a YouTube video into a Markdown document capturing both audio and visuals via the Gemini API, so an agent can read a video the way it reads a doc. Useful for feeding conference talks and tutorials into a coding session.

youtubemarkdowntranscriptiongemini
by MetamoL Aug 27, 2026 5/10
app GitHub

vibepanel: tmux Keeps Agents Alive, the Browser Organizes Them

A web console for many parallel coding-agent sessions with a clean split of concerns — tmux owns process lifetime, the browser owns naming, ordering and state. Sessions survive a closed tab.

tmuxweb-consoleparallel-sessionsmulti-agent
by jiangmuran Aug 27, 2026 6/10
app GitHub

agentlab: One Captain for All Your Coding Agents

Direct work across every coding agent you run, follow each session live, and take over at any point. Single control surface for people running several agents at once.

multi-agentsession-managementmonitoring
by RiadMefti Aug 27, 2026 6/10
app GitHub

html-share: Present Claude Code's Generated Output Legibly

Collects what Claude Code generates and lays it out as a readable shareable page instead of scattered files. Japanese-language project aimed at the last-mile problem of showing your session's output to someone else.

htmlsharingpresentationjapanese
by minorun365 Aug 27, 2026 5/10
app GitHub

claude-code-ltm: Pluggable Long-Term Memory Over Session Transcripts

Builds a disposable index on top of the verbatim transcripts already in ~/.claude/projects and layers pluggable memory strategies over it, entirely locally. Because the index is disposable, you can change strategy without losing anything.

memorytranscriptslocallong-term-memorychinese
by PsychQuant Aug 27, 2026 7/10
app GitHub

AllSessions: Local Desktop Workspace for Claude Code, Codex, and Gemini Sessions

A local-first desktop app that indexes session transcripts from Claude Code, Codex CLI, and Gemini CLI in one place. You can browse, search, and manage past sessions rather than digging through JSONL files by hand. Handy for recovering context or auditing what an agent actually did.

sessionstranscriptsdesktoplocal-first
by yuluod Aug 27, 2026 7/10
app GitHub

zerg: Go Daemon Supervising Agent CLIs in Isolated Worktrees With a Vue Cockpit

A multi-agent coding orchestrator where a Go daemon supervises several agent CLIs, each in its own isolated git worktree, and routes work between them. A Vue 3 cockpit gives you a live view of what every agent is doing. Aimed at running parallel agents without them stepping on each other.

orchestrationworktreesmulti-agentgo
by kconfesor Aug 27, 2026 8/10
app GitHub

keel: Agent-Native Next.js Starter With a Spec-Driven Verify Gate

A Next.js monorepo starter designed to be built by agents rather than just edited by them, with a spec-driven build harness and a hard verify gate that work must pass. It adds a context layer intended for multi-agent development. Useful as a template if you want structure enforced before agent output lands.

nextjsstarterspec-drivenverification
by derekleavitt Aug 27, 2026 6/10
app GitHub

cc-picker: Multi-Provider Launcher Showing Each Terminal Account and Quota

A launcher for running several Claude Code terminals at once, each pointed at a different provider or model. The status bar shows which account a session is on and how much quota is left, so parallel sessions stop being a guessing game. Documentation is in Chinese.

launcherprovidersquotastatus-line
by 1e0zj Aug 27, 2026 6/10
app GitHub

rag-your-code: Local Explainable Code Retrieval Index With No Network Calls

A code retrieval index built for coding agents that runs entirely locally with no network access and no runtime dependencies, covering 15 languages. Results are explainable, so you can see why a chunk was retrieved instead of trusting an opaque embedding score. Useful for large repos where grep is too blunt and cloud RAG is not an option.

ragretrievallocal-firstsearch
by skymanbp Aug 27, 2026 7/10
app GitHub

cocoaskills: Skill Manager With Dependencies and a Security Audit Step

A package-manager-style tool for AI agent skills: reproducible per-project installs, declared skill dependencies, and a security audit step before anything lands. Adapters cover Claude Code, Codex CLI, Cursor, and Gemini. Addresses the growing problem of skills being copy-pasted around with no versioning or provenance.

skillspackage-managersecuritydependencies
by ivanopcode Aug 27, 2026 7/10
app GitHub

conductor-oss: Local-First Control Surface for Agents, Worktrees, and Previews

A local-first control surface that brings agent workspaces, git worktrees, terminals, diffs, and previews into one interface. It also supports paired-device access, so you can check on runs from another machine. Aimed at people juggling several concurrent agent sessions.

orchestrationworktreesdashboardlocal-first
by charannyk06 Aug 27, 2026 7/10
app GitHub

volery: One Wall Showing Which Agents Are Working, Asking, or Waiting

A dashboard for directing many Claude Code agents at once, showing at a glance who is actively working, who has a pending question, and who has been idle waiting on you. The waiting signal is the interesting part, since blocked agents are easy to lose track of. Aimed at running a studio of agents rather than one session.

dashboardmulti-agentmonitoringorchestration
by ShaitanLyss Aug 27, 2026 7/10
app GitHub

skillport: Symlink a Personal Skill Library Into Every Local Project

Keeps one personal library of agent skills and live-syncs it into every local project by symlink, so edits propagate instead of drifting across copies. Works with both Claude Code skills and AGENTS.md conventions. Simple answer to the copy-paste sprawl problem.

skillssymlinksynclibrary
by tiger-dreams Aug 27, 2026 6/10
app GitHub

ai-maestro: Orchestrator With Memory Search, Code Graph, and Agent Messaging

An orchestrator that manages Claude, Codex, or other agents from a single dashboard while adding shared capabilities: memory search, code graph queries, and agent-to-agent messaging. Agents can also be moved between computers and locations. The code graph and messaging pieces are what set it apart from simple session managers.

orchestrationmemorycode-graphdashboard
by 23blocks-OS Aug 27, 2026 7/10
app GitHub

prism-coder: Local Session Memory With On-Device Inference and Drift Detection

Persistent session memory for coding agents that runs local-first with on-device inference, associative recall, and drift detection to catch when an agent wanders off the established context. Supports Claude Code, Cursor, and Codex. The drift detection is the differentiator versus plain fact storage.

memorylocal-firstdrift-detectionrecall
by dcostenco Aug 27, 2026 7/10
app GitHub

warp-claude-resume: Per-Pane Session Resume for Claude Code in Warp

Restores each Warp pane to its own Claude Code conversation after a terminal restart, instead of dumping you into a single shared or blank session. Panes reattach to the conversation they were running before, which matters if you keep several parallel agent sessions open across projects. Small quality-of-life fix for a specific but common multi-pane workflow.

warpterminalsessionsresume
by supersistence Aug 27, 2026 6/10
app GitHub

omarchy-aikit: Run Claude Code Migration Skills From the Omarchy Desktop

Wires Claude Code's AI Migration Kit skills into the Omarchy desktop environment with a status bar widget and a cross-repo work queue. It also keeps a local GitHub mirror so menus render instantly instead of blocking on network calls. For Omarchy users running migration work across several repositories at once.

omarchydesktopmigrationlinux
by Atypical-Consulting Aug 27, 2026 5/10
app Reddit

getvect: Raster-to-Vector Conversion Claude Can Invoke Itself

An open-source raster-to-vector tool built because existing options were paid, overkill, or needed heavy tweaking for simple logo work. The interesting part is the CLI surface: Claude can vectorize its own generated images in-loop instead of handing PNGs back to you for manual conversion. Straightforward utility for anyone spinning up side projects that need a quick logo.

imagesvectorclidesign
by PointAbject7717 Aug 27, 2026 6/10
app GitHub

vibeporter: Migrate Chat History and Config Between Agent CLIs

A CLI that moves conversation histories and configuration files between different agent interfaces, so switching tools doesn't mean abandoning your context and settings. Handles the format differences between agent frontends rather than requiring a manual re-export. Useful if you rotate between Claude Code and other coding agents.

migrationcliconfigportability
by iamvxrn Aug 27, 2026 6/10
app Reddit

From Arcade Idea to a WPA-Spec Pool Simulation in Three Months

A build log covering three months of developing a browser 8-ball game into a full physics simulation with a hand-rolled engine and an SVG table drawn to official World Pool Association specifications. The writeup traces the failure modes along the way — balls sliding instead of rolling, unpocketable pockets — and where the fixes came from. Plans now extend to ranked matchmaking and a community platform.

showcasegamephysicssimulation
by Honigbart Aug 27, 2026 5/10
app GitHub

tokensaver-cli: Route Claude Code, Cursor and Codex Through One Control Plane

An open-source CLI that puts Claude Code, Cursor, and Codex traffic behind a shared control plane offering Zero Trust governance, MCP support, and usage routing. The pitch is central policy and visibility across multiple coding agents rather than per-tool configuration. Relevant mainly to teams that need governance over who runs what.

cligovernancemcprouting
by tokensaver-ai Aug 27, 2026 5/10
app GitHub

claude-session-publisher: Export a Session With a Fidelity Report

Turns a Claude Code session into a self-contained document in HTML, plain text, LaTeX, or PDF. The distinguishing feature is a fidelity report that proves nothing was silently dropped during export — a real risk when transcripts contain tool calls and attachments. Good fit for archiving sessions or turning them into shareable writeups.

sessionsexportpdfdocumentation
by fabiocampolim-design Aug 27, 2026 7/10
app GitHub

busybar-claude-status: Claude Code Status on a BUSY Bar LED Matrix

Pushes live Claude Code state to a BUSY Bar LED matrix — state ring animations, the active model and effort level, plus context and plan usage. Moves the status line off your screen and onto physical hardware, so you can tell at a glance whether a session is thinking or waiting. Niche by definition, but a tidy piece of hardware integration.

hardwarestatusmonitoringled
by Alpharius-003 Aug 27, 2026 6/10
app GitHub

claude-draw: A Persistent Sketch Canvas as Input for Claude Code

Adds hand-drawn input to Claude Code through a persistent canvas you can sketch and annotate on, either locally or from a tablet elsewhere on your network. Diagrams, layout ideas, and annotated screenshots reach the agent without a screenshot-and-paste round trip. The canvas persists, so drawings stay available across a session.

inputdrawingcanvasui
by ThePhilipWilson Aug 27, 2026 7/10
app GitHub

InspectAI: Send React Components From the Browser Straight to Your Agent

An AI-powered take on Inspect Element: visually pick a React component in the browser and ship it, with context, to your IDE's AI agent. Removes the step where you hunt down which file and component a rendered element came from. Practical for front-end work where the gap between what you see and where it lives is the slow part.

reactfrontendbrowserdevtools
by im-anishraj Aug 27, 2026 7/10
app GitHub

vibemeter: See What Your Agents Are Doing

An observability tool for agent sessions that surfaces what your agents are actually working on and how the collaboration is going over time. Aimed at the gap between launching agents and knowing whether the time they spent was useful. Worth a look if you run multiple agents and only find out afterwards where they went wrong.

observabilitymonitoringagentsanalytics
by RangeKing Aug 27, 2026 6/10
app GitHub

claude-code-account-switcher: Per-Directory Claude Code Account Switching

A Rust CLI plus shell integration that binds a Claude Code account to a directory, so the right account activates automatically when you cd into a project. Works on macOS, Linux and Windows. Useful if you juggle personal and work accounts and keep forgetting to switch before starting a session.

cliaccountsrustshellmulti-account
by Nemo-Illusionist Aug 26, 2026 7/10
app GitHub

claude-computer-use: Accessibility-Tree Desktop Control for Claude Code

Gives Claude Code Codex-style computer use by driving Windows and macOS apps through the OS accessibility tree instead of screenshots, which the author claims is about 20x cheaper in tokens. Because it reads structure rather than pixels, you can keep using the same desktop while the agent works. A practical option for GUI automation that does not need a dedicated VM.

computer-usedesktop-automationaccessibilitywindowsmacos
by ridelink0 Aug 26, 2026 8/10
app GitHub

claude-vitals: Statusline Showing Model and Context Window

A Claude Code statusline that surfaces the active model and remaining context window directly in your terminal prompt. Small quality-of-life tool for anyone who wants to see how close they are to compaction without checking manually. Documentation is in Spanish.

statuslinecontext-windowterminalmonitoring
by mrtacojr Aug 26, 2026 6/10
app GitHub

Better-UI-UX: Design System Generation for Coding Agents

Generates a design system that coding agents can then build against, so UI work stays visually consistent across sessions. Targets the common failure mode where an agent produces functional but stylistically incoherent interfaces. Relevant to anyone who has shipped a Claude Code app that works but looks assembled from unrelated parts.

design-systemuiuxfrontend
by Mert-byt Aug 26, 2026 6/10
app GitHub

claude-spill-scrub: Find and Scrub Credentials Leaked Into Claude Code Logs

Scans local Claude Code logs for credentials that leaked in through transcripts and command output, then scrubs them when you pass --yes. Scanning is the default so nothing is destroyed accidentally, and it emits a rotation manifest listing what needs to be rotated. Addresses a real and underappreciated exposure: secrets sitting in plaintext session history on disk.

securitycredentialssecretslogscleanup
by joshuafuller Aug 26, 2026 8/10
app GitHub

metabrain: SQLite Memory Layer That Promotes Patterns to Proven Preferences

A zero-dependency SQLite memory layer for AI agents with a built-in experiment loop: observed patterns are tested and graduate to proven preferences only once they demonstrably work. This is a step beyond memory files that just accumulate assertions nobody validates. Attractive if you want agent memory that self-corrects rather than calcifies.

memorysqliteagentslearningzero-dependency
by ariaxhan Aug 26, 2026 7/10
app GitHub

nullset: Local-First Data-Broker Erasure Requests Driven by Claude Code

Traces where your personal data is being sold, then generates erasure requests, AI-training objections and regulator complaints under GDPR, LGPD and CCPA. Runs local-first and is driven by Claude Code rather than a hosted service. A concrete example of pointing an agent at bureaucratic paperwork that is tedious rather than hard.

privacygdprccpalocal-firstautomation
by Bettercallcoutinho Aug 26, 2026 6/10
app GitHub

AiLibi: Social-Deduction Sim With LLM Agents, Built Contract-First

An Among Us style social-deduction simulation where LLM agents play the roles, deceiving and deducing against each other. The author built it by directing AI coding agents against written contracts rather than ad-hoc prompting, which makes the process as interesting as the game. Worth a look if you are experimenting with contract-driven agent development.

llm-agentssimulationgamecontractsmulti-agent
by dkdan10 Aug 26, 2026 5/10
app GitHub

swiftagent: Workspace-Scoped Task Control Room for Claude Code

A local control room for Claude Code tasks, scoped per workspace so runs from different projects stay separated. Gives you one place to see and manage what agents are doing instead of tracking scattered terminal sessions. Useful once you routinely run more than one Claude Code session at a time.

task-managementdashboardlocalworkspace
by OthmaneBlial Aug 26, 2026 6/10
app GitHub

claude-code-canary: Regression Testing and Version Bisecting for Claude Code

Runs deterministic scenarios to compare Claude Code releases, CLAUDE.md configurations, hooks and plugins, so you can bisect which change caused a behavior regression. Turns "it felt better last week" into something measurable. Genuinely novel: almost nobody is doing controlled A/B testing on their agent configuration.

testingregressionbisectbenchmarkingconfiguration
by SLP-DEV1 Aug 26, 2026 8/10
app GitHub

MobileController: Token-Efficient iOS Simulator Control for Agents

Controls the iOS Simulator from Claude Code with a focus on token efficiency, combining agent-device conventions, a simprobe CLI for pixel-level ground truth, and a load-aware benchmark. Lets an agent verify what actually rendered rather than assuming its code worked. Valuable for iOS developers running agent-driven UI work.

iossimulatormobiletestingtoken-efficiency
by NicolasBataille Aug 26, 2026 7/10
app Reddit

Codebay: Docker-Isolated Workspaces for Running Multiple Claude Code Agents

Codebay gives each agent task its own Docker container instead of a git worktree, so every task gets a real dev environment with databases and caches that cannot interfere with the others. It runs the actual Claude Code CLI rather than the Agent SDK, so it stays current with CC features, and a central admin panel previews each container's services. Open source, self-hostable, and can run on a remote server so tasks continue while your laptop is off.

dockerisolationparallel-agentsself-hostedopen-source
by khromov Aug 26, 2026 8/10
app GitHub

cc-token-meter: Local Claude Code Usage Tracking With Zero Telemetry

A local usage dashboard for Claude Code that reports token counts, estimated cost, cache efficiency, budgets, per-project breakdowns, and live sessions. Everything stays on your machine — no telemetry is sent anywhere. Useful if you want to see where your context and quota actually go without handing usage data to a third party.

tokensusagecost-trackingprivacydashboard
by Sabeekhann Aug 26, 2026 7/10
app GitHub

aisecscan: Static Security Scanner for Your .claude/ Directory

A Checkov-style static analyzer aimed at agent configuration rather than infrastructure. It scans settings, permissions, hooks, MCP server definitions, subagents, skills, slash commands, and CLAUDE.md for risky patterns. A practical way to audit a repo's .claude/ setup before trusting it, especially with third-party plugins and marketplaces.

securitystatic-analysispermissionshooksmcpaudit
by jassics Aug 26, 2026 8/10
app GitHub

ai-bwrap: Run Claude Code and Other Agents Inside a Bubblewrap Sandbox

A single wrapper that launches coding agents — Claude Code, opencode, Grok and others — inside a bubblewrap sandbox on Linux. The agent gets a confined filesystem and process view instead of your whole machine. Handy if you want to hand an agent broad autonomy without giving it broad access.

sandboxsecuritybubblewraplinuxisolation
by didvc Aug 26, 2026 7/10
app GitHub

claude-code-tree: Browse Claude Code Sessions as a Fork Tree in the Terminal

A terminal UI that renders your Claude Code session history as a tree, showing where sessions forked rather than as a flat list. Makes it much easier to find the branch of a conversation where things were still going well. Useful for anyone who rewinds and resumes sessions often.

tuisessionshistoryterminalnavigation
by rswrz Aug 26, 2026 7/10
app GitHub

agentsurface: Unified Launcher for Claude Code, Codex, and Pi Sessions

A single launcher and session surface for multiple coding agents, covering Claude Code, Codex, Pi, and managed backends. Rather than juggling separate terminals and conventions per tool, you get one place to start and return to sessions. Aimed at people who run more than one agent day to day.

launchersessionsmulti-agentcodextui
by possibilities Aug 26, 2026 6/10
app GitHub

lore: Persistent Agent Memory That Turns Sessions Into Obsidian Notes

Captures agent sessions as Obsidian notes so past work becomes searchable, linkable memory rather than buried JSONL. Recall is designed to be instant and feel native to the vault. Works across Claude Code, Cursor, Codex, Antigravity, and OpenCode, so memory is not locked to one tool.

memoryobsidiannotespersistencemulti-agent
by John-Daniels Aug 26, 2026 7/10
app GitHub

agent-mission: Live Goal Board That Checks Agent Claims Against Disk

Puts goals and subgoals on a single live board so the original objective survives a conversation that drifts. Subtasks are visible at a glance, and the agent's claims of completion are verified against what is actually on disk. Targets the failure mode where an agent reports done for work it did not finish.

goalstrackingverificationdashboardtask-management
by jlee844 Aug 26, 2026 6/10
app GitHub

hormuz: Open-Source AI Gateway for Policy, Routing, and Redaction

An open-source gateway sitting in front of Codex and Claude Code that applies policy, routes between models, redacts sensitive content, and records usage and cost evidence. Aimed at teams that need an auditable record of what agents sent and spent. Self-hosted rather than a managed proxy.

gatewaypolicyroutingredactioncostopen-source
by Xpounder-com Aug 26, 2026 6/10
app GitHub

claude-project-dashboard-macos: See Which Claude Code Projects Await You

A macOS-only single page that answers one question: which of your Claude Code projects is currently waiting on your input? Deliberately narrow rather than a general metrics dashboard. Handy when you run several sessions in parallel and lose track of which one has stalled on a prompt.

dashboardmacossessionsmonitoringparallel-agents
by Verohomie Aug 26, 2026 6/10
app GitHub

flowbrowse: Co-Browsing Browser That Never Hands the Agent Your Cookies

An open-source macOS and Linux browser that lets Claude Code, Codex, or any MCP agent act inside your already-logged-in accounts, without exposing cookies, passwords, or your profile to the agent. Access is off by default, granted per tab, killable instantly, and written to a hash-chained audit log. A far more careful design than handing an agent your whole browser profile.

browsermcpsecurityaudit-logautomationopen-source
by corleylun Aug 26, 2026 7/10
app Reddit

ReviewFlow: Record Screen and Voice, Get a review.md Claude Code Can Fix

A desktop app for the tedious half of frontend work with an agent: spotting ten small layout problems is easy, describing each one back to Claude is not. You hit record, walk through your app, and say what looks wrong; it captures screen, cursor, and voice, then matches each spoken comment to the right moment and screenshot. Output is a review.md plus screenshots you drag into Claude Code and tell it to fix.

frontenduifeedbackvoicescreenshotsdesktop-app
by Character_Total4468 Aug 26, 2026 7/10
app GitHub

llm-router: Free-First Fallback Routing Across Claude Code, Cursor, and Codex

A universal router that sits between your coding tool and model providers, trying free tiers first and falling back up a chain, with claimed cost cuts of 35 to 80 percent. Supports Claude Code, Cursor, Codex, Gemini CLI, and Copilot. Savings depend heavily on your workload mix, so verify against your own usage before relying on the numbers.

routercostfallbackmulti-modelgateway
by ypollak2 Aug 26, 2026 6/10
app GitHub

agentmailkit: Scheduled LLM-Written Email Digests From Your Own Machine

Runs scheduled digests locally that read your own files, have an LLM write them up, and send from your own inbox. The design is explicitly deterministic rather than autonomous — the schedule and the sources are fixed, and the model only writes. A good pattern for recurring reports without handing an agent open-ended email access.

emaildigestschedulingautomationlocal-first
by ariaxhan Aug 26, 2026 6/10
app GitHub

tscreen: Browse and Attach Claude Code Screen Sessions by What They Are About

A wrapper over GNU screen that lists Claude Code sessions by their actual subject, with previews, instead of by opaque session IDs. You can browse and attach from SSH or a phone. Solves the specific pain of reconnecting to the right long-running session on a remote box.

screensessionssshmobileterminal
by mdrobniu Aug 26, 2026 6/10
app Reddit

roundtable: A Scrubbable Player for Claude Code Session Recordings

Claude Code already writes every session to disk as JSONL under ~/.claude/projects/, one per session plus one per subagent. roundtable turns those into a timeline player you can scrub to any second to see which agent was running and what it had read or edited. MIT, runs entirely locally via npm start.

sessionsobservabilityjsonlplayer
by ClaudeCdGuy Aug 26, 2026 8/10
app Reddit

CCC v5.26.0: Manual Sub-Session Attach in Claude Command Center

Claude Command Center is a dashboard for running 30+ parallel Claude Code and Codex sessions. This release adds a manual "Attach as sub-session of..." row action so related sessions with no real spawn lineage still render nested, plus Devin CLI model/effort display in the board.

dashboardparallel-sessionsorchestration
by amirfish Aug 26, 2026 6/10
app Reddit

A Web Builder That Generates Your Claude Code Status Line Prompt

A browser tool for configuring a Claude Code status line visually. Rather than exporting a finished script it hands you the prompt to paste into Claude Code, which keeps the output adaptable to your setup. Built after the author's status line config drew interest as a comment.

status-lineconfigtooling
by AIeaIactaEst Aug 26, 2026 6/10
app Reddit

FALLMATCH: A Shipped Mobile Puzzle Where Every Level Has a Machine-Checked Proof

A designer who does not write code shipped a 300-level React Native/Expo puzzle game on iOS and Android with Claude Code writing all the code. The interesting half is the verification pipeline: a solver proves the minimum move count behind every 3-star target, and each "mechanic required" badge in the HUD is solver-verified.

react-nativeverificationshippedcase-study
by Gold-Adhesiveness574 Aug 26, 2026 6/10
app GitHub

openharness: Run Coding Agents in a Sandbox Instead of on Your Machine

A harness that puts coding agents inside a sandbox so their file and command access is bounded rather than pointed at your real working tree. Relevant if you run unattended sessions and would rather not trust every tool call.

sandboxsecurityharness
by mifunedev Aug 26, 2026 7/10
app GitHub

PRTruth: Check the Evidence When Your Agent Says It Is Done

A verification tool for the moment an agent declares a task complete — it looks for evidence in the change rather than taking the claim at face value. Fits into the PR stage of an agent-driven workflow.

verificationpull-requestsevidence
by eissasoubhi Aug 26, 2026 6/10
app GitHub

herdr-agent-quota: Time-Aware Quota Monitoring for Claude, Codex, and Grok

Live quota monitoring inside Herdr showing usage, reset times, and task context, with quota health calculated from remaining quota against your runway rather than raw percentage. Useful if you routinely burn through plan limits mid-task.

quotausagemonitoringherdr
by levi-qiao Aug 26, 2026 5/10
app GitHub

claude-provider-proxy: Point Claude Code at Any Model Backend

A local proxy that routes Claude Code to OpenCode Go/Zen, NVIDIA, or custom backends, selecting the provider by URL path. Supports per-provider profiles and fallback chains, so a failed backend hands off rather than killing the session.

proxyprovidersroutingfallback
by caseol Aug 26, 2026 7/10
app GitHub

ai-containers: A Firewalled Docker Workspace for CLI Coding Agents

A CLI-only Docker workspace running Claude Code, Copilot, Codex, Gemini, and Kiro as a non-root user behind a deny-by-default outbound firewall. Everything the agent reaches out to has to be allowed explicitly.

dockersandboxfirewallsecurity
by ihudak Aug 26, 2026 7/10
app GitHub

vibeview: A Claude Code Session Viewer

A viewer for Claude Code sessions, letting you read back what happened in a run rather than scrolling terminal scrollback. Small and focused.

sessionsviewerobservability
by driangle Aug 26, 2026 6/10
app GitHub

ccledger: Self-Hosted Team Usage Ledger for Claude Code

Ingests Claude Code OTLP telemetry into SQLite and serves a per-person dashboard, so a team can see usage without sending data to a third party. Independent project, not affiliated with Anthropic.

telemetryusageteamself-hosted
by shakibbinkabir Aug 26, 2026 7/10
app GitHub

relayagent: Agent Packages That Ship Their Own UI

A substrate where one manifest declares an agent, its verbs, and the screens it presents — so an agent package arrives with its interface rather than depending on a host to build one.

agentsuipackaging
by relayax Aug 26, 2026 5/10
app GitHub

alc: A Control Plane for Agentic Coding

Automated checks and quality gates wrapped around your agents, so work has to clear defined criteria rather than whatever the agent decides is done.

quality-gatescontrol-planeautomation
by gifflet Aug 26, 2026 6/10
app GitHub

clay: Self-Hosted Multiplayer Workspace for Claude Code and Codex

A browser-based team workspace where multiple people share Claude Code and Codex agents that carry memory between sessions. Self-hosted, so the conversation history and memory stay on your infrastructure.

teamself-hostedmultiplayermemory
by chadbyte Aug 26, 2026 7/10
app GitHub

blender-kiln: Text Brief to Production GLB via Blender MCP

A Claude Code plugin running a full 3D asset pipeline — Blender MCP, Hunyuan3D generation, texturing, and batch mode — from a written brief to a production-ready GLB.

3dblendermcpassets
by elithril Aug 26, 2026 6/10
app GitHub

biocli: An Agent Execution Layer for Biology Workflows

Batch gene scanning, tumor cohort briefing, and target discovery with structured outputs, resume support, and pipeline-ready artifacts. Resume matters here because these runs are long enough to fail midway.

bioinformaticsclipipelinesagents
by youngfly93 Aug 26, 2026 5/10
app GitHub

cclimit: Halt Claude Code Before Your Plan Usage Runs Out

Stops the session at a usage percentage you set and waits for you to decide, instead of letting a long run consume the rest of your quota unnoticed. Small, targeted, and useful on a metered plan.

usagequotalimitssafety
by epogonii Aug 26, 2026 7/10
app GitHub

SportChat: A Sports Analysis Web Chat Running on the Claude Code Engine

A web chat for analyzing sporting events built directly on Claude Code — MCP, skills, plugins, and slash commands — rather than a plain API wrapper. Russian-language. An example of Claude Code as an application runtime.

web-appmcpskillsrussian
by bychikola Aug 26, 2026 5/10
app GitHub

frizz: An Opinionated Agent Command Center That Runs on Localhost

A local command center for driving coding agents, built for throughput and deliberately opinionated about the workflow rather than configurable to death. From Colin McDonnell, author of Zod.

dashboardlocalhostorchestrationproductivity
by colinhacks Aug 26, 2026 7/10
app Reddit

dsh-claude-live: stream Claude Code's live steps into a DeepSeek Harness session

Bridges the gap where DSH can delegate to Claude Code but shows nothing until the child process returns. This keeps DSH as the driving agent and renders Claude Code's tool calls, file reads, and commentary as live sub-rows in the session UI. Works on the released rc.2 harness, unlike the existing background-agents approach that needs an unreleased core.

subagentsstreamingobservabilitydsh
by kaiomp Aug 26, 2026 6/10
app GitHub

devdeck: project command deck for Claude Code

A dashboard over all your Claude Code projects showing git state and staleness at a glance, with one-click `claude -c` resume for any of them. Solves the problem of forgetting which repo had an unfinished session. Lightweight alternative to keeping a dozen terminal tabs open.

dashboardgitsession-managementresume
by writingdeveloper Aug 26, 2026 6/10
app Reddit

mex: persistent agent memory that stays trustworthy after hundreds of commits

A structured Markdown wiki in `.mex/` holding architecture, conventions, decisions, patterns, and project state so agents stop relearning the codebase each session. The author's follow-up insight is that storing memory is the easy half — the hard part is staleness detection when files move, dependencies change, or two context files start contradicting each other. Adds validation for exactly that.

memorycontextstalenessdocumentation
by DJIRNMAN Aug 26, 2026 7/10
app GitHub

InflaTOKEN: native macOS menu bar watcher for Claude Code token usage

A tiny local-only menu bar app that shows your Claude Code token consumption inflating in real time. No network calls, no telemetry — it reads local session data. For people who want a constant ambient reading rather than opening a dashboard.

macosmenu-bartokensusagemonitoring
by o-ba Aug 26, 2026 6/10
app GitHub

daybook: daily work reports from Claude Code sessions and git history

Generates a daily summary of what you actually did by combining your Claude Code session transcripts with your git commits. Useful for standups, timesheets, or reconstructing a week you can no longer remember. Reads local data only.

reportinggitsessionsstandup
by humanikio Aug 26, 2026 6/10
app GitHub

ctxray: a flamegraph for your agent's context window

Renders where the tokens in an agent's context window actually went as a flamegraph — system prompt, tool definitions, file reads, tool results, conversation. The flamegraph framing makes the dominant consumers obvious at a glance instead of requiring a token-count spreadsheet. Direct diagnostic for context bloat.

contexttokensvisualizationprofiling
by Gabriel-Gerhardt Aug 26, 2026 7/10
app GitHub

claude-usage: where your Claude Code budget actually goes

Breaks down local session logs into context growth over time, cost per turn bucketed by context size, cache-write split, and machine-readable limit reset times. The cost-by-context-bucket view is the useful one — it shows how much you pay for letting context grow rather than just a total. No network, no dependencies.

usagetokenscostcacheanalytics
by vevdokimovm Aug 26, 2026 7/10
app GitHub

headless-vault-kit: agent-driven Obsidian vault automation with no app running

A headless toolkit that indexes an Obsidian vault into SQLite and exposes backlinks plus Dataview and Bases queries, so agents can work the vault on a 24/7 server without the desktop app. Turns a personal knowledge base into something an automated agent can query and update. Good fit for always-on note pipelines.

obsidiansqlitenotesheadlessautomation
by angelsaez Aug 26, 2026 6/10
app GitHub

letitloop: durability kernel with crash recovery and AST-level splicing

A deterministic durability layer for coding agents built from three pieces: 2ms write-ahead-log crash recovery, source-span AST node splicing instead of text patching, and proof verification gates before changes land. Aims to make long autonomous runs survivable rather than restarting from scratch after a crash. Ambitious and low-level.

durabilitywalastverificationcrash-recovery
by sdageltc Aug 26, 2026 6/10
app GitHub

cli-agent-runner: keep Claude Code and other agent CLIs running 24/7

A supervisor for long-running agent CLIs — Claude Code, aider, or anything taking a prompt argument — with 11 layers of failure defenses and structured observability so you can see why a run died. Targets unattended operation where a crash at 3am otherwise means eight lost hours. Agent-agnostic by design.

supervisorreliabilityobservabilityunattendedaider
by wan9yu Aug 26, 2026 6/10
app GitHub

sitrep: situation report across every git repo in a workspace

Scans all repos in a workspace for anything pending a decision — uncommitted changes, unpushed commits, stashes, parked feature branches — then cross-references project docs for planned roadmap items and renders it as a self-contained HTML infographic with branch graphs and dirty-tree meters. Answers 'what did I leave half-finished everywhere' in one artifact.

gitreportingworkspacehtmlvisualization
by 0n1-Studios Aug 26, 2026 6/10
app GitHub

storegga: map what your AI coding agents are storing on disk

Accounts for every byte in the Claude Code, Codex, and opencode data folders and attributes it back to the project that generated it. Read-only with zero setup. Useful when agent session data has quietly grown into tens of gigabytes and you need to know what is safe to delete.

disk-usagesessionscodexopencodecleanup
by pixle-codes Aug 26, 2026 6/10
app GitHub

openteams: plan, build, and ship with a team of AI agents

An orchestration layer that runs a coordinated team of agents through plan, build, and ship phases rather than driving a single agent through everything. Role separation is the organizing idea. Early-stage but a clear expression of the multi-agent-team pattern.

orchestrationmulti-agentplanningteams
by openteams-lab Aug 26, 2026 5/10
app GitHub

screencast-desktop: agent drives a Windows app and records a demo video

A Claude Code plugin where the agent operates a Windows application and captures the session as a demo video, zooming in before each click so the recording is actually watchable. Produces documentation-grade footage without a human doing takes. Neat use of computer control for artifact generation rather than testing.

pluginwindowsscreencastcomputer-usedemo
by JHamidun Aug 26, 2026 6/10
app GitHub

ccs (ken-ty): thin tmux wrapper to spawn, find, and fold Claude Code sessions

A minimal wrapper that manages multiple Claude Code sessions across tmux panes from a single hub, deliberately delegating listing and inter-session messaging to Claude Code's own built-ins rather than reimplementing them. The restraint is the design point — it adds only the tmux layer. Japanese documentation.

tmuxsessionsmulti-sessionclijapanese
by ken-ty Aug 26, 2026 5/10
app GitHub

code-review-cli: deep low-noise AI code review as CLI and GitHub Action

Wraps the AgentsKit code-review agent in both a local CLI and a GitHub Action, tuned for signal over volume — the stated goal is depth without the wall of nitpicks that makes automated review get ignored. Same agent runs in CI and on your machine. Worth comparing against the built-in review workflows.

code-reviewcigithub-actionscli
by AgentsKit-io Aug 26, 2026 6/10
app GitHub

Recuris: recursive experiential and working memory for long-horizon agents

A memory architecture that evolves both experiential memory (what has been learned across runs) and working memory (what matters now) recursively, aimed at harnesses running tasks far beyond a single context window. Research-flavored rather than a drop-in plugin. Relevant if you are designing your own long-horizon agent loop.

memorylong-horizonresearchharnessagents
by Gen-Verse Aug 26, 2026 6/10
app GitHub

omarchy-harness-dock: agent lifecycle and attention status in the Omarchy bar

Shows which of your Codex, Claude Code, OpenCode, and Pi sessions are running and, more usefully, which are waiting on you — surfaced directly in the Omarchy status bar. Attention status is the differentiator over plain process listing. For Omarchy and Hyprland users running several agents at once.

status-baromarchyhyprlandmulti-agentlinux
by Lucenx9 Aug 26, 2026 5/10
app GitHub

proxy: Route Claude Code Requests Across Multiple Upstream Providers

A proxy that sits in front of Claude Code and routes its requests to several upstream providers — OpenCode Go, OpenCode Zen, and AWS Bedrock. It handles model selection automatically and transforms between the providers' request/response formats. Useful if you want to spread load or fall back across backends without changing how you invoke Claude Code.

proxybedrockopencoderouting
by routatic Aug 25, 2026 6/10
app Reddit

Claude Code Agent Pets: Pixel Pets That Track Your Running Sessions

An open-source pixel-art pet that reflects the state of your Claude Code sessions — a lightweight ambient status indicator instead of a dashboard. The author released it to the community looking for contributions and ideas. A playful take on the growing category of session-monitoring tools.

monitoringstatusopen-sourcesessions
by well__wisher Aug 25, 2026 6/10
app GitHub

pets-driven: Desktop Pets Showing Claude Code and Codex Agent Status

A Windows desktop app built with Tauri that puts animated pets on your desktop tied to the live status of your Claude Code or Codex CLI agents. The pet reacts as work progresses and alerts you the moment a task finishes. Solves the "did it finish yet?" problem without keeping a terminal in view.

tauriwindowsnotificationsstatus
by young1the Aug 25, 2026 6/10
app GitHub

Apex: Run Claude Code, Codex, Gemini, and OpenCode in One Desktop Window

A desktop hub that hosts multiple AI coding CLIs — Claude Code, Codex, Gemini, OpenCode, and arbitrary commands — inside a single window. Instead of juggling terminal tabs per agent, you get one surface to launch and switch between them. Handy when comparing agents on the same task or running several in parallel.

desktopmulti-agentclihub
by sthbryan Aug 25, 2026 7/10
app GitHub

md-reader: Live Markdown Reader and Editor for AI-Generated Docs

A viewer and smart editor aimed specifically at the Markdown that Claude, ChatGPT, and Cursor produce — long plans, specs, and reports. It renders live as the file changes and provides editing affordances suited to agent output. Useful if you accumulate a lot of generated Markdown you actually need to read.

markdownviewereditordocs
by kumaradarsh1993 Aug 25, 2026 5/10
app GitHub

StackFerry: Desktop Provider Manager and Router for AI Coding Tools

A focused desktop app for managing which model provider your AI coding tools talk to, and routing requests between them. It centralizes provider credentials and switching rather than editing config per tool. Aimed at people running several coding agents against several backends.

providerroutingdesktopconfig
by Ninthless Aug 25, 2026 6/10
app Reddit

Promptly Dead: A Browser Game That Teaches Prompting Logic

A short browser game, built with Claude Code, designed to teach non-developers how to phrase instructions to AI agents without ambiguity. Each level puts the player in a situation where a sloppy prompt gets misinterpreted, making the failure mode concrete. Free to play with the source published on GitHub.

gamepromptingeducationopen-source
by R_Songbird Aug 25, 2026 6/10
app GitHub

ccContextRead: Real-Time Markdown Viewer for Claude Code Session Logs

Reads Claude Code session logs and renders them as live Markdown so you can follow a running session in readable form. It has zero external dependencies. Useful for watching long unattended sessions or reviewing what happened after the fact.

sessionslogsviewermarkdown
by VeruYuo Aug 25, 2026 6/10
app GitHub

AIIM: An AIM-Style Network Where AI Agents Chat With Each Other

A live instant-messenger network in which AI agents talk to and help each other while humans can only spectate — an intentional revival of the AOL Instant Messenger aesthetic, SmarterChild included. More of an experiment in agent-to-agent interaction than a productivity tool. Running publicly at aiim.broke2builtai.com.

multi-agentexperimentchat
by lordbasilaiassistant-sudo Aug 25, 2026 5/10
app GitHub

analysis-video: Turn Lecture Videos Into AI-Readable Context

An agent-first CLI that converts a lecture video into structured Markdown — one section per screen, each carrying the frames and the slice of transcript that belong to it. The output is designed to be fed to an agent as grounded context rather than read by a human. Fills a real gap for anyone whose source material is video.

videotranscriptcontextcli
by hwanyong Aug 25, 2026 6/10
app GitHub

pier: tmux Sidebar Dashboard for Claude Code Sessions

A tmux sidebar that lists your Claude Code sessions grouped by git worktree, shows live status for each, and lets you click to jump straight to one. Keeps orientation across many parallel sessions without leaving the terminal. Fits naturally into an existing tmux-based workflow.

tmuxsessionsdashboardworktree
by zkzofn Aug 25, 2026 6/10
app GitHub

Couplet: Local-First Code Intelligence and Context Engine

A local code intelligence and context engine for Codex and Claude Code, backed by an embedded SonnetDB. It indexes your repository so the agent retrieves relevant context instead of reading broadly. Everything stays on your machine.

contextindexinglocal-firstcode-intelligence
by IoTSharp Aug 25, 2026 6/10
app GitHub

bay: Open-Source Cloud Where the Coding Agent Picks the Infrastructure

An open-source cloud platform for agent-built applications: you do not choose a database, a region, or a RAM slider — your coding agent and Bay decide together, then keep the app running and scaling. Aimed at closing the gap between "the agent wrote it" and "it is live." MIT-spirited infrastructure for agent-first development.

clouddeploymentinfrastructureopen-source
by thebaycloud Aug 25, 2026 6/10
app GitHub

BetterClaude: A BetterDiscord-Style Enhancement Suite for the Claude App

Layers themes, plugins, and productivity tools on top of the Claude desktop app without modifying Anthropic's code or touching your login. The BetterDiscord model applied to Claude — client-side augmentation with a plugin ecosystem. Appeals to anyone who wants the app customized but does not want to fork it.

desktoppluginsthemescustomization
by ara-mkr Aug 25, 2026 7/10
app GitHub

conforme: Sync Rules, Skills, Agents, and MCP Servers Across AI Tools

Keeps your AI coding configuration consistent across Claude Code, Cursor, and other tools — rules, skills, agents, and MCP server definitions in one source of truth. Removes the drift that builds up when the same setup is maintained per tool. Straightforward and broadly applicable.

configsynccross-toolmcp
by maxgfr Aug 25, 2026 6/10
app Reddit

ClodeBot: A Bot Inside Claude Code That Narrates What It Is Doing

Translates Claude Code's activity into plain status: how long a background process has actually been running, and an alert when something fails instead of silently stalling. It lives inside the session rather than watching from outside. Aimed at the visibility gap during long background work.

monitoringnotificationssessions
by jerupjerup Aug 25, 2026 6/10
app GitHub

agent-link: Run Multiple Claude Code and Codex Accounts Side by Side

Lets you run several Claude Code and Codex accounts at once — in parallel, hot-switched, or auto-routed — with one slot per account and no copying of credentials between sessions. Supports macOS and Linux. Useful when you legitimately hold separate personal and work accounts.

accountsroutingmulti-session
by itsjustanks Aug 25, 2026 6/10
app Reddit

A Notes Plugin for Leaving Comments Anchored to an Agent Turn

Built for the moment Claude finishes a task and mentions three other things it noticed while you are already halfway into the diff. The plugin lets you drop a note anchored to that exact turn without leaving the session, so the observation is not lost. Implemented as a plugin for an agent IDE.

pluginnotessessionsworkflow
by pablooliva Aug 25, 2026 5/10
app GitHub

claude-usage-autopilot: Pace Your Weekly Limits and Auto-Switch to Eco Mode

Tracks Claude Code usage against your weekly limits and paces you automatically, switching to an eco mode when you are burning through quota too fast. Rather than just reporting usage, it acts on it. Aimed at the recurring problem of hitting the weekly wall mid-project.

usagelimitsautomationquota
by sshykvlv Aug 25, 2026 6/10
app GitHub

cloudcli-kit: Opinionated Customisations for the Claude Code Web UI

A set of customisations for CloudCLI, the Claude Code web UI, plus a launcher that re-applies them to the installed package on every start so upgrades do not wipe them. Adds a LiteLLM spend tab. The re-apply-on-launch trick is a practical answer to patching a package you do not control.

web-uicustomizationlitellmspend
by liran-funaro Aug 25, 2026 5/10
app GitHub

agent-session-bridge: Portable Session History Across Coding Agents

A provider-neutral reference implementation for moving coding-agent session history between tools, with a working Claude Code importer and an RFC for Antigravity integration. Treats session history as a portable format rather than a per-vendor lock-in. Worth watching if you switch harnesses and lose your history each time.

sessionsportabilityhistoryinterop
by atomicdjt Aug 25, 2026 6/10
app GitHub

claudebar: Waybar Widget for Claude Code Usage Limits

A Waybar widget showing Claude Code session, weekly, per-model, and extra-usage spending with progress bars, countdowns, and pacing hints. Handles OAuth refresh itself and supports Omarchy theming. Pure Bash with an AUR package, so no runtime to install.

waybarusagelimitslinuxbash
by mryll Aug 25, 2026 6/10
app GitHub

career-wiki: An AI-Maintained Knowledge Base for Running a Job Search

Interviews you about what you actually do, builds a knowledge base from it, scores roles against your own stated values, and writes a bespoke CV for each application. The interview step is what makes the generated material specific rather than generic. A well-scoped example of an agent owning a long-running personal process.

job-searchknowledge-basecvpersonal
by sachajackson Aug 25, 2026 6/10
app GitHub

power-agents: Centrally Define and Sync Your Coding Agent Configurations

Maintains one central definition of your coding agent configurations, skills, and instructions and syncs it out to the tools that need it. Removes per-machine and per-tool drift in your setup. Sits in the same space as other config-sync tools but with its own approach.

configsyncskillsinstructions
by chrysogonus Aug 25, 2026 5/10
app Reddit

A CLI Client for Ultima Online, Handed to Claude to Play

The author wrote a command-line client for Ultima Online and gave Claude open-ended prompts like "explore this world" and "make friends and sing them songs." Failures — such as not working out how to get resurrected by a healer — were fixed by writing better skill instructions rather than more code. A genuinely interesting demonstration of skills as in-world procedural knowledge.

gamecliskillsexperiment
by autorokk Aug 25, 2026 6/10
app GitHub

hermes-usage-dashboard: Universal AI Usage Tracker That Extends Itself

Tracks token usage and quota windows across every local AI CLI and IDE tool from within the Hermes desktop app. It self-extends through provider adapters, so covering a new tool means adding an adapter rather than patching the core. Useful if your usage is spread across more than one vendor.

usagedashboardtokensmulti-provider
by PowerfulAnts Aug 25, 2026 5/10
app GitHub

claude-annotate: Comment on Any Block of Claude's Answer and Have It Rewritten

Renders Claude's long answers in a browser where you can comment on any individual block, and Claude rewrites just that block in place. Avoids the usual cycle of quoting a paragraph back and asking for a revision. A better interaction model for iterating on long generated documents.

annotationbrowsereditingreview
by petmakris Aug 25, 2026 6/10
app GitHub

dietclaudecli: A Diet Coke Can That Drains as You Burn Through Limits

A Claude Code statusline plus a live animated can in the terminal and a floating macOS overlay, where the Diet Coke level falls as you consume your usage limits. An unofficial CLI port of the Diet Claude browser extension. Pure whimsy, but a surprisingly legible way to feel quota depletion.

statuslineusagemacosfun
by RO-29 Aug 25, 2026 6/10
app GitHub

patcher-browser: The Browser That Writes Its Own Extensions

A browser that generates its own extensions on demand instead of requiring you to find or build one. The premise is that a missing browser capability should be a prompt away rather than a project. Early and unusual, but a genuinely different take on agent-driven tooling.

browserextensionscodegen
by laruss Aug 25, 2026 5/10
app GitHub

foreman: A Supervisor for Your AI Agent Sessions

Adds a supervisory layer over agent sessions that would otherwise run unwatched. It monitors what sessions are doing and intervenes rather than only reporting after the fact. Part of the emerging pattern of treating long agent runs as processes that need oversight.

supervisionsessionsmonitoring
by vikgmdev Aug 25, 2026 5/10
app GitHub

agentline: Zero-Dependency Claude Code Statusline With System Health

A statusline showing cost, context percentage, rate limits, git branch, active MCP servers, and system health, with no dependencies to install. Combines the usual usage metrics with MCP and machine state in one line. Easy to adopt precisely because there is nothing to set up.

statuslinecontextmcpmonitoring
by OFCode-dev Aug 25, 2026 6/10
app GitHub

atlas: Source Control for Agents Across Multiple Coding Tools

Tracks what each of your coding agents changed and lets you query it all from one place, functioning as a version-control layer scoped to agent activity rather than commits. Useful when several agents touch the same repository and attribution gets murky. Answers "which agent did this, and when."

version-controlmulti-agenttrackingaudit
by pacifio Aug 25, 2026 6/10
app GitHub

xats-setup: One Command to Join a Cross-Agent Bus on Any OS

Stands up a xats cross-agent-bus peer — daemon, service registration, Claude Code and opencode hooks, and the bridge — with a single command on Windows, macOS, or Linux. Removes the multi-step setup that usually blocks people from trying agent-bus architectures. Installation tooling rather than the bus itself.

setupcross-agenthooksinstaller
by Abdk4Moura Aug 25, 2026 5/10
app GitHub

voiceterm: Rust Terminal Overlay With Local Whisper for Codex and Claude Code

A low-latency terminal overlay written in Rust that adds local Whisper speech-to-text over a PTY passthrough, with wake words, macros, memory tools, and a customizable HUD. Transcription runs locally, so nothing is shipped to a speech API. One of the more serious attempts at voice-driven agent coding.

voicewhisperrustterminallocal
by jguida941 Aug 25, 2026 7/10
app GitHub

cross-ai-memory: One Notebook All Your AIs Read, Written Only With Your Approval

A shared memory file that every AI tool you use can read, where models may only propose entries and nothing is written until you approve it. The proposal-plus-approval gate is the whole design — it prevents memory from filling with things the model merely assumed. Chinese-language project with a broadly applicable idea.

memorycross-agentapprovalchinese
by hc-ui Aug 25, 2026 6/10
app Reddit

Claude Code Sessions Viewer: All Your Sessions in One List

An open-source viewer that gathers Claude Code sessions scattered across projects and directories into a single browsable list. Built out of the recurring annoyance of hunting for an old session by directory. Published for others to use and contribute to.

sessionsvieweropen-sourcehistory
by henrymaxm Aug 25, 2026 6/10
app GitHub

tokenbroke: A Public Leaderboard for the Most Rate-Limited Users Alive

A leaderboard ranking AI coding tool users by how thoroughly they have exhausted their rate limits, joinable with a single npx command. Pure community fun rather than a productivity tool. Also a light window into how much other people are actually consuming.

usageleaderboardfunnpx
by SnehanChakravarthi Aug 25, 2026 5/10
app GitHub

dsh-assembly.resume: Import Local Codex and Claude Sessions Into DeepSeek Harness

Imports your existing local Codex and Claude session history into the DeepSeek Harness so a switch does not start from an empty slate. Practical migration tooling for anyone moving between harnesses. Narrow in scope but does the one thing that makes switching tolerable.

sessionsimportmigrationdeepseek
by kanchengw Aug 25, 2026 5/10
app GitHub

phase console: Secrets Management for Teams and AI Agents

An open-source secrets manager that treats AI agents as first-class consumers alongside human team members. Agents get scoped access to credentials without secrets landing in a repo or a prompt. Increasingly necessary as agents run more real infrastructure work.

secretssecurityteamsopen-source
by phasehq Aug 25, 2026 6/10
app GitHub

vac: Vacuum Up the Cruft Left Behind by Agent Sessions

Cleans out the accumulated debris from Kiro CLI and Claude Code sessions — stale artifacts, abandoned scratch files, and leftover session state. Reclaims disk and reduces the noise an agent has to read past next time. Small maintenance utility for heavy session users.

cleanupsessionsdiskmaintenance
by homeo26 Aug 25, 2026 5/10
app GitHub

job-search-copilot: An AI-Run Job Search as a Claude Code Plugin

A plugin marketplace entry that runs a job search end to end: application tracking, job board and career-page scans, Gmail reply tracking, LinkedIn matching, and interview prep. The Gmail integration means it notices replies instead of relying on you to log them. Genuinely long-running personal automation rather than a one-shot tool.

pluginjob-searchautomationgmail
by CervantesVive Aug 25, 2026 6/10
app GitHub

very-happy: Orchestrate Coding Agents and Terminals From One Web Panel

A web command panel for driving coding agents and real terminal workflows from anywhere, so you are not tied to the machine running them. Combines agent orchestration with genuine terminal access in one surface. Useful for kicking off or checking on work from a phone or another computer.

web-uiorchestrationterminalremote
by Mereithhh Aug 25, 2026 5/10
app GitHub

instructree: Map and Lint AGENTS.md, CLAUDE.md, and Skill Instructions

Builds a map of all your agent instruction files — AGENTS.md, CLAUDE.md, Copilot instructions, agent skills, and their imports — and lints them, with zero dependencies. Surfaces contradictions and dead imports across files that individually look fine. Increasingly necessary once instructions are layered at multiple directory levels.

lintingclaude-mdagents-mdinstructions
by kotobuki09 Aug 25, 2026 7/10
app GitHub

koment: Out-of-Band Code Annotations for Agents and Humans

Stores the "why" behind code alongside it without putting it in the file, so both agents and people can read the reasoning without the source accumulating comment cruft. Annotations live out of band and travel with the repository. A neat answer to context that matters but does not belong in the code.

annotationscontextdocumentation
by koment-dev Aug 25, 2026 6/10
app GitHub

claude-code-zanii: An Open Build With Every Tool Call Signed and Auditable

An open build of Claude Code that cryptographically signs every tool call and records it on a transparency log, giving verifiable proof of what the agent actually did. Runs on both Bun and Node.js. Relevant wherever an agent's actions have to be provable after the fact rather than merely logged.

audittransparencysecurityopen-source
by vigilancetrent Aug 25, 2026 7/10
app GitHub

scanr: An Offline X-Ray for TypeScript Agent Codebases

Inventories a TypeScript codebase and reports references, duplicated code, and agent-generated slop, entirely offline with no API calls. Aimed at codebases that have grown quickly under agent authorship and accumulated redundancy. Fast to run because nothing leaves your machine.

typescriptanalysisduplicationoffline
by nikuscs Aug 25, 2026 6/10
app GitHub

turbotokens: Real-Time Token Telemetry for Claude Code and 15+ Agents

A single Rust binary that reads local agent logs and reports token usage in real time, with a live dashboard and budget alerts. Claims roughly 50x faster report generation than comparable tools and covers Claude Code, Codex, and more than fifteen other agents. Useful if you juggle several coding agents and want one place to watch spend.

tokenstelemetrydashboardrustmonitoring
by maxmoneycash Aug 25, 2026 7/10
app GitHub

meditate: Evidence-Graded Memory and Attention Analytics for Claude

A local-only companion that gives Claude persistent memory with evidence grading and drift detection, plus per-project attention analytics on a localhost dashboard. It also dispatches an agent fleet you can watch and includes Casper, a desktop companion that answers out loud with on-device speech recognition. Everything runs on your machine and voice data never leaves it.

memoryanalyticsdashboardlocal-firstvoice
by prashantpandey-creator Aug 25, 2026 7/10
app GitHub

agent-knock-knock: Drive Claude Code and Codex From OpenClaw Over tmux

Bridges OpenClaw to locally running Codex and Claude Code sessions through shared tmux terminals. Because the terminal is shared rather than owned, you can take over a session by hand mid-run and hand it back to the agent. Aimed at people who want remote control of local agents without giving up direct access.

tmuxremote-controlorchestrationcodex
by scotthuang Aug 25, 2026 6/10
app GitHub

pairdown: Multiplayer Markdown Rooms You Share With Agents

Collaborative markdown documents that both people and agents can edit in the same room, structured so agents can read and write without stepping on human edits. Turns a shared doc into the coordination surface instead of a chat log. Fits planning, spec drafting, and any work where several agents and a human need one live artifact.

collaborationmarkdownmulti-agentrealtime
by rohanrichards Aug 25, 2026 6/10
app GitHub

pub-project-auditor: Audit a Whole Directory of Git Repos via Claude Code CLI

Points the Claude Code CLI at a folder of local Git repositories and produces an audit across all of them. Useful for taking stock of a machine full of side projects — what is stale, what is undocumented, what needs attention. Runs entirely locally against your existing checkouts.

auditcligitbatchcode-quality
by oh-namgyu Aug 25, 2026 6/10
app GitHub

claudetick: Wear OS Notifications When Claude Code Finishes a Task

Sends a buzz to your Wear OS watch the moment a Claude Code task completes, with no companion phone app required. Fills the gap left by the many macOS and Windows desktop notifiers for people who step away from the desk. Small, single-purpose tool.

notificationswear-osandroidmonitoring
by AndyCavedal Aug 25, 2026 6/10
app GitHub

neoxider-benchmark: Agentic CLI benchmark that also scores making things up

A benchmark suite for agentic CLI models covering instruction-following, algorithms, browser work, spatial reasoning and exact arithmetic. Its distinguishing axis is resistance to fabrication, which most coding benchmarks do not measure. Useful if you are picking between CLI agents on evidence rather than vibes.

benchmarkevaluationcli-agentshallucination
by NeoXider Aug 25, 2026 6/10
app GitHub

claude-code-spend: What your sessions cost, and how much is re-reading

Analyzes Claude Code session logs to report cost, then breaks out how much of the bill came from the agent re-reading files it had already read. The re-read split is the interesting part — it turns a vague sense of context waste into a number you can act on by restructuring prompts or CLAUDE.md.

costtokensanalysiscontext
by alexandersnakes Aug 25, 2026 7/10
app GitHub

agent-lore: Learn repo conventions from human corrections of AI code

Watches the edits you make to AI-written code and distills them into repo-specific coding conventions the agent then follows. Harness-agnostic across Claude Code, Codex and Cursor, with zero dependencies. The premise is that your corrections are a better convention source than a hand-written style doc.

conventionsmemorylearningcross-agent
by a1473838623 Aug 25, 2026 6/10
app Reddit

Stremio-like all-media desktop app built with custom Claude Code skills

A single app covering manga, comics, books, audiobooks, TV, movies and anime plus a Kodi-style local library, built as a desktop-environment shell with a taskbar. The author built it using custom Claude Code skills remixed from Superpowers for brainstorming, planning and execution, including animated QML wallpapers.

showcasemediaskillsqml
by KingOfTheSeasLuffy Aug 25, 2026 6/10
app Reddit

A cross-tool memory layer that syncs context, diffs and commits between CLIs

A memory tool that started as a fix for copy-pasting context between sessions and grew to cover Claude Code, OpenCode, Gemini CLI, Codex, Antigravity and Cursor behind an MCP layer. Beyond chat it carries changed files, diffs and commits, and syncs across devices so asking Codex what Claude did last week works.

memorycontextmcpcross-tool
by notinteresteddddd Aug 25, 2026 5/10
app GitHub

claude-dispatcher: Terminal cockpit for a fleet of Claude Code sessions

Runs many Claude Code sessions across many repos and puts them on one screen: dispatch work, watch what ships and act on what is blocked. Aimed at the point where parallel agent sessions outgrow tab-switching between terminals.

orchestrationtuimulti-sessionfleet
by Innovology Aug 25, 2026 7/10
app GitHub

claude-marketplace: 14 plugins for development, PM and automation

A Claude Code plugin marketplace bundling 14 plugins across development, project management and automation, installable with one command. A convenience entry point if you would rather adopt a curated set than assemble plugins individually.

marketplacepluginsinstallautomation
by SkyWalker2506 Aug 25, 2026 5/10
app GitHub

SkillSpector: NVIDIA's security scanner for agent skills and MCP servers

An NVIDIA-published scanner that inspects Claude Code, Codex and MCP skills before you install them, flagging vulnerabilities, malicious patterns, prompt injection, data exfiltration and supply-chain risk. The most credible answer yet to the problem that installing a skill means running someone else's instructions.

securityscannerprompt-injectionsupply-chain
by NVIDIA Aug 25, 2026 9/10
app GitHub

Podiom: Thin orchestration layer for local LLM agents

An orchestration layer for locally-run LLM agents offering durable sessions, profiles, scheduling and native MCP, tool and skill integration. Deliberately thin — it coordinates agents rather than trying to be a framework.

orchestrationlocal-llmmcpscheduling
by Podiom Aug 25, 2026 5/10
app GitHub

agent-ops-operator: Kubernetes operator giving each agent its own pod

A Kubernetes operator where alerts, schedules, cluster events and chat messages each start a Conversation running in an isolated agent pod that replies in a thread you can respond to. Self-hosted, and what an agent may touch is defined by the wiring rather than by the agent's own judgment.

kubernetesoperatorisolationops
by kostiantyn-matsebora Aug 25, 2026 7/10
app Reddit

Five weeks, 860 commits: what Claude Code could not do on a poker site

A retrospective on building a full poker training site — rules engine, cash games, 10,000-entrant tournaments resolving in six seconds, three bot tiers, ~2,300 tests — where Claude wrote all the code. The valuable half is the explicit account of what the AI could not supply, starting with knowing what a poker player actually looks like.

retrospectiveshowcasetestinglessons
by dinobravo16 Aug 25, 2026 7/10
app Reddit

Week 5 of vibecoding an MMO: fixing onboarding, player acquisition

The fifth weekly devlog of an MMO built largely with AI coding agents, covering player acquisition, gameplay updates and lessons about vibe coding. This week's change came from player feedback that the intro was a wall of text with no context, so the onboarding was rebuilt.

devloggamedevmmovibe-coding
by Electrical-Pig Aug 25, 2026 5/10
app GitHub

punchcard: Architecture review where every blocker is demonstrated

Runs architecture-level code review across Claude Code, Codex, Cursor, Gemini CLI and 100+ other agents, returning a single verdict where each blocker is proven by actually running the code. The run-it-to-prove-it rule is what separates this from a model asserting a design smell.

code-reviewarchitectureverificationcross-agent
by Maksim-Burtsev Aug 25, 2026 7/10
app GitHub

ai-jury: Multi-provider PR review jury that debates to one verdict

A stdlib-only Python CLI that convenes Claude Code, Codex, Antigravity, OpenRouter, DeepSeek, Groq, local models and Aider as a jury on a pull request — they debate, verify, and synthesize a single verdict. Local-first and secure by default, with no dependencies to vet.

code-reviewmulti-agentpull-requestcli
by berkayturanci Aug 25, 2026 7/10
app GitHub

actualis: Turn existing agent logs into answers about exposure and cost

Reads the logs your coding agents already write and answers what actually ran: what was touched, what activity occurred and what it cost. Local, read-only and dependency-free, so it can be pointed at existing history without instrumenting anything first.

logsauditcostobservability
by digital-foundry Aug 25, 2026 6/10
app GitHub

agentic-product-demo: Demo videos where the UI is code, not a recording

Builds polished product demo videos with AI coding agents and Remotion, rendering the UI as code instead of capturing a screen recording. That makes the demo re-renderable when the product changes, and lets an agent update it like any other source file.

videoremotiondemomarketing
by Alexwtlf Aug 25, 2026 7/10
app GitHub

hermes-claude-sdk: Let Hermes Agent orchestrate Claude Code on macOS

A bridge that lets the Hermes Agent drive Claude Code on your Mac through the native Claude Agent SDK, so Claude Code sessions become steps in a larger Hermes-managed workflow rather than something you start by hand.

orchestrationagent-sdkmacoshermes
by rawprogress Aug 25, 2026 5/10
app GitHub

Project-LucidIndex: Self-hosted magazine your agents research and file

A self-hosted personal intelligence magazine where external AI agents research the targets you are watching over MCP and file the resulting articles. An interesting inversion of the usual chat interface — the agents publish to you on a schedule rather than waiting to be asked.

mcpresearchself-hostedaggregation
by lxrbckl-labs Aug 25, 2026 5/10
app GitHub

agentdeck: Web cockpit for local coding agents with persistent sessions

A browser-based cockpit for local AI coding agents — Claude Code, Codex, Grok, Pi and OpenCode — with persistent sessions, streaming output and remote access. Lets you leave a session running on a workstation and check on it from elsewhere.

web-uisessionsremotemulti-agent
by cfpperche Aug 25, 2026 6/10
app GitHub

Confer: Open A2A Platform Where Agents Talk on Their Owners' Behalf

A self-hosted agent-to-agent protocol platform letting AI agents negotiate with each other for their owners, using DID:web identities and RFC 9421 HTTP message signatures. Ships a Claude Code plugin as one of its clients.

a2aprotocolself-hostedidentity
by hyhmrright Aug 24, 2026 6/10
app GitHub

vibe-replay: Turn AI Coding Sessions Into Animated Web Replays

Converts a recorded AI coding session into an animated, interactive replay you can view in a browser. Useful for reviewing what an agent actually did, sharing sessions with teammates, or producing demos of an agent run.

replayvisualizationsessions
by tuo-lei Aug 24, 2026 6/10
app GitHub

agent-canvas: Desktop Canvas Where Multiple Coding Agents Run as Real Processes

A desktop canvas that launches several AI coding agents as real OS processes and lets you wire them together by drawing connections. Connected agents discover each other and share tasks and memory, giving a visual way to compose multi-agent work.

multi-agentorchestrationdesktopcanvas
by prayagtushar Aug 24, 2026 7/10
app GitHub

Aegis: OS-Level Monitor Attributing File and Network Events to Agents

Watches processes, file access, and network activity on the local machine and attributes each event back to the specific agent instance that caused it. Gives you an audit trail of what an autonomous coding agent actually touched outside the transcript.

monitoringsecurityobservabilityaudit
by antropos17 Aug 24, 2026 7/10
app GitHub

AgentScribe: Flat-File Logging and Telemetry Archive for Running Agents

Captures logs and telemetry from running agents and writes them to flat files with a searchable index. The archive is meant to be read back by agents themselves, so a later session can look up how a past problem was solved.

loggingtelemetrymemorysearch
by jedarden Aug 24, 2026 6/10
app GitHub

token-max-site-factory: Agent-Native SEO Page Factory With Receipts

A Python CLI that scans an existing site, generates evidence-backed pages for search and AI-answer visibility, and enforces hard quality gates before publishing. Each generated page carries provenance receipts so claims can be traced. MIT licensed.

seogeoclipython
by TheSmokeDev Aug 24, 2026 5/10
app GitHub

opencode-plugin-cc: Run OpenCode as a Subagent Inside Claude Code

A plugin that exposes OpenCode as a subagent to Claude Code, so you can hand work to a second, independent model. Intended for cross-model code review, adversarial feedback on your own agent's output, and delegated background tasks.

pluginopencodesubagentreview
by ghiaog123 Aug 24, 2026 7/10
app GitHub

reverie-automata: Reasoning-First Idle Engine for Persistent LLM Agents

An idle engine for agents that keep running between tasks: rather than scripted busy-work, behaviour emerges from the agent reasoning about its own idle state. A cheap model-free safety layer gates what the idle reasoning is allowed to act on.

idleautonomysafety
by freeze1999 Aug 24, 2026 5/10
app GitHub

anyllm-proxy: Rust Proxy for LLM Routing and Cross-API Translation

A Rust proxy that routes requests across LLM providers and translates between their API formats, in the same vein as ccrouter. Useful for pointing Claude Code at alternative backends without changing the client.

proxyrustroutingapi
by whit3rabbit Aug 24, 2026 7/10
app GitHub

codex-pr-reviewer: Claude Code Plugin for Reviewing Others' PRs With Codex

A Claude Code plugin that pulls someone else's GitHub PR and reviews it using Codex instead of Claude, giving a second-model opinion. Handy when you want review feedback that isn't from the same model that wrote the code.

plugincode-reviewcodexgithub
by dumplingsensei Aug 24, 2026 6/10
app GitHub

lockpaw: Hotkey Screen Cover for macOS That Leaves Agents Running

Covers your Mac screen with a hotkey while background AI agents keep working, unlocking with Touch ID. Includes a dog/cat mascot and native Settings, aimed at stepping away from a shared desk mid-run.

macosprivacyutility
by sorkila Aug 24, 2026 5/10
app GitHub

kn: Switch API Profiles for Claude and Codex per Terminal Session

An AI profile manager that injects environment variables so each terminal session can use a different API configuration for claude or codex. Lets you run several accounts or endpoints side by side without editing config files.

configprofilesenvironmentcli
by zhaojun2066 Aug 24, 2026 6/10
app GitHub

flowy: Build on Webflow With Claude Code, With Hook-Enforced Publish Guards

Drives Webflow development from Claude Code with explicit hand-routing and hooks that guard the publish step so an agent can't push live by accident. Includes a field manual of actual Webflow MCP behaviour, verified rather than inferred from docs.

webflowhooksmcpguardrails
by yaroshidi Aug 24, 2026 6/10
app GitHub

nodeterm: Node-Based Terminal Manager for Agents on an Infinite Canvas

Puts tmux-backed terminals and parallel agent sessions on an infinite pan/zoom canvas as draggable nodes, so a fleet of sessions is spatially arranged rather than tab-hopped. Runs on macOS and Linux, plus a browser-based Server Edition.

terminaltmuxcanvasparallel
by eneskirca Aug 24, 2026 7/10
app GitHub

rashomon: Measure Prompt and Skill Changes With Blind A/B Comparison

Runs prompt or skill variants against each other and compares results blind, so improvements are measured rather than assumed. Fills the gap where most prompt tuning is judged by whichever output the author read last.

evalsab-testingpromptsmeasurement
by shinpr Aug 24, 2026 7/10
app GitHub

refract: Write Your Agent Setup Once, Compile It Into 12 Tools' Native Formats

Keeps one source of truth — 148 commands, 88 agents, 115 skills, and 23 role-based packs — and compiles it into the native config format for Claude Code, Cursor, Gemini CLI, OpenCode, Aider, Cline, Codex, Continue, Copilot, Windsurf, Kimi, and Qwen. Solves the drift problem when you use more than one agent.

portabilityconfigcompilermulti-tool
by adnanmokhtar Aug 24, 2026 8/10
app GitHub

show-me: Isometric Codebase Map Where Every Claim Cites a File and Line

Point it at a repository and it returns an isometric visual map of the codebase, with each claim backed by a file path, line number, and the text found there. The citations make the map checkable instead of a plausible-looking diagram.

visualizationcodebasecitationsmapping
by Ofori01 Aug 24, 2026 7/10
app Reddit

Claude Usage Meter for the macOS Menu Bar, and Two Gotchas That Cost a Week

A menu bar app that converts your Claude usage percentage into remaining time ("limit in ~1h 17m"), covering the 5-hour and weekly windows with daily history and threshold alerts to Slack, Discord, or webhooks. Electron with a native Objective-C++ module, shipped through the Mac App Store; the post covers the build gotchas.

usagemacosmenubarelectron
by Fearless_Bit_1349 Aug 24, 2026 6/10
app GitHub

curtain: Agents Bring Up the Stack, Drive the App, and Record It

Starts the full stack, drives the actual running application, records the session, and tears everything down again. Gives you evidence that an agent's change works in the real app rather than only in its own summary.

testingverificationrecordinge2e
by jdsalomon Aug 24, 2026 7/10
app GitHub

clawdline: Watch and Answer Every Claude Code and Codex Session as One Live Tree

Shows every Claude Code and Codex session on your Mac in a single live tree — including sessions you started by hand and the child agents they dispatch — marking which are working, done, or waiting. You can answer any of them from your phone, with no hooks, MCP, or wrapper required; works with iTerm2 or tmux.

monitoringsessionsmobiletmux
by sainteye Aug 24, 2026 7/10
app GitHub

BongoTokenCat: A Bongo Cat Per Agent, Drumming to Its Output

Spawns a bongo cat for each running coding agent that drums along with that agent's output. A lightweight ambient signal for whether your agents are actually producing anything.

funmonitoringdesktop
by LucasOyarzun Aug 24, 2026 5/10
app Reddit

Doop: Open-Source Live Canvas Where Claude Code Designs

Doop.design is a shared live canvas where Claude Code, Codex, and other LLMs collaborate on visual design. It stores design preferences in memory so every agent produces work matching the same design system. You can drop in screenshots and ask Claude to design a site in a similar style.

designcanvasopen-sourcemulti-agent
by zatuh Aug 24, 2026 8/10
app GitHub

agentdoctor: Lint and Grade Your Coding-Agent Configuration

A zero-dependency linter that grades an AI coding agent's setup: permissions, hooks, MCP servers, skills, and memory files. A correctly configured project produces no output, so the tool only speaks up when something is off. MIT licensed.

linterconfighooksmcp
by jqntn Aug 24, 2026 8/10
app Reddit

Beacon: A Status Light Per Parallel Claude Code and Codex Session

Beacon sits in a screen corner showing one light per Claude Code or Codex session: amber while working, green when finished, red when it needs an answer. Clicking a light jumps back to that session. Lights group by project and hold a stable order so the display stays readable as sessions pile up.

monitoringparallel-sessionscodexui
by alicepk Aug 24, 2026 7/10
app Reddit

claude-chess: Play Chess Against Claude Code From Your Terminal

An open-source browser chess app that lets Claude Code play a full game against you while running in your terminal. Claude reasons about the position in chat, narrates its moves, and occasionally trash-talks. In the author's demo game it opened by the book, then lost on narration-induced time trouble.

gamechessopen-sourcefun
by tokentrillionaire Aug 24, 2026 6/10
app GitHub

agent-cerberus: Run Claude Code in Docker With Zero Credentials

Runs Claude Code inside a hardened Docker container that holds no credentials at all. Every CLI call (git, aws, gh, kubectl, terraform) is brokered through a host-side server with pluggable authorization, temporary credentials, and audit logging. Aimed at letting an agent work autonomously without handing it your keys.

securitydockersandboxcredentials
by shkrwnd Aug 24, 2026 8/10
app GitHub

Clawed-Hopper: Switch Between Multiple Claude Code Configurations

A helper for people who keep separate Claude Code setups, such as home versus work. It manages the configuration sets and lets you hop between them instead of hand-editing settings each time. Small, single-purpose utility.

configcliworkflow
by tonywalker1 Aug 24, 2026 6/10
app GitHub

agi-cockpit: Parallel Coding Agent Manager for Claude Code and Codex

A manager for running several coding agents side by side, covering Claude Code, Codex, Cursor, Grok, and more. It gives one place to start, watch, and switch between parallel sessions across different vendors.

parallel-agentsmanagercodexcursor
by tempi-tech Aug 24, 2026 6/10
app GitHub

claude-backup: Save Claude Code Sessions Before the 30-Day Deletion

Claude Code discards session history after 30 days; this tool backs it up. It captures config and chat history, syncs daily on a schedule, and supports migrating everything to another machine.

backupsessionshistorymigration
by tombelieber Aug 24, 2026 8/10
app GitHub

cconnect: Mobile, Desktop, and Web Client for Claude Code

A cross-platform client for driving Claude Code sessions from a phone, desktop, or browser. Beyond sending prompts it manages plugins, browses project files, and streams a live view of the host machine.

mobileremoteclientplugins
by jahirxtrap Aug 24, 2026 8/10
app GitHub

ai-statusline: Customizable Status Line for AI Coding Assistants

Another take on the coding-agent status line, showing model, token counts, cost, and git status in real time. Fields and layout are configurable, and it targets AI coding assistants generally rather than one specific CLI.

statuslinetokenscostgit
by mstuart Aug 24, 2026 5/10
app GitHub

memvid-rag: Local Multimodal RAG Agent for Claude Code

A retrieval agent that runs locally and indexes multimodal content for Claude Code to query. Keeps the corpus and the retrieval on your own machine rather than in a hosted vector service.

raglocalmultimodalretrieval
by fa-ina-tic Aug 24, 2026 6/10
app GitHub

agenttrail: Local Observability Map for Claude Code, Codex, and Cursor

Renders a live map of what your coding agents are doing: plans, tool calls, file changes, and progress, as it happens. Runs locally across Claude Code, Codex, and Cursor so you can watch several agents from one view.

observabilitymonitoringlocalmulti-agent
by sodiumsun Aug 24, 2026 7/10
app GitHub

agent-dashboard-command-center: A Fleet Dashboard That Audited Itself

A Tauri and Node desktop command center for managing a fleet of coding agents, with 306 tests. What makes it worth reading is the author's post-mortem against their own usage data, which concluded the premise was wrong: no click-driven feature survived 20 days of real use.

dashboardtauripost-mortemfleet
by operajiajia-prog Aug 24, 2026 7/10
app GitHub

tuotuo: Token HUD and Electric Pet for Claude Code on macOS

A local token-burn HUD that needs no API key, priced per model at each model's own list rate. It pairs the readout with a pet that glows from cool to hot as your burn rate climbs. macOS only.

hudtokenscostmacos
by Yeff144725 Aug 24, 2026 6/10
app GitHub

drkrm: A Taste Gate Between Your Agent and the Image Model

Sits between a coding agent and an image generation model, enforcing a brand kit, a budget governor, and a quality bar. Images that fall below the bar do not leave the darkroom.

imagesbrandbudgetquality-gate
by 00BROD Aug 24, 2026 6/10
app GitHub

cardex: Task Queue That Drains Claude's 5-Hour Usage Windows

A local scheduler that queues work and runs it so each 5-hour usage window is consumed rather than expiring idle. Engine profiles extend it to other Anthropic-compatible subscriptions (Kimi Code, GLM, MiniMax, MiMo, OpenCode Go, Ollama Cloud), each with its own cooldown and ledger. Single Go binary with a read-only web board.

schedulerquotaqueuego
by OttoPrua Aug 24, 2026 8/10
app GitHub

rate-sentry: Windows Tray Monitor for Claude Code and Codex Token Usage

A desktop tray app for Windows that tracks token consumption across Claude Code and Codex. Sits in the system tray so you can watch usage against your limits without leaving the terminal. Niche but welcome if you're on Windows, where most usage monitors are terminal-only.

usagetokenswindowsmonitoringcodex
by SwagatSD03 Aug 23, 2026 6/10
app GitHub

claude-handoff: One-File Export of a Claude Code Session to handoff.md

A zero-dependency, single-file tool that summarizes a finished Claude Code session into a clean handoff.md you can hand to Gemini, GPT, or another Claude. It runs post-hoc against an existing session rather than instrumenting your workflow up front. Worth a look if you want cross-model handoffs without installing a plugin.

handoffcontextsessioncross-model
by Vasilispapg Aug 23, 2026 7/10
app GitHub

skill-village-web: A Tamagotchi Village Where Your Skills Are Pixel Creatures

Renders every Claude Code skill and agent in your setup as a living pixel creature in a Tamagotchi-style village. Purely for fun, but it doubles as a surprisingly readable inventory of what you've actually installed. A novelty that makes a sprawling skills directory legible at a glance.

visualizationskillsfunweb
by trmnmc Aug 23, 2026 6/10
app GitHub

waybill: Token Accounting That Attributes Spend to the Story It Shipped

A Claude Code plugin that meters every token and ties the cost back to the specific work item it produced. Instead of a single monthly burn number, you get per-story receipts you can put in front of someone. Aimed at teams that need to justify agent spend rather than just observe it.

plugintokensaccountingcost
by Jakeintech Aug 23, 2026 7/10
app GitHub

appstore-doctor: Read-Only Diagnosis of Why Your iOS App Won't Ship

Checks code signing, provisioning profiles, and App Store Connect state to explain why a build won't make it to the store. All checks are read-only, so it diagnoses without mutating your certificates or project. Useful to hand an agent when release failures are opaque.

iosreleasediagnosticscode-signing
by Bkessing Aug 23, 2026 5/10
app GitHub

pptwise: Stable, Editable PPTX Generation From a Semantic IR

Takes a semantic intermediate representation and emits native DrawingML, so agent-generated decks stay editable in PowerPoint instead of degrading into images or brittle XML. Ships as a Claude Code plugin, a DSH plugin, and a CLI. Solves the usual failure mode where agent-built slides can't be touched afterwards.

pptxplugindocumentscli
by liustack Aug 23, 2026 7/10
app Reddit

Agent Quest: Watch Claude Code Sessions as Heroes in a 2D World

Turns Claude Code and Codex sessions into characters in a small 2D world, and now signals state clearly — working, waiting for input, finished, or errored — with visuals and sound. The point is knowing when an agent needs you without watching terminals. Open source.

monitoringnotificationsmulti-agentopen-source
by Redrock990 Aug 23, 2026 7/10
app GitHub

happy: Mobile and Web Client for Claude Code and Codex With Voice

A fully featured mobile and web client that connects to your Claude Code and Codex sessions, with realtime voice and end-to-end encryption. Lets you drive and monitor agent work away from the desk. One of the more complete remote-control clients in the ecosystem.

mobileremotevoicecodex
by slopus Aug 23, 2026 8/10
app GitHub

mondspace-reviewer: Review Agent Work in the Terminal Without Writing Back

A terminal companion for autonomous coding agents that clusters, flags, questions, and annotates their output. It deliberately never writes back to the agent, so review stays a separate, human-controlled pass. Useful when agents produce more diff than you can read linearly.

reviewterminalannotationautonomous
by mondial7 Aug 23, 2026 6/10
app GitHub

fya: Wrap Claude Code in a PTY for Clean Print-Mode JSON Output

Runs Claude Code inside a PTY session so process-based print mode emits usable JSON or streaming output. Solves the case where the CLI behaves differently when it is not attached to a terminal. Handy for scripting and CI around Claude Code.

ptyautomationjsonscripting
by yahir7695 Aug 23, 2026 6/10
app GitHub

keke: Provider-Agnostic AI Coding Harness and Agent Runtime in Rust

A Rust harness and agent runtime that is fully decoupled from any one model provider and driven by plugins. Compatible with ACP and Claude Code plugins, so existing extensions carry over. For people who want to own the loop rather than the vendor CLI.

rustharnessacpplugins
by milisp Aug 23, 2026 7/10
app GitHub

atelier: Run Coding Agents in Firecracker microVMs on Kubernetes

Provides a controlled, isolated environment for Claude Code and Gemini CLI built on Kubernetes with Firecracker microVMs. Each agent gets real isolation rather than a container escape hatch. Aimed at running agents with fewer permission prompts but real containment. Documentation is in French.

sandboxkubernetesfirecrackersecurity
by PhilippeVienne Aug 23, 2026 7/10
app GitHub

one-ring: Desktop Control Panel for AI Skills, Plugins, and Extensions

A unified desktop app for managing skills, plugins, and extensions across AI tools from one vault. Replaces hunting through per-tool config directories. Useful once your skill collection outgrows manual file management.

desktopskillspluginsmanagement
by netsirius Aug 23, 2026 6/10
app Reddit

OUTRACE: A Browser Racer That Pages You When Your Agent Stops

A WebGL time-trial racer with a pager built in: paste a token into your agent and it writes its own hook config for Claude Code settings.json, Codex notify, or OpenCode. The game then shows a banner when a turn ends or the agent is stuck on a permission. Built in three days and 74 commits with Claude Code.

notificationshooksgamewebgl
by AIeaIactaEst Aug 23, 2026 6/10
app GitHub

retake: Demo-as-Code — YAML In, Product Walkthrough Video Out

Describes a product demo in YAML so you rerun it after every change instead of re-recording. Built for coding agents to maintain alongside the code. Solves the stale-demo problem that kills most screen recordings within a release or two.

demovideoautomationyaml
by glebbogachev00 Aug 23, 2026 7/10
app GitHub

graymatter: Persistent Agent Memory in Three Lines of Code

A drop-in memory layer that claims roughly 90% lower token consumption while holding response quality. Integration is deliberately minimal — three lines. Worth benchmarking against your own workload before trusting the number.

memorytokenslibrarypersistence
by angelnicolasc Aug 23, 2026 6/10
app GitHub

mako: One Local Workspace to Run and Move Sessions Across Every Agent

Run, follow, resume, and migrate conversations across Claude Code, Codex, Cursor, Grok, Devin, and OpenCode from a single local workspace. Moving a conversation between agents is the distinctive part. For people who switch tools mid-task.

workspacemulti-agentsessionslocal
by kashyab12 Aug 23, 2026 7/10
app Reddit

claude-hl: Syntax Colors for Shell Commands in Claude Code Output

A PTY wrapper with a small VT emulator that colors command, subcommand, flags, strings, and operators in Claude Code's shell output, so a long git line reads at a glance. Claude Code itself runs exactly as shipped, leaving hooks, MCP, plugins, permissions, and Remote Control untouched. Rust, one dependency, 380 KB.

clirustsyntax-highlightingpty
by parvez210 Aug 23, 2026 7/10
app Reddit

arc: Claude Plans, Codex Writes, and Neither One Holds the Memory

A terminal app built after the author measured that their two worst long sessions (60h and 53h) were the ones that hit compaction twice, while a 4.6h session that never compacted stayed sharp. Claude interviews and plans, Codex implements, and memory lives outside both models. Written by a daily Claude Code user of over a year.

memorycompactioncodexterminal
by eliadkid Aug 23, 2026 7/10
app GitHub

Agent2Telegram: Connect Claude Code, Codex, or Antigravity to Telegram

Bridges a coding agent to Telegram so you can follow and respond from your phone. Dependency-free and built with security in mind. Another entry in the growing remote-control-over-chat category.

telegramremotenotificationsmobile
by petrludwig-collab Aug 23, 2026 6/10
app GitHub

cc-warehouse: Permanent, Readable Archive of Your Claude Code Sessions

Captures each session as it ends and renders Markdown plus self-contained HTML beside the untouched original JSONL. Survives project moves and renames, and supports redacted sharing, integrity checks, and one-shot import of existing archives. For people who want their session history to outlive the tool.

archivesessionshistorymarkdown
by CaptainCodeAU Aug 23, 2026 7/10
app GitHub

artifacture: Verified Visual Explainers Authored in MDX and React

Coding agents author explainers in MDX/React, which then pass deterministic design-quality verification and a multi-model eval harness. The verification step is what separates it from a template library. Aimed at documentation and teaching material that has to look right.

mdxreactdocseval
by theclaymethod Aug 23, 2026 6/10
app Reddit

CCC v5.26.0: Manual Sub-Session Attach and Devin Effort Mapping

The Claude Command Center dashboard, used by its author to run 30+ parallel Claude Code and Codex sessions, adds a manual attach and detach action for linking related sessions that lack real spawn lineage, so they nest like true subagents. Devin CLI sessions now show model, reasoning effort, and subagent calls, with the low-to-max effort ladder mapped across tools. Ships most days.

dashboardsessionsmulti-agentdevin
by amirfish Aug 23, 2026 6/10
app GitHub

sirious: Computer-Use CLI for Hyprland and Wayland Desktops

Gives any agent — pi, Claude Code, or Codex — control of a Wayland desktop through plain bash commands, plus a headless pi summon. Fills the Linux gap in computer-use tooling that mostly targets macOS. Hyprland-oriented.

computer-usewaylandhyprlandlinux
by AdamUnderwood375 Aug 23, 2026 6/10
app GitHub

bridget: Rust Daemon Letting CLI Agents Talk Across Machines

Connects command-line AI agents to each other over a Unix socket locally and SSH federation across machines, via a Rust daemon. Agent-to-agent messaging without a cloud broker. Documentation is bilingual French and English.

rustmulti-agentsshdaemon
by guthubrx Aug 23, 2026 6/10
app GitHub

kimetsu: Evidence-first memory that records what actually solved the problem

A memory layer for Claude Code, Codex, and terminal agents that watches sessions and captures the steps that genuinely resolved problems, rather than storing everything indiscriminately. It then feeds that high-signal context back so the next run starts where the last one ended. The evidence-first framing is the differentiator in a crowded agent-memory field — it filters on outcomes instead of recency.

memorycontextclaude-codecodexpersistence
by RodCor Aug 23, 2026 7/10
app GitHub

squinch: Architecture diagrams as code, in a DSL agents write fluently

A diagramming DSL designed so a coding agent can author architecture diagrams reliably while you keep precise control over the output. Renders to deterministic SVG, which means diagrams diff cleanly in git and regenerate identically. A better fit than Mermaid-by-prompt if you want agent-generated architecture docs to stay stable across commits.

diagramsdslsvgdocumentationarchitecture
by jquatier Aug 23, 2026 7/10
app GitHub

claude-code-sessions: Move sessions between accounts and project folders

An unofficial utility for the Claude Code session files on disk: surface a session under a different Claude account on the same machine, or relocate one to another project folder. Operations are journaled and reversible, and it fails closed rather than risking your history. Niche, but it solves a real annoyance if you juggle two accounts or reorganize project directories.

sessionscliguiclaude-codeutility
by craigstoller Aug 23, 2026 6/10
app GitHub

rundesk-cli: Persistent AI teammates with memory, skills, and schedules

A CLI for running long-lived agent "teammates" that keep memory between runs, load skills, and act on schedules rather than only when prompted. The pitch is proactive and self-improving agents — work that continues on a cadence instead of per-session. Early and broad in scope, so treat it as something to watch rather than a settled tool.

cliagentsmemoryskillsscheduling
by rundesk-ai Aug 23, 2026 5/10
app GitHub

vibehub: Self-hosted kanban IDE for containerized Claude Code agents

A hosted IDE that puts live Claude Code terminals on a kanban board, each running in its own container on a server you control. Cards represent agent tasks, so you can watch and steer several concurrent sessions from one browser tab. Useful if you want parallel agent work without juggling tmux panes on your laptop.

idecontainersmulti-agentself-hostedkanban
by cesarvcanal Aug 23, 2026 7/10
app GitHub

tiny-code-pet: Native Windows desktop pet showing Claude Code task status

A small native Windows desktop companion that reflects what Claude Code (or Codex) is doing — current task status, progress across a whole request, and a signal when the quiet window means it is done. It is an ambient status indicator rather than a control surface. Handy when the agent runs long and you have switched to another window.

windowsdesktopstatusnotificationsux
by nikotaronosuke Aug 23, 2026 6/10
app GitHub

claude-dashboard-vscode: VS Code dashboard and status bar for Claude Code

An unofficial VS Code extension that reads ~/.claude and surfaces spend, active agents, workflows and usage limits in a dashboard plus status bar. Everything is local file parsing, so no account hookup is required. Useful for keeping an eye on limits mid-session without leaving the editor.

vscodedashboardusagemonitoringextension
by grgrwlkr Aug 23, 2026 7/10
app GitHub

motionworks: Direct manipulation motion design layer for agent-built projects

A motion design layer that lets you tune animations by direct manipulation instead of describing them in prompts. Aimed at projects scaffolded by AI coding agents, where the generated UI usually lands with generic or missing motion. Fills the gap where natural language is a poor tool for timing and easing.

motion-designanimationfrontenduidirect-manipulation
by jhn-kim Aug 23, 2026 5/10
app GitHub

muster: Local-first multi-agent workbench with per-task worktree isolation

A local-first workbench for running multiple coding agents across projects, with evolving org blueprints describing agent roles. Supports Claude Code, Codex, OpenCode, Antigravity and pi CLI alongside OpenAI-compatible and Gemini API executors. Each task gets its own git worktree, so parallel agents do not collide on the same files.

multi-agentorchestrationgit-worktreelocal-firstworkbench
by CNiMaster Aug 23, 2026 7/10
app GitHub

Self-Updating Claude Code on NixOS Without npm Globals

Packages the official Anthropic Claude Code binary for NixOS so it stays current without npm global installs, third-party binary caches, or waiting for a nixpkgs bump. Includes a pinned fallback for reproducible builds when you need a known-good version. Solves the recurring NixOS friction of a CLI that expects to self-update on a system where the store is immutable.

nixosnixinstallationself-updatepackaging
by pete-builds Aug 23, 2026 6/10
app GitHub

soloist: Linux Terminal Workspace for Coordinating Multiple Coding Agents

A Linux alternative to Solo (soloterm.com) that runs your dev stack and your CLI coding agents side by side in one window with real terminals. It adds crash auto-restart, Git and pull request handling, and a shared project workspace where multiple agents coordinate over MCP. Targets Ubuntu 22.04+ on x86_64.

terminalmulti-agentmcplinuxorchestration
by ArtMin96 Aug 23, 2026 7/10
app GitHub

citshe: Phone-First Command Panel for Claude Code Workers

A mobile control panel for shipping and maintaining a portfolio of web apps from your phone. Tasks are delegated to Claude Code workers that pull from a queue, run in isolated containers, and open PRs; you can also open browser terminals. It surfaces live status across Cloudflare, Vercel, Neon, VPS, Expo, and Apple Developer in one view.

mobileorchestrationcontainersdeploymentdashboard
by mitshe Aug 23, 2026 7/10
app GitHub

claude-code-sentinel: Session Monitor and Weekly Limit Dashboard

A time tracker for Claude Code that monitors sessions and shows how much of your weekly limit you have consumed. It gives you a dashboard view of usage over time rather than discovering a limit at the moment you hit it. One of several tools in this space, so check whether it adds anything over what you already run.

monitoringusage-trackingdashboardquota
by fakegamer07 Aug 23, 2026 5/10
app GitHub

paseo-agent-superpowers: Multi-Account Routing Across Claude Code, Codex, Kimi and Grok

A Paseo plugin that tracks every coding-agent account you hold — Claude Code, Codex, Kimi, Grok — with live health status and automatic routing between them when one is throttled or down. It also bundles a universal MCP server manager. Works standalone if you do not use Paseo.

multi-accountroutingmcppluginfailover
by itsjustanks Aug 23, 2026 6/10
app Reddit

Web Wrapper for Claude Code with Session History and Diff Review

A developer's own web app that wraps Claude Code so sessions across many projects stay findable. Hooks stream prompt data to the app as Claude works in the background, and replies go back through claude -p with the stored session ID to continue the conversation without opening a terminal. Includes a diff viewer and plan view; shared as a show-and-tell after six months of daily use.

wrapperhookssession-managementweb-uiheadless
by m4rcoperuano Aug 23, 2026 5/10
app GitHub

agent-beacon: Open-Source Telemetry Layer for AI Agents

A telemetry layer that instruments AI agents wherever they run — local machine, CI, or cloud — so behavior is observable across environments instead of only in the terminal you launched from. Open source, and positioned as general-purpose rather than tied to one agent runtime. Useful if you are running agents in CI and currently flying blind.

telemetryobservabilitymonitoringciopen-source
by Asymptote-Labs Aug 23, 2026 7/10
app GitHub

wshobson/agents: Multi-Harness Agentic Plugin Marketplace

A plugin marketplace of specialized agents that works across Claude Code, Codex, Cursor, OpenCode, GitHub Copilot, and Google Antigravity. Instead of maintaining separate agent definitions per tool, you install from one catalog and reuse the same roles everywhere. Useful if you switch harnesses or run several in parallel.

agentspluginsmarketplacemulti-harness
by wshobson Aug 22, 2026 8/10
app GitHub

flightdeck: Stream Deck XL Annunciator Panel for Parallel Claude Code Agents

Maps a fleet of parallel Claude Code sessions onto a Stream Deck XL, one key per session, colour-coded by lifecycle state. Press to focus a session, long-press to tear it down safely, and answer permission prompts directly from the deck. macOS + iTerm2 only.

stream-deckmulti-agentsession-managementmacos
by louisalexander Aug 22, 2026 8/10
app GitHub

PromptMatrix: Git-Style Version Control for LLM Prompts

Open-source prompt version control aimed at AI teams: git-style history, automated evals against saved prompt versions, and one-click rollback. Fills the gap where prompts live in code but are not reviewed or regression-tested like code. Not Claude Code specific, but relevant to anyone maintaining prompts in a shared repo.

promptsversion-controlevalstooling
by PromptMatrix Aug 22, 2026 5/10
app GitHub

mairouter: Local Routing Gateway for 96+ AI Providers with Format Translation

A self-hosted gateway that exposes one endpoint and routes requests to 96+ model providers. It translates automatically between the Claude, OpenAI, and Gemini API formats, so a client written against one API can talk to any backend. Handy for pointing Anthropic-format tools at alternative or local models without rewriting them.

gatewayrouterapi-proxymulti-providerself-hosted
by NatrocTeam Aug 22, 2026 7/10
app GitHub

spar: Predict-Then-Compare Practice to Keep Learning While AI Writes Code

A practice tool that asks you to predict what the agent will do before it shows you the code, then turns every gap between your guess and reality into a personal curriculum. It targets skill atrophy from heavy agent use. Turns ordinary coding sessions into deliberate practice instead of passive review.

learningskill-buildingcode-reviewdeveloper-tools
by Lander-Parren Aug 22, 2026 6/10
app GitHub

huddle: Multi-Session Claude Code Orchestrator for Windows

A Windows console that runs a fleet of Claude Code sessions as a coordinated dev team, with one place to launch, watch, and steer each agent. Most multi-agent orchestrators assume tmux or a Unix shell, so this fills a real gap for Windows users. Useful for running parallel agents on separate tasks without juggling terminal windows.

orchestrationmulti-agentwindowsclaude-codeparallel-sessions
by halrad-com Aug 22, 2026 8/10
app GitHub

agent-html-render: Local Visual Review Loops for Coding Agents via Plain HTML

A local tool that lets coding agents render ordinary HTML so they can visually review their own output instead of guessing from code alone. It closes the write-render-inspect loop without a heavyweight browser automation stack. Useful for agent workflows that generate UI, reports, or documents and need a visual check step.

htmlvisual-reviewagentsfeedback-looplocal-first
by RiadMefti Aug 22, 2026 6/10
app GitHub

skill-kit: Local-First Analytics for AI Agent Skills

A local-first analytics layer for AI agent skills: it tracks which skills fire, how often, and in what context, keeping all of the data on your own machine. Useful if you maintain a large skill library and want evidence about what actually gets used rather than guesses.

skillsanalyticslocal-first
by crafter-station Aug 22, 2026 6/10
app GitHub

waku: Native Desktop App for All Your Coding Agents

A native application that hosts your coding agents in one place instead of scattered terminal tabs. Built by egoist, it gives agent sessions a proper desktop UI with the responsiveness of a native app.

desktopguimulti-agent
by egoist Aug 22, 2026 7/10
app GitHub

dazzle-claude-config: Sync Claude Code Config Across Machines

A CLI (ccs) that collects your Claude Code configuration, pushes it to a GitHub payload repo, and applies or bootstraps it on another machine. Solves the drift between laptop and desktop setups without hand-copying dotfiles.

configsyncdotfilescli
by DazzleML Aug 22, 2026 7/10
app GitHub

memory-bank: Version-Controlled Context and Delivery Flows

A repository-committed memory bank holding project context, governance rules, and delivery workflows for coding agents. Because it lives in git, the agent's understanding is reviewable in a diff and travels with the branch.

memorycontextgitgovernance
by dapi Aug 22, 2026 6/10
app GitHub

sprint-coder: Local-First Multi-Agent Coding Desktop

An open-source desktop app (Japanese-language) bundling Codex CLI, Claude Code, Gemini, and cloud or local LLMs into a single AI team workspace. It moves you from one chat window to coordinating several agents from one surface.

desktopmulti-agentlocal-firstjapanese
by Robbits-CO-LTD Aug 22, 2026 7/10
app GitHub

claude-patch: Pure-Go Patch Adding Third-Party Models to Claude Code

A Go tool that patches Claude Code v2.1.233 to talk to third-party model endpoints while keeping the native /model and /fast commands and normal terminal interaction intact. Written in pure Go with no runtime dependencies.

modelsproxygopatch
by cnlanlansky Aug 22, 2026 7/10
app GitHub

resource-broker: Stop Concurrent Claude Code Sessions Colliding

A shared bulletin board where each Claude Code session on a machine declares the finite resources it is about to use — ports, devices, files — so the others can see it. It deliberately never blocks and never inspects a resource; visibility is the entire mechanism. UI and docs are Japanese.

concurrencymulti-sessioncoordinationjapanese
by 1-case Aug 22, 2026 7/10
app GitHub

happier: End-to-End Encrypted Client for Coding Agents on Any Device

A client for Codex, Claude Code, OpenCode, Kimi, Augment Code, and Qwen that runs on web, desktop, and mobile with end-to-end encryption throughout. Start a session at your desk and keep following it from a phone.

clientmobileencryptionmulti-agent
by happier-dev Aug 22, 2026 7/10
app GitHub

open-migrate: Move Rules, Skills and Hooks Between AI Coding Tools

Migrates your configuration — rules, skills, subagents, hooks, permissions — between Claude Code, Codex CLI, Cursor, and Grok Build. It plans the migration before touching anything and supports an undo afterwards.

migrationconfigportabilityhooks
by chakki-the-potato Aug 22, 2026 7/10
app GitHub

keyboard-a11y-tester: Screen-Reader Testing With WCAG Evidence

Drives a real browser keyboard-only and with a screen reader, then emits WCAG findings each linked to the evidence that produced it. Aimed at accessibility checks an agent can run and a human can actually audit.

accessibilitywcagtestingbrowser
by ezufelt Aug 22, 2026 7/10
app GitHub

mneme-plugin: Human-Gated Cross-Project Memory and Phase Workflows

A Claude Code plugin providing persistent memory that spans projects plus a phase-based workflow engine, stored locally and event-sourced so every change is replayable. Writes to memory are human-gated rather than automatic.

memorypluginevent-sourcingworkflow
by supostat Aug 22, 2026 8/10
app GitHub

agsearch: Global Search Across Claude Code and Codex Sessions

Searches every past Claude Code and Codex CLI conversation on your machine and lets you resume the one you find. Answers the recurring 'I solved this three weeks ago in some session' problem.

searchsessionshistorycli
by devcodes9 Aug 22, 2026 8/10
app GitHub

OpenNest: Desktop Roster of Claude Code Bots With Their Own Models

A desktop app presenting your Claude Code work as a roster of bots, where each keeps its own model, working directory, and persistent conversation. Switching tasks means switching bots rather than re-establishing context.

desktopmulti-agentsessions
by shoto290 Aug 22, 2026 7/10
app GitHub

swarm: Local-First Control Plane for Live Claude Code Sessions

Watches every Claude Code session on your machine in real time and keeps a ledger of tasks, worktrees, and resources alongside token spend and cost. Rules are enforced centrally instead of being repeated in each session.

dashboardmulti-agentcostlocal-first
by ra3orblade Aug 22, 2026 7/10
app GitHub

clawdeck: Turn an Elgato Stream Deck Into an Agent Status Display

Maps Claude Code and Codex session state onto Stream Deck keys so you can see at a glance which agent is running, blocked, or done. Physical ambient status instead of one more window to check.

stream-deckstatushardwaremonitoring
by itIsMaku Aug 22, 2026 7/10
app GitHub

sift: A Context Budget for CI That Fails the Build When It Grows

Measures the always-on context tax of your CLAUDE.md, skills, and subagents, diffs it on every pull request, and fails the build when it grows past budget. The bundle-size bot, applied to agent configuration.

cicontextclaude-mdbudget
by Jithendrag22 Aug 22, 2026 8/10
app GitHub

agent-orchestrator: One Captain Directing All Your Coding Agents

A single control surface for directing several coding agents, following each session as it runs, and stepping in at any point. Positions you as the captain rather than a tab-switcher.

orchestrationmulti-agentmonitoring
by RiadMefti Aug 22, 2026 6/10
app GitHub

bridger: Let Two Claude Code Sessions Talk to Each Other

Connects two Claude Code sessions so the one holding the relevant context answers the other's question — no copy-paste, no re-explaining. Aimed at the split-brain problem when you run more than one session on a project.

multi-sessioncommunicationcontext
by HoussemDjeghri Aug 22, 2026 7/10
app Reddit

nono: Micro-Sandbox Individual Tool Calls, Including Shell-Wrap Escapes

An open-source agent runtime security tool that sandboxes tool executions one at a time and blocks the shell-wrapping tricks agents use to slip out of isolation. The release adds worked tool-sandbox examples.

securitysandboxruntimeopen-source
by DecodeBytes Aug 22, 2026 7/10
app GitHub

infomarchy: Your Wallpaper as a Live Information Desk for Agents

An Omarchy plugin turning the desktop wallpaper into a clickable status board showing every running AI agent — Claude Code, Codex, Grok, Ollama — with a seven-day heatmap, rate limits, recent prompts, and machine stats. Follows the active theme.

dashboardlinuxomarchymonitoring
by nixfred Aug 22, 2026 7/10
app GitHub

mncode: Go CLI Coding Assistant With Claude Code Compatibility

A high-performance coding assistant CLI written in Go that stays compatible with Claude Code, adds multi-account routing, and supports ClaudeKit skills. Positioned as a faster drop-in for the same workflow.

cligocompatibilityrouting
by mncuchiinhuttt Aug 22, 2026 6/10
app GitHub

agent-permissions: One permissions.json Policy for Every Agent

A cross-agent permission policy kept in a single .agents/permissions.json, with an MCP sync daemon, a CLI, per-tool codecs, and an evaluator. Write the rule once instead of maintaining a different allowlist per agent.

permissionssecuritymcpcross-agent
by Mearman Aug 22, 2026 7/10
app GitHub

claude-redact: Find Credentials Leaked Into Claude Code Transcripts

Scans Claude Code's local transcripts and state files for credentials that ended up there — keys pasted into a prompt, secrets echoed by a command. Read-only with zero dependencies, so it changes nothing while it looks.

securitysecretstranscriptsscanner
by deviationist Aug 22, 2026 8/10
app GitHub

ccpeek: Explore Your Claude Code History Locally

A local browser for your Claude Code session history, letting you dig through past conversations on your own machine. No upload and no service in between.

historysessionslocalcli
by ahmedelgabri Aug 22, 2026 7/10
app GitHub

AI-agent: Directory-Driven Cross-Platform Agent Installer for China

An installer wizard aimed at users in China for setting up Claude Code, Codex, Hermes, and domestic model CLIs from a directory-driven catalog. Still in testing, with the author actively asking for reports.

installerchinasetupcross-platform
by gao666490 Aug 22, 2026 5/10
app GitHub

secskill: Audit Skills for Prompt Injection Before They Run

Scans your Claude Code skills for prompt injection, hidden instructions, credential exfiltration, and guardrail tampering before any of it reaches the model's context. Since skill installs increasingly come from strangers' repos, this is the gap between npm-style convenience and actual review.

securityprompt-injectionskillsaudit
by newts7 Aug 22, 2026 9/10
app GitHub

agent-tab-colors: Terminal Tabs That Turn Red When an Agent Blocks

Colours iTerm2 tabs by agent state — red when blocked, amber when it is your turn — with the colour fading over twelve hours so stale tabs recede. Supports iTerm2 and Claude Code today.

terminaliterm2statusnotifications
by pocketarc Aug 22, 2026 7/10
app GitHub

attune-ai: Persistent Memory and Receipt-Verified Workflows in One Install

Bundles a Claude Code plugin, an MCP server, and a spec-driven development framework into a single pip install, giving persistent memory plus workflows whose completion is backed by receipts. Aims to replace three separate tools with one.

memorymcppluginreceipts
by Smart-AI-Memory Aug 22, 2026 7/10
app GitHub

deepPairing: Visual Review Surface for Changes an Agent Will Make

Shows pending agent changes on a rich visual surface with inline comments and supporting evidence, gated so nothing lands unreviewed. The gate remembers the approaches you rejected, so the agent stops re-proposing them.

reviewgatesuidiff
by mitchjablonski Aug 22, 2026 7/10
app Reddit

Four Months of Vibe Coding: A Browser Racer That Reached Beta

A follow-up on an F-Zero-style browser racing game built by someone with no coding background, now closer to beta than tech demo after four months. The main change was moving planning to Fable and wiring it into the build loop.

showcasegamewebgllong-term
by ActionLittle4176 Aug 22, 2026 6/10
app GitHub

semantic-compactor: Lossless Compaction of Session Knowledge

Compacts what a session learned without losing it, using symptom-first triage, durable capture of findings, and a cold-start verification pass that checks the compacted form still works. Targeted at the moment context runs out mid-investigation.

contextcompactionmemorysessions
by clyde-tressler Aug 22, 2026 7/10
app GitHub

rgt: Numeric and Date Provenance Tracking for LLM Coding Agents

A Rust graph tracker that follows where numbers and dates came from, evaluates the expressions that produced them, and verifies each derivation. Aimed at the class of agent error where a plausible figure has no traceable origin.

provenanceverificationrustdata
by rafael-bianchi Aug 22, 2026 6/10
app Reddit

What Memory Tool Actually Retrieves the Right Context?

A user evaluated memplace after a month and found it rarely surfaced the context the agent needed, at roughly a 900:1 ratio, and asks what people use instead. Worth reading as much for how to test a memory tool as for the recommendations.

memoryevaluationtoolsdiscussion
by zeesshhh Aug 22, 2026 5/10
app Reddit

TS Evidence Graph: A Compiler Rule Enforcing Requirements Coverage

Annotates TypeScript declarations with @evidence tags pointing at the spec sections, endpoints, and hooks each one satisfies, then enforces coverage as a compiler rule. Requirements an agent skipped become build failures instead of silent gaps.

typescriptrequirementscompilercoverage
by jhnam88 Aug 22, 2026 7/10
app GitHub

gremlins: Background Agents That Execute, Review and Land Work

Runs coding agents in the background through the full cycle — do the work, review it, land it — without a human in the loop at each step. For the queue of work you would otherwise babysit.

automationbackgroundunattendedreview
by xbrianh Aug 22, 2026 7/10
app Reddit

phantom: Wrap a Command, Let Claude Fix the Crash on a Throwaway Branch

Wraps a command you already run and stays invisible until the process exits non-zero, then captures the stack trace, output tail, and git state, cuts a branch, and hands it to a headless Claude Code session that writes a failing test and patches it. Crucially, phantom re-runs the tests itself outside the session and audits the branch, so nothing in the report rests on the model's own word.

debuggingcrashverificationautomation
by OkLengthiness3801 Aug 22, 2026 8/10
app Reddit

openwolf at Five Months: Condensed Output, Real Costs, Shared Memory

Local hooks sitting under your coding agent that condense flooding command output before it enters context while keeping the full text on disk. When a session ends it prices your real usage from the harness transcript, and it keeps one git-committed .wolf/ memory shared across Claude Code and Codex.

hookscontextcostmemory
by LawfulnessSlow9361 Aug 22, 2026 7/10
app GitHub

crux: A Scientific-Method Lab Notebook Your Agent Drives

Structures research as a tree of questions and falsifiable hypotheses kept in plain markdown, so an AI agent can extend the tree while you keep the files in git. Ships an LLM-maintained literature wiki and a browser GUI cockpit for navigating the tree. Aimed at agent-assisted research rather than agent-assisted coding.

researchmarkdownhypothesesnotebook
by mehdiforoozandeh Aug 22, 2026 6/10
app GitHub

dsh-movein: Move Skills, Commands, Agents, and MCP Config Between Agent CLIs

A migration tool that safely transfers skills, slash commands, subagents, and MCP server config between Claude Code, OpenCode, Codex, and DeepSeek Harness. Handles the format differences per harness instead of making you hand-port each file. Handy if you keep one canonical config but run several CLIs.

migrationopencodecodexconfigportability
by sjh9714 Aug 22, 2026 7/10
app GitHub

nyann: Claude Code Plugin That Sets Up and Maintains Project Governance

A plugin (Burmese for 'scaffolding') that installs project governance structure and then keeps it current as the codebase evolves. Rather than a one-shot template dump, it re-checks and maintains the conventions it scaffolded.

plugingovernancescaffoldingconventions
by thettwe Aug 22, 2026 6/10
app GitHub

llm-pulse: macOS Menu Bar Monitor for Local AI Coding Tasks

A native macOS menu bar app that shows the state of local AI coding runs at a glance. Codex is supported today with Claude Code and Qwen3.7 listed as next. Useful if you kick off long agent sessions and want status without keeping a terminal in view.

macosmonitoringmenubarcodex
by zuuzii-org Aug 22, 2026 5/10
app GitHub

nativewright: CLI-Driven Persistent Chrome for AI Agents

Drives a long-lived Chrome instance through CLI commands so agents can browse sites that require being logged in. Sessions and cookies persist between commands, which is the piece plain headless automation usually loses.

browserchromeautomationclisessions
by barongoj3693 Aug 22, 2026 6/10
app GitHub

bristol-tickets: A Kanban Board You Share With Your AI Agents

A ticket board that both you and your coding agents read and write, so agent work is tracked as cards instead of buried in chat scrollback. Gives multi-agent runs a visible queue and a shared definition of what is in progress.

kanbanticketsmulti-agenttask-management
by JackHatchett Aug 22, 2026 6/10
app GitHub

staxtrace: Offline Observability and Memory for AI Coding Sessions

A local-first Rust engine that records agent session history so you can trace back what happened — described as a stack trace for your agent history. Supports 20+ providers and keeps every byte on your machine, with no hosted dashboard in the loop.

observabilityrustlocal-firstmemorysessions
by 0bserver07 Aug 22, 2026 7/10
app GitHub

agentos: Single-Operator Control Plane for Scoped Agent Tasks

A local control plane for handing scoped software tasks to coding agents, with observability, durable state, and approval gates. Built independently on the Claude Agent SDK, inspired by Danny Postma's AgentOS video. Currently a v0.1.0 developer preview.

agent-sdkcontrol-planeorchestrationgates
by mosonlab Aug 22, 2026 6/10
app GitHub

OpenTrade: Open-Source Trading Harness for Claude Code and Codex Agents

A harness that gives coding agents a structured environment for trading work rather than ad-hoc scripts. It targets both Claude Code and Codex agents, so strategy and execution logic stays agent-agnostic. Useful as a reference for how to wrap a domain with real-world side effects in an agent-driven loop.

tradingharnessagentscodexopen-source
by OpenTradeOSS Aug 21, 2026 7/10
app Reddit

specfill: A TUI That Interviews You About the Gaps in Your Spec

specfill analyzes a project specification, researches the topic, and then interviews you one question at a time about missing architecture, behavior, edge cases, and UI/UX decisions, folding the answers back into the original document while preserving its structure. Skipped questions stay unresolved instead of being filled with invented answers. Unlike Plan Mode, which produces a plan for the current session, the output is a reusable spec you can commit; it supports Anthropic, OpenAI, Google, and OpenAI-compatible providers.

spectuiplanningrequirementsinterview
by trashcoder Aug 21, 2026 7/10
app GitHub

claude-docker: Lightweight Community Docker Image for Claude Code

A community-maintained Docker image that packages Claude Code for containerized use. The stated focus is staying lightweight rather than bundling a large toolchain. Handy for sandboxed runs, CI, or keeping agent sessions off the host filesystem.

dockercontainersandboxdevops
by jyje Aug 21, 2026 6/10
app GitHub

vscode-claude-turn-diff: See a Whole Claude Turn as One Multi-File Diff

A VS Code extension that collects every file Claude Code touched during a single turn and presents it as one unified multi-file diff. Instead of reviewing edits tool call by tool call, you get a single review surface per turn. Aimed at people who run Claude with auto-accept and want a fast after-the-fact review pass.

vscodediffcode-revieweditor-integration
by ZhenyaUsenko Aug 21, 2026 7/10
app Reddit

Daily Business News Agent: Portfolio-Aware Briefings as MP3

A Claude Code agent that generates a personalized 15-20 minute business news briefing every business day, reading a portfolio and watchlist from Google Sheets, pulling live quotes via yfinance, and rendering audio with Kokoro TTS to Google Drive. It carries context from prior reports so stories build on each other instead of repeating, and accepts feedback that shapes future runs. A good template for scheduled, personalized research agents.

agentautomationttsfinancescheduled
by krkn1010 Aug 21, 2026 6/10
app GitHub

local-kanban: kb CLI + Web Board for Working Alongside Claude Code

A local-first kanban board designed to be driven by Claude Code, combining a kb command-line interface with a web board view. Cards live locally and can optionally be mirrored to GitHub issues. Useful if you want the agent to track and update its own task board without leaving the terminal.

kanbanclitask-managementgithub
by lamaohub Aug 21, 2026 7/10
app GitHub

agent-plugins: Cross-Harness Plugin Marketplace Gated by a Three-Tier Eval Suite

A Claude Code plugin marketplace whose plugins are written to work with any agent harness, not just Claude Code. Every change has to clear a three-tier evaluation suite before landing, which is an unusual amount of rigor for a plugin registry. Useful both as a source of plugins and as a model for testing them.

marketplacepluginsevalscross-harness
by JRichlen Aug 21, 2026 6/10
app Reddit

Session Kit: Terminal Picker for Managing 10+ Concurrent Claude Code Sessions

Session Kit runs on the machine hosting your Claude Code and Codex sessions and presents them all in one terminal picker, each with a stable number, name, color, model, and status. Status comes from live process evidence rather than window titles, so sessions blocked waiting on you sort to the top. Sessions survive SSH disconnects via shpool, and a per-repo session-kit.toml sets the provider, account, model, and startup command.

session-managementtuimulti-agentcodexopen-source
by dob312 Aug 21, 2026 8/10
app Reddit

VibeRevert: Rollback Layer That Flags Risky Claude Code Edits

VibeRevert wraps a Claude Code session, snapshotting the project before the agent starts and flagging changes that touch payments, auth, migrations, secrets, infrastructure, or dependencies. The checks are deterministic rules rather than another model, so the same inputs always produce the same findings with an inspectable reason. Rollback previews before writing and preserves your own uncommitted work, which plain git checkout would destroy.

rollbacksafetygitguardrailscli
by Creamy-And-Crowded Aug 21, 2026 8/10
app GitHub

lore: Self-Improving Memory for Claude Code With a Belief Store and FTS5 Search

lore gives Claude Code a memory layer that reasons about you instead of just storing notes, using a Honcho-style belief store with deriver, dreamer, and dialectic stages. It automatically turns recurring patterns into skills via a closed judge/update/retire loop, hard-caps curated memory so it cannot grow without bound, and adds FTS5 full-text search over past sessions. Everything lives in one SQLite file using only stdlib Python, with a human in the loop.

memorysqliteskillsfts5python
by docwilde Aug 21, 2026 8/10
app GitHub

agent-tty: Drive, Inspect, and Record Terminal Sessions From the CLI

agent-tty from the Coder team lets you drive, inspect, and record terminal sessions programmatically from the command line. That makes it a useful primitive for automating or observing coding agents that live in a TTY, including headless Claude Code runs. Useful for building supervisors, replay tooling, or test harnesses around interactive agent sessions.

terminalautomationrecordingclitooling
by coder Aug 21, 2026 7/10
app Reddit

Building a Kids' Receipt Printer on a Raspberry Pi Entirely in Claude Code

A parent with no prior wiring experience built a real toy cash register — six arcade buttons, a thermal receipt printer, and a Pi Zero — through Claude Code sessions run mostly over SSH on the Pi itself. Two debugging stories stand out, including RPi.GPIO's interrupt-based edge detection failing on newer kernels because it depends on a stale sysfs interface, which they replaced with a plain 20ms polling loop. A concrete look at how far agent-driven development goes into unfamiliar hardware territory.

raspberry-pihardwaregpiodebuggingssh
by Nuenni Aug 21, 2026 6/10
app GitHub

claude-code-sessions-viewer: Fuzzy-Searchable Browser With One-Key Resume

A visual browser for every Claude Code session on your machine, spanning all projects and git worktrees. Fuzzy search narrows the list, a live preview pane shows session content before you commit to opening it, and a single keypress resumes the session you land on. Handy when you juggle many short-lived sessions and lose track of where a piece of work happened.

sessionssearchresumeworktreestui
by maxhayim Aug 21, 2026 8/10
app GitHub

tracer: Turn AI Coding CLI Transcripts Into a Self-Contained HTML Trace Viewer

tracer converts session transcripts from AI coding CLIs into a single self-contained, browsable HTML file. Because the output has no external dependencies, a trace can be shared, archived, or attached to a bug report and still open anywhere. Useful for reviewing what an agent actually did across a long session or for post-mortems on runs that went sideways.

transcriptshtmlviewerdebuggingsessions
by codesweep-ai Aug 21, 2026 7/10
app Reddit

Claude Sessions: Desktop App to Browse and Search All Your Claude Code Logs

Claude Code writes every session as JSONL under ~/.claude/projects and deletes it after ~30 days, with no browser or search. Claude Sessions is a 100% local Tauri/Rust/Svelte desktop app that indexes every session across projects with global search, in-session find, and keyboard nav, handling 500k-token sessions. It surfaces what raw logs bury — mid-turn interrupts, AskUserQuestion picks, edited files, subagent transcripts, fork lineage — and lets you save sessions past the cleanup window or export to Markdown.

sessionshistorysearchtaurilocal-first
by hero_ascending Aug 21, 2026 8/10
app Reddit

RAG Plugin for Claude Code: 32% Fewer Tokens, 53% Fewer Tool Calls

A plugin that gives Claude Code SQL, hybrid RAG, and grep as retrieval options over your repository instead of relying on grep-and-read alone. The author reports 32% fewer tokens, 53% fewer tool calls, and 32% less wall time, since context retrieval is offloaded to local CPU and memory rather than spent on the model reasoning about how to search.

pluginragcontexttoken-efficiencysearch
by m-penaroza Aug 21, 2026 7/10
app GitHub

biz-studio: Local-First AI Video Studio in a Single Go Binary

A local-first video production studio shipped as one Go binary that drives AI editing through your Claude CLI subscription rather than a separate API key. It handles auto-cut, subtitles, on-device TTS, translation, quality control, and packaging for publish. Everything runs on your machine.

videogolocal-firstcliautomation
by nguyenduchoai Aug 21, 2026 6/10
app GitHub

threadknot: Run Claude Code on Any of Your Machines, Check From Your Phone

A free and open-source desktop app that runs Claude Code, Codex, and Kimi across your own machines. Hosts discover each other over your local network, so you can start work on whichever box you want and monitor it from your phone. No cloud service and no account required.

desktopremotemobilemulti-agentopen-source
by smith-network-solutions Aug 21, 2026 7/10
app GitHub

agentlink: Sync One AGENTS.md to Every AI Coding Tool via Symlinks

Keeps a single AGENTS.md as the source of truth and symlinks it into the config location each AI coding tool expects. No code generation and no duplicated files that silently drift apart. Small tool for anyone juggling Claude Code alongside other agents.

agents-mdconfigsymlinksinterop
by snapsynapse Aug 21, 2026 6/10
app GitHub

CodeReentry: macOS Cockpit for Finding and Resuming AI Coding Sessions

A local-first macOS app for picking up where you left off across AI coding tools. It finds past sessions, keeps per-project memory, and resumes work in whichever tool the project belongs to. Aimed at the context loss that happens between one day and the next.

macossessionsmemoryresumelocal-first
by roooooly Aug 21, 2026 6/10
app GitHub

termish: Mosh-First Mobile SSH Terminal for Driving Claude Code From a Phone

An MIT-licensed Android, iOS, and desktop terminal built on Mosh with a pure-Kotlin terminal emulator, so sessions survive WiFi roaming and network drops. Positioned as the pocket entry point to TUI agents like Claude Code and Codex running on your own machines.

mobilesshmoshterminalkotlin
by icelum Aug 21, 2026 5/10
app GitHub

drift-detector-scan: Find Dying Third-Party API Integrations Down to file:line

A deterministic plus AI-aided scanner that flags integrations at risk from retiring vendor APIs, CVEs, and EOL dependencies, reporting the exact file and line. Notably it also states where it is blind rather than presenting a clean bill of health it cannot back up.

scannerdependenciesapieolmaintenance
by TOPSinfo Aug 21, 2026 5/10
app GitHub

agentcarto: One Searchable TUI for Sessions Across Claude Code, Codex, and Grok

A terminal UI that pulls the local session history of Claude Code, Codex, Grok, and GitHub Copilot Chat into one place to browse, search, resume, and fork. Solves the problem that each agent stores its history in its own format in its own directory.

tuisessionssearchmulti-agentresume
by agentcarto Aug 21, 2026 7/10
app GitHub

prompt-contribution-graph: A Contribution Graph for Your Daily Prompts

Tracks daily prompt activity across CLI coding agents and renders it as a contribution graph. Lightweight and mostly for fun, though it gives an honest picture of how much of your work actually flows through an agent.

statspromptsvisualizationcli
by chintan-diwakar Aug 21, 2026 5/10
app GitHub

PocketTUI: Your Computer Terminal on Your Phone

Puts your machine terminal on your phone, giving you a way to check on or drive a long-running Claude Code session while away from the desk. Minimal scope by design.

mobileterminalremotetui
by saidwivedi Aug 21, 2026 5/10
app GitHub

agentic-sandbox: Self-Hosted KVM-Isolated Runtime for Autonomous Coding Agents

A self-hostable runtime for persistent autonomous coding agents, isolating each in a KVM virtual machine or rootless container. Includes an A2A-protocol executor with signed AgentCard discovery, AIWG mission dispatch, a web dashboard, and virtiofs shared storage. Runs entirely on your hardware with no hosted control plane.

sandboxkvmautonomousself-hosteda2a
by jmagly Aug 21, 2026 7/10
app GitHub

caprock: Mission Control for Claude Code With Loop Detection

A local mission control for Claude Code sessions: live activity, cost and token burn, verified multi-agent tasks, and loop detection to catch a session spinning on the same failing edit. Run, observe, and orchestrate from one place.

dashboardmonitoringtokensmulti-agentlocal
by dspv Aug 21, 2026 7/10
app GitHub

boost: Token Savings and Context Maximization From JFrog

JFrog open-sourced a tool for saving tokens and maximizing usable context safely. Worth attention mainly because it comes from an established tooling vendor rather than a weekend project, so the context-trimming heuristics are likely to be conservative.

tokenscontextjfrogoptimization
by jfrog Aug 21, 2026 6/10
app GitHub

podium: Agentic Dev Environment With Cross-Harness Subagents

An agentic development environment with built-in cross-harness subagents and agent-to-agent communication, running on desktop, mobile, and VPS. Cross-harness means a subagent need not be the same model or CLI as its parent.

adesubagentsmulti-harnessmobilevps
by madeinorbit Aug 21, 2026 6/10
app GitHub

agentclaim: File Ownership So Parallel Agents Stop Overwriting Each Other

Adds file-level ownership claims for multiple AI coding agents working in a single git working tree, so two agents cannot silently overwrite each other edits. Zero dependencies. A lighter alternative to giving every agent its own worktree.

parallel-agentslockinggitcoordinationzero-deps
by volkangunay Aug 21, 2026 7/10
app GitHub

seo-miner: Claude Code SEO Plugin With Local SQLite Brain and Dashboard

A Claude Code plugin that measures where you rank in both search results and AI answers, identifies what to fix, and carries the change through to actual code edits. Backed by a local SQLite store and a dashboard, and works without an API key. Documentation is in Korean.

pluginseosqlitedashboardkorean
by seanjr2847 Aug 21, 2026 6/10
app GitHub

Baton: View and Drive Claude Code and Codex Sessions From Anywhere

Serverless remote access to your Claude Code and Codex sessions, built on AWS. Lets you check in on and interact with a running session from any device without leaving a machine exposed to the internet.

remotesessionsawsserverlessmobile
by zhu-xiaowei Aug 21, 2026 6/10
app GitHub

sakusen: An AI Harness You Actually Pilot

A coding harness built around keeping the human in the driving seat rather than dispatching work and hoping. Worth a look if the fully autonomous loop has burned you and you want tighter turn-by-turn control.

harnesscontrolinteractiveagent
by Bakaface Aug 21, 2026 5/10
app GitHub

falcondeck: Open-Source Control Plane for Codex and Claude Coding Agents

An open-source control plane for organizations running coding agents at scale, starting with Codex and Claude across Mac, web, and iOS. Positions agent fleets as infrastructure to be operated rather than terminals to be babysat.

control-planeopen-sourcemulti-agentiosfleet
by jamesblackwell Aug 21, 2026 6/10
app GitHub

cerebro-inevita: Local-First Business Second Brain for the Agent You Already Use

An open-source company brain that runs inside whichever AI agent you already use — Claude Code, Codex, Gemini CLI, or Antigravity — keeping business context local to your machine instead of uploading it to a SaaS knowledge base. Documentation is in Portuguese.

knowledge-baselocal-firstbusinessportugueseopen-source
by gabrielzucco Aug 21, 2026 6/10
app GitHub

anyagent: Run Claude Code, Codex, or Droid Against Any Model Endpoint

One command to run Claude Code, Codex, OpenCode, Droid, Pi, and others against OpenRouter, DeepSeek, Groq, Ollama, or any OpenAI- or Anthropic-compatible endpoint. Useful for evaluating how much of a harness quality comes from the harness versus the model behind it.

climodelsopenrouterollamamulti-agent
by waspdev95 Aug 21, 2026 7/10
app GitHub

StaffordAI: Manage a Team of Claude Code Agents Like Colleagues

A desktop app for running a team of Claude Code agents using a hiring metaphor: hire an agent, assign it a project, watch its work, and pick up where you left off. The persistent per-agent context is the substance behind the framing.

desktopmulti-agentteamorchestrationsessions
by BENZOOgataga Aug 21, 2026 6/10
app GitHub

pai-anywhere: Hardened VPS Host for Daniel Miessler Personal AI Infrastructure

A paste-installable, hardened deployment of Daniel Miessler Personal AI Infrastructure on a Linux VPS, with private Tailscale-only access, an isolated pai system account, and Pulse plus gateway components. One PAI instance reachable from every device without exposing it publicly.

paivpstailscaleself-hostedsecurity
by gl0bal01 Aug 21, 2026 6/10
app GitHub

pomo: Floating flowtime timer for macOS with a Claude Code API

A local-only, free floating pomodoro/flowtime timer for macOS that exposes a Claude Code-friendly API. That means an agent session can start, stop, or query your focus timer as part of a workflow. Small utility, but a neat demonstration of giving a desktop app an agent-callable surface.

appmacospomodoroproductivitylocal-first
by imutaroh Aug 21, 2026 5/10
app GitHub

tracewood: Turn AI coding agent telemetry into a 3D forest

A local-first app that reads your AI coding agent telemetry and renders it as a generative 3D forest that grows with your usage. Sessions, tokens, and activity become trees and terrain rather than a bar chart. Purely a visualization toy, but a memorable way to see your own agent usage patterns.

appvisualizationtelemetry3dlocal-first
by harishkotra Aug 21, 2026 6/10
app Reddit

groupchatty: Share Claude Code sessions with others in realtime

A web app that lets you share a live Claude Code session with friends or coworkers so several people can watch and collaborate on the same run. It is bring-your-own-Claude, so there is no per-seat cost and the author serves it free. Useful for pairing, teaching, or reviewing an agent run as it happens.

appcollaborationrealtimesession-sharingpairing
by CurryKid Aug 21, 2026 6/10
app GitHub

tlive: Self-hosted remote approvals and live monitoring for Claude Code

A self-hosted service that streams your Claude Code or Codex sessions to Telegram, Feishu, or a web terminal and lets you approve tool calls remotely. You can keep long unattended runs moving without sitting at the machine that started them. Works with either a subscription login or an API key.

appmonitoringapprovalstelegramself-hostedremote
by y49 Aug 21, 2026 8/10
app GitHub

codex-cc-proxy: Run Claude Code against ChatGPT-subscription models

A proxy that speaks the Anthropic Messages API on the front and the OpenAI Responses API on the back, letting Claude Code drive models served through a ChatGPT subscription. It is an adapter layer, so the CLI you already use stays unchanged. Relevant if you want to reuse Claude Code tooling against a different model provider.

appproxyapiinteropopenaimessages-api
by husniadil Aug 21, 2026 7/10
app GitHub

claude-code-search: Search through your Claude Code history

A tool for searching across your past Claude Code sessions instead of scrolling transcripts by hand. It indexes your local history so you can find the conversation where you solved something before. Simple but fills a real gap for anyone with months of accumulated sessions.

appsearchhistorysessionslocal
by mblode Aug 21, 2026 7/10
app GitHub

EvoTrace: Compile agent trajectories into verified training assets

A project that turns real Claude Code and Codex session trajectories into verified, tradable post-training assets. The pitch is that everyday agent runs are latent training data if you can validate and package them. Early and speculative, but an unusual angle on what session logs are worth.

apptrajectoriestraining-datapost-trainingtelemetry
by jinzijian Aug 21, 2026 5/10
app Reddit

PDFTrail: macOS PDF table extractor built with Claude Code

A macOS app for pulling tables and other structured content out of PDFs, built over three months of iteration with Claude Code. The author works in finance and wrote it after commercial OCR tools mangled financial tables. The Reddit writeup also covers the model and agent workflow used to build it.

appmacospdfextractionfinancebuilt-with-claude
by SuperHornetFA18 Aug 21, 2026 5/10
app GitHub

openpaw: Mobile Control Plane for Terminal Coding Agents

A local-first, open-source mobile interface for terminal-based coding agents like Claude Code, Codex and OpenCode. It gives you a real terminal backed by durable tmux sessions, so agents keep running when you close the app. Approvals are risk-gated, letting you sign off on sensitive actions from your phone while everything stays on machines you own.

mobiletmuxremote-controllocal-firstapprovals
by danielchen26 Aug 21, 2026 8/10
app GitHub

live-voice-agent: Voice Bridge with Wake Word and Barge-In for Coding Agents

A voice bridge that adds session-safe TTS and STT to terminal coding agents, with wake-word activation and barge-in so you can interrupt the agent mid-speech. Harness adapters are modular, so it is not tied to a single CLI. The session-safe framing matters — it aims not to corrupt the agent's stdin/stdout while piping audio alongside it.

voicettssttwake-wordaccessibility
by davidjdseo Aug 21, 2026 7/10
app Reddit

Zeus: Native macOS Command Center for Claude Code and Other Agents

An open-source macOS app that gives every coding agent its own live terminal and shows each one's state in a sidebar, so you can tell at a glance which is working, waiting on input, or done. It supports isolated git worktrees for parallel agents, remote agents over SSH, persistent sessions that survive closing the app, and MCP so one agent can spawn others. Written in Rust and GPUI; very early at v0.0.1.

macosmulti-agentworktreerustsession-manager
by Big-Debate2800 Aug 21, 2026 8/10
app Reddit

Claude of Tanks: Multiplayer Three.js Tank Game With 100+ Vehicles

A browser multiplayer tank game built with Claude Code across a long-running multi-agent pipeline, inspired by World of Tanks Blitz. It has 100+ procedurally generated vehicles across 16 maps, with detailed armor zones, internal modules, crew positions, physics-driven destruction and private/LAN lobbies. Worth a look as evidence of what sustained agent-directed development produces at scale.

gamethreejsmultiplayershowcasemulti-agent
by BasedKetsu Aug 21, 2026 7/10
app GitHub

claude-kiss: Minimal, Lean-Tooling Launcher for Claude Code

A launcher for Claude Code built on a keep-it-simple premise: a lean tool set, concise prompts, and no vendor-injected noise in the context window. The pitch is that stripping back what gets loaded into every session improves both durability of output and token cost. Worth comparing against your own CLAUDE.md and plugin sprawl.

launcherminimalismpromptstoken-efficiency
by aphoristicartist Aug 21, 2026 5/10
app GitHub

ai-agent-sandbox: Rootless Podman/Docker Sandboxes for Autonomous Agents

Runs autonomous coding agents — Claude Code, Aider, Hermes Agent — inside rootless Podman or Docker containers so they cannot reach your host filesystem. Rootless matters here: a container escape does not hand over root on the host. A reasonable option if you want to run agents in permissive/YOLO mode without giving them your whole machine.

sandboxpodmandockersecurityisolation
by MiGoller Aug 21, 2026 8/10
app GitHub

hpc-session: SLURM Cluster Access for Agents in Non-Interactive Shells

Opens a single authenticated SSH window onto a SLURM cluster and keeps it alive via connection multiplexing, with optional VPN and TOTP two-factor support. Jobs can be submitted, watched and fetched through it. The key detail is that it works from shells with no terminal, which is exactly the situation a coding agent runs in.

hpcslurmsshresearch-computingautomation
by HolobiomicsLab Aug 21, 2026 6/10
app GitHub

quotabar: Menu-Bar and CLI Quota Monitor for Codex, Claude Code and Gemini

Shows how much of your AI coding CLI quota is left without opening a session to find out. It runs as a native macOS menu-bar app, or as a cross-platform quotabar command on Linux. Covers Codex, Claude Code and Gemini in one place, which is handy if you rotate between plans as limits run down.

quotarate-limitsmacosmenu-barmonitoring
by bebepewpew Aug 21, 2026 7/10
app GitHub

Desk154: ESP32 Desk Gadget Showing Coding-Plan Quotas With Voice Input

A small 1.54-inch ESP32 desk display that surfaces your coding plan quota so you stop alt-tabbing to check it, plus voice input piped into Cursor. There is a live demo on GitHub Pages. Hardware side-projects around agent tooling are rare enough to be worth noting, even if the integration targets Cursor rather than Claude Code.

hardwareesp32quotavoiceambient-display
by DrDavidDa Aug 21, 2026 5/10
app GitHub

ai-memory-reader: Native macOS Viewer for Agent Memory and Session Logs

A native macOS app for browsing and tracking AI agent memory files, session logs and project transcripts. Reading these as raw JSONL is painful once you have any volume; this gives them a fast interface. Useful for auditing what an agent actually did across a long session or figuring out where its memory went wrong.

memorylogsmacostranscriptsdebugging
by Reviewfamilytetranychidae774 Aug 21, 2026 6/10
app GitHub

proxypal: Use Your AI Subscriptions With Any Coding Tool

A desktop app wrapping CLIProxyAPI so Claude, ChatGPT, Gemini, and Copilot subscriptions can drive any coding tool. Provides a UI for managing connections and tracking usage across providers.

proxysubscriptionsdesktopusage
by heyhuynhgiabuu Aug 20, 2026 6/10
app GitHub

hy: Local-First Harness Multiplexer for Claude Code and Codex

Multiplexes Claude Code and Codex sessions behind one local-first interface, with a durable event log and a web UI. The event log means you can reconstruct what any session actually did rather than scrolling terminal history.

multiplexerevent-logweb-uicodex
by asiraky Aug 20, 2026 6/10
app GitHub

One Switch: Local Failover Gateway for Claude Code and Codex

A local API gateway that centralizes multiple AI providers, models, and keys behind one endpoint, so tools are configured once. On upstream network errors, timeouts, rate limits, or auth failures it automatically fails over to the next channel by priority.

gatewayfailoverproxyproviders
by yinxulai Aug 20, 2026 6/10
app GitHub

dsh-agent-plugins-market: Plugin Marketplace With a Web GUI

A marketplace that installs and injects agent plugins — skills, MCP servers, hooks, and slash commands — into Claude Code, Codex, or Cursor from git marketplace repos. Includes a web GUI market page for browsing what is available.

marketplacepluginsmcphooks
by Sivan757 Aug 20, 2026 5/10
app GitHub

Zetrem: Desktop App for Running a Team of Claude Code Agents

Gives Claude Code a screen — a desktop application for launching and supervising a team of agents working in parallel. For people who have outgrown a grid of terminal tabs.

desktopmulti-agentorchestrationgui
by rayforvideos Aug 20, 2026 6/10
app GitHub

ai-usage-monitor: Menu Bar App for Claude and ChatGPT Limits

An unofficial macOS menu bar app that surfaces your current Claude and ChatGPT usage limits at a glance. Small, but it removes a question people otherwise answer by hitting the wall.

usagelimitsmacosmenu-bar
by stavrop Aug 20, 2026 5/10
app Reddit

AngKorGit: A 12 MB Git Client Built With Claude Code Over Three Weeks

A free MIT-licensed Git client for macOS, Windows, and Linux in Rust and Tauri, now at v0.6.2. The author credits two things: a large CLAUDE.md documenting architecture and every hard-won libgit2 gotcha, and 36 integration tests against real temp repos that decide what survives.

gittaurirustclaude-mdtesting
by chansocheat Aug 20, 2026 6/10
app GitHub

repo-steward: Autonomous Agent for Open-Source Repository Management

Triages incoming issues, reviews PRs across multiple iterations, watches your sites, and escalates only the decisions that genuinely need a human. Aimed at maintainers drowning in the mechanical half of repo upkeep.

maintenancetriagecode-reviewautonomous
by AlexsJones Aug 20, 2026 7/10
app GitHub

awsl: Durable Local Runtime for Claude Code Workflow Scripts

Runs Claude Code Workflow JS locally with resume, checkpoints, token budgets, and git worktree isolation. Codex-verified and Claude-compatible, so long orchestrations survive interruption instead of restarting from zero.

workflowruntimecheckpointsworktreesbudgets
by XhinLiang Aug 20, 2026 7/10
app GitHub

agent-mux: A TUI for Multiplexing Agent Sessions in tmux

A terminal UI that manages multiple agent sessions inside tmux. Keyboard-driven and lightweight, for people who want parallel agents without leaving the terminal.

tmuxtuimultiplexingsessions
by leonardcser Aug 20, 2026 6/10
app Reddit

MARGINAL: Open-Source Runtime Governor for AI Coding Agents

Observes agent behaviour — repeated actions, context burn, retries that produce no progress — records evidence, and only earns the right to intervene once it has enough proof. Supports tool enforcement on Codex and observation mode for Claude Code, OpenCode, and PrivacyCode. Contributors wanted.

governanceobservabilityopen-sourcetokens
by Positive-Captain-709 Aug 20, 2026 6/10
app Reddit

claude-scope: Search Your Entire Session History, Including Mid-Session

Claude Code writes every conversation to .jsonl under ~/.claude/projects but gives you no way to search them. claude-scope syncs incrementally per file by byte offset on every query, so a message from a minute ago in your current session is already searchable, and results include the session ID for claude --resume. The author notes a subtle bug most indexers miss: messages typed while Claude is working are logged as attachment lines, not user lines.

searchsessionshistorypluginjsonl
by OkLengthiness3801 Aug 20, 2026 7/10
app GitHub

zashiki: Orchestration Cockpit for Claude Code Sessions

Visualizes every running Claude Code session on a single screen so you can see which agent is working, waiting, or stuck without cycling through terminals.

cockpitsessionsmonitoringorchestration
by kounetsuman Aug 20, 2026 6/10
app GitHub

GoZen: Multi-CLI Environment Switcher With Proxy Failover

Switches environments across Claude Code, Codex, and OpenCode, with API proxy auto-failover when an upstream goes down. One config surface instead of three sets of environment variables.

switcherproxyfailovercli
by dopejs Aug 20, 2026 5/10
app GitHub

claude-window-timing: Keep Your 5-Hour Windows Rolling

Starts a usage window before you sit down so you are never waiting on one, and with multiple subscriptions spaces them evenly and tells you which to spend next. Scheduling as an answer to rate limits.

usagelimitsschedulingwindows
by ariel42 Aug 20, 2026 5/10
app GitHub

companion: A macOS Pair-Programming Panel Driven by Claude Code

A side panel that answers questions about the repo you are working through, deliberately sized so it does not push your pairs view off screen. Driven by the Claude Code or Codex CLI underneath.

macospair-programmingpanelcli
by SouhaibBenFarhat Aug 20, 2026 5/10
app GitHub

ensemblr: macOS Orchestrator Where Agents Can Drive the App Itself

Each stream of work gets its own git worktree, and an agent can operate the orchestrator itself — spawning sub-agents, delegating, and integrating results. Supports Pi and Claude Code.

orchestratorworktreesmacossubagents
by ensemblr-hq Aug 20, 2026 6/10
app GitHub

Notch-hub: Live Agent Status in Your MacBook Notch

A macOS menu-bar app that turns the notch into a live dashboard for system stats, battery, media, calendar, clipboard, focus, and AI coding-agent status. Built with Claude Code.

macosdashboardnotchstatus
by Srimi1 Aug 20, 2026 5/10
app GitHub

session-migrate: Move Native Sessions Between Seven Agent CLIs

Migrates native session files across Claude Code, Codex, Pi, OpenCode, Copilot CLI, Antigravity, and Cursor Agent. Lets you switch tools mid-task without abandoning the conversation you already built.

sessionsmigrationcross-toolportability
by xhluca Aug 20, 2026 7/10
app GitHub

ego-lite: A Browser That Shares Your Logged-In State With Agents

A fast browser for agent automation that hands your existing logged-in session to Codex or Claude Code without taking over the browser you are using. Zero cost, zero config, which is the pitch against heavier automation stacks.

browserautomationauthcdp
by citrolabs Aug 20, 2026 6/10
app GitHub

tmux-hub: A Control Panel Over Local and Remote tmux Servers

Orchestrates many Claude Code sessions across both local and remote tmux servers from one panel. Useful when your agents are spread across a laptop and a couple of boxes.

tmuxremoteorchestrationsessions
by DawnBreather Aug 20, 2026 6/10
app GitHub

Graph_Keeper: Grounded, Auditable, Git-Backed Memory for Agents

Agent memory stored in git, where each remembered fact is grounded in a source and the history of what changed is auditable. Git as the substrate means no separate database to run or trust.

memorygitauditgrounding
by anusbutt Aug 20, 2026 5/10
app GitHub

GoDrop: A File Drop Box for Coding Agents

Upload a file, get a hard-to-guess URL — so an agent can put a screenshot into a pull request, which GitHub has no API for. One Go binary, no database, files on your own disk.

file-sharinggoscreenshotsgithub
by fatihbaltaci Aug 20, 2026 6/10
app GitHub

reread: 96% of Your Claude Code Tokens Are Re-Reads

An analysis and tool showing where Claude Code tokens actually go, with the headline finding that the overwhelming majority are files being read again. Worth checking against your own transcripts before you start optimizing anything else.

tokensanalysiscontextoptimization
by KaramelliS Aug 20, 2026 6/10
app GitHub

kekkai: A Configurable Sandbox for Claude Code

A sandbox for Claude Code where the boundaries are yours to configure, rather than accepting whatever the default permission model allows.

sandboxsecurityisolationpermissions
by filidorwiese Aug 20, 2026 6/10
app GitHub

vibepulse: A Shelf-Top AMOLED Screen for Agent Status

An ESP32-S3 display showing Claude Code and Codex usage, live agent activity, and a NEEDS YOU alert when an agent is blocked waiting on you. Backed by a pure-stdlib Mac service, with nothing leaving your LAN.

hardwareesp32statusnotifications
by niclasvestlund-YT Aug 20, 2026 5/10
app GitHub

artel: A Shared Notepad Your Whole Agent Fleet Learns From

You and every agent you run write into one pad, and a note written once resurfaces the moment it is relevant. A background archivist merges, connects, and retires notes so the pad improves without curation. What one agent learns at 3am, the rest know by morning. Self-hosted, MIT.

memoryfleetnotesself-hosted
by NicolasPrimeau Aug 20, 2026 6/10
app GitHub

claude-auto: Wait Out the Usage Limit and Resume Automatically

Auto-continue for Claude Code — when you hit a usage limit it waits for the reset and picks the session back up on its own. For long unattended runs that would otherwise stop dead at 3am.

usagelimitsautomationresume
by Darkblader24 Aug 20, 2026 6/10
app GitHub

pairroom: A Local Collaboration Room for You, Claude Code, and Codex

A shared local room where you and both agents work together, while each keeps its own official harness rather than being wrapped or emulated. Preserving the native harnesses is the design constraint here.

collaborationcodexlocalmulti-agent
by sean2077 Aug 20, 2026 5/10
app GitHub

agent-trajectory: One Live Terminal Feed for Four Agent CLIs

Watch tool calls, model responses, token counts, and context usage across Claude Code, Codex, DeepSeek Harness, and Hermes in a single live terminal feed. Useful for spotting an agent that has gone off the rails before it burns the window.

monitoringobservabilitytokensterminal
by shaswatco Aug 20, 2026 6/10
app GitHub

traceshield: A 500-Line Audit Trail and Policy Layer for Agents

Lightweight audit trail and policy enforcement for AI agents, pitched explicitly as a 500-line alternative to Microsofts Agent Governance Toolkit. Small enough to read end to end before trusting it.

auditpolicygovernancelightweight
by cdzzy Aug 20, 2026 5/10
app GitHub

terminal-manager: Reclaim RAM From Idle Claude Code Sessions

A macOS menu bar app that finds running Claude Code and Grok Build sessions, pauses them, and frees their memory — without losing the resume id, so you can pick them back up. For laptops running more sessions than RAM.

macosmemorysessionsresume
by ProximoBinks Aug 20, 2026 5/10
app GitHub

harken: Fully Offline Audio Transcription for Claude Code

Batch local transcription for Claude Code and any other agent, with no API key and nothing leaving the machine. For turning recordings into text the agent can work with when you would rather not upload them.

transcriptionaudioofflinelocal
by montezuma-p Aug 20, 2026 6/10
app GitHub

agent-vigil: Fail-Closed Evidence Receipts for Agent Sessions

Produces evidence receipts for Claude Code and Codex sessions that fail closed when evidence is missing, and does it without an LLM judge grading its own homework. Deterministic verification rather than a second models opinion.

verificationevidenceauditdeterministic
by sulmusic2-star Aug 20, 2026 5/10
app GitHub

cockpit: Run Many Claude Code Agents in One Keyboard-Driven Table

A terminal UI where each agent gets its own git worktree, cmux workspace, GitHub PR, and Linear/Jira/Trello ticket, all visible in one live table. Wires the agent fleet into the tracking systems the work actually lives in.

tuiworktreesgithubjirafleet
by khivi Aug 20, 2026 7/10
app GitHub

elnora-slack: The Entire Slack Web API as a CLI, Plus a Send Gate

201 Slack Web API methods across 29 groups exposed as a CLI, with agent skills wrapping them and a draft-and-approve gate before anything is actually sent. The approval gate is the right call for a tool that can post to your team.

slackcliskillsapproval-gate
by Elnora-AI Aug 20, 2026 6/10
app GitHub

palimorph: Point Claude Code at Any NVIDIA NIM Model

Launches Claude Code against a NIM model through a per-run loopback proxy that translates the Anthropic Messages API to NIMs OpenAI-compatible API — streaming, tools, and images included — and exits with the process. No lingering daemon.

proxynvidianimapi-translation
by ahmetatar Aug 20, 2026 6/10
app GitHub

leads-kit: Contact-Form Enquiries in Workers KV With a Claude Code Plugin

Stores contact-form enquiries in Cloudflare Workers KV and reads them back safely behind Cloudflare Access, with audited deletes and CSV/JSON/Mailchimp/Klaviyo exports. Ships as a framework-free npm package plus a Claude Code plugin.

cloudflareworkerspluginleads
by nurkamol Aug 20, 2026 5/10
app GitHub

UnslopMyCode: 64 Checks for What Your AI Coding Tool Left Behind

Finds production failures agents commonly leave — hardcoded secrets, missing RLS policies, IDOR, runaway cost, hallucinated dependencies, and general AI rot — across 64 checks, then fixes the ones that are safe to fix automatically. A Claude Code plugin.

securitycode-qualityrlsidorplugin
by RuslanAMandell Aug 20, 2026 7/10
app GitHub

debrief: Voice Recordings to Repo-Aware Briefs and GitHub Issues

Turns Plaud voice recordings of client meetings and brainstorms into briefs that understand your repository, then files them as conventional GitHub issues. Closes the gap between a conversation and a tracked task.

voicemeetingsgithubissues
by brett-buskirk Aug 20, 2026 5/10
app GitHub

mex: Project Memory With a Drift Detection CLI

Persistent project memory for coding agents built on a structured scaffold, paired with a CLI that detects when the memory has drifted from the actual state of the code.

memorydriftcliproject
by mex-memory Aug 20, 2026 5/10
app Reddit

Plannotator: Annotate Agent Plans and Questions in a Browser UI

Plannotator opens the last agent message in a browser UI where you can mark up individual questions and answers, then send the annotations straight back to the agent. The Reddit report pairs it with Matt Pocock's batch-mode Grill Me via a /plannotator-last command. More granular than a questionnaire component because you annotate parts of each question.

plannotatoruireviewgrill-me
by backnotprop Aug 20, 2026 6/10
app GitHub

argus: Local Desktop App That Finds and Fixes Wasted Agent Work

A free, local desktop app that surfaces where agent runs burned effort without producing results. Notably it targets business tasks rather than code, and reads sessions from Claude Cowork, Chat, and Code plus ChatGPT Work and Codex.

monitoringdesktopanalyticslocal-first
by Agent-Deployment-Co Aug 20, 2026 6/10
app GitHub

DecayWatch: Baseline Success Rates and Alert on Long-Run Agent Decay

A capability-decay sentinel that establishes baseline success rates per capability category, then warns when a long-running agent starts degrading mid-run. Useful for unattended sessions where quality drifts silently instead of failing outright. Documentation is in Chinese.

monitoringreliabilitylong-runningalerting
by SuperMarioYL Aug 20, 2026 5/10
app Reddit

TrueForge: Open-Source Agent Runtime Focused on Context Management

An open-source agent runtime benchmarked against Claude Managed Agents on 14 cross-system tasks with the same model and three MCP services. Both solved 11 of 14, but TrueForge used 3.7M tokens versus 10M by offloading large tool outputs behind references and compacting old events. The author is candid that compaction is lossy and the runtime lacks tracing and sandboxing.

agent-runtimecontext-managementbenchmarktokens
by Traditional_Pain5032 Aug 20, 2026 6/10
app GitHub

claude-for-poor-folks: Live Cost, Token, and Quota Meter for Claude Code

A zero-dependency local meter showing live cost, token, and quota use, with a budget gate, a burn-rate alarm for runaway loops, and a prompt-cache leak detector. Adds no text to the conversation, so it does not consume the context it measures.

tokenscostmonitoringbudget
by thanhpt1110 Aug 20, 2026 7/10
app Reddit

Agent Status on Your Keyboard RGB F-Row, One Key Summons the Waiting Agent

A Windows tray app that mirrors each agent session to a lane on your keyboard F-row via hooks: pulsing means waiting on you, green done, red broken. Pressing a lane key brings that agent window forward. Deliberately read-only — every hook reply is empty and a test asserts the hook binary cannot print a byte. Rust, MIT, works with Claude Code and Codex on native Windows and WSL.

hookswindowsmulti-agentrust
by timetoy Aug 20, 2026 7/10
app GitHub

token-usage: Cross-Harness Token Store Syncing Claude Code, Codex, and Grok

A Rust API and store that collects token usage from multiple coding agents through per-harness plugins, covering Claude Code, Codex, Grok, and Hermes. Useful if you split work across tools and want one number instead of several dashboards.

tokensrustanalyticsmulti-harness
by mintychochip Aug 20, 2026 5/10
app GitHub

switchboard: Windows Tray App to Switch AI CLI Accounts and Track Quota

Answers which AI account a machine is currently using. Register multiple subscription accounts per AI CLI, switch in two clicks, see remaining quota per account, install and update tools through vendor mechanisms, and catch billing traps. Manages accounts only and never runs tasks.

windowsaccountsquotatray-app
by barrycarrjr Aug 20, 2026 6/10
app GitHub

apra-fleet: AI Agents That Write Code, Review Each Other, and Coordinate

A fleet system where agents write code, review one another's work, and coordinate across multiple machines. Peer review between agents is the distinguishing feature versus a single agent looping on its own output.

multi-agentcode-reviewfleetdistributed
by Apra-Labs Aug 20, 2026 5/10
app GitHub

portage: Self-Hosted Gateway to Run Any Model in Claude Code and Codex CLI

A single-binary self-hosted gateway that keeps the harness and swaps the model, translating between Anthropic Messages, OpenAI Responses, and Chat Completions. Lets Claude Code and Codex CLI drive open-weight, self-hosted, or relay-provided models.

gatewayproxymodel-routingself-hosted
by SimonGino Aug 20, 2026 7/10
app Reddit

bubbleclaude: Run Claude Code in a Sandbox Where Your Secrets Don't Exist

A single bash script that launches Claude Code inside a bubblewrap namespace on an allowlist model, so your home directory and credentials are absent rather than merely denied. Uses --clearenv to drop GITHUB_TOKEN, AWS_*, and SSH_AUTH_SOCK, binds settings.json read-only at both user and managed-settings precedence so a session can't rewrite its own security config, and makes only the launch directory writable. Built for people who want YOLO mode without approving every tool call.

sandboxsecuritybubblewrappermissions
by xinouch Aug 19, 2026 8/10
app Reddit

Native macOS App for Scheduled, Event-Triggered Unattended Claude Agents

A native Mac app that runs Claude unattended on schedules and on event triggers — a file landing in a watched folder, an incoming email, a text message, or a new RSS entry — through an agent event queue, with each agent scoped to its own key. SMTP notifications come back when something needs attention, and you can reply like a normal email to continue the conversation. Replaces a hand-run Java/Spring MCP server so agent work continues while away from the machine.

automationmacosschedulingunattended
by KlassyCoder Aug 19, 2026 7/10
app GitHub

claude-code-docker: Pinned Non-Root Image With Egress-Firewalled YOLO Mode

A Docker setup for Claude Code built on a pinned non-root image with persistent login across container runs. Adds an egress firewall so --dangerously-skip-permissions can be used without giving the agent unrestricted network access. Ships compose and CI examples for dropping it into an existing pipeline.

dockersandboxcisecurity
by agent37-platform Aug 19, 2026 7/10
app GitHub

backtalk: Talk to Your Claude Code Agent Out Loud, No API Keys

A push-to-talk voice interface for Claude Code — hold a key, speak, and the agent answers aloud about a second later with all its tools and its own personality intact. Both speech recognition and the voice run on free local models, so no cloud speech APIs or keys are involved.

voicelocal-modelsinterface
by jaredrhod Aug 19, 2026 8/10
app Reddit

Lattice: An Isometric Game Kit Designed for Agents

A game development kit for isometric games built to be driven by coding agents rather than hand-authored. Shared on r/ClaudeCode; the post itself is a bare link, so check the project for specifics.

gamedevisometrictoolkit
by Whole_Art_2446 Aug 19, 2026 5/10
app GitHub

agent-sync: One AGENTS.md Synced to Claude Code, Codex, Cursor, and More

Maintains a single AGENTS.md and syncs it out to Codex, Claude Code, Cursor, Copilot, Gemini, Windsurf, Aider, and others. Removes the drift that comes from hand-maintaining a separate instruction file per tool.

agents-mdclaude-mdsyncmulti-tool
by Blackwindow6 Aug 19, 2026 7/10
app GitHub

ClaudeTower: Statusline CLI Showing Model, Branch, Context, Cost, and Usage

A Claude Code statusline CLI displaying project location, model, git branch, context, cost, and usage rate, with Powerline separator support. Widgets can be toggled from within the Claude Code chat itself. Korean-language project; automatic account switching is not in the current release.

statuslineclimonitoring
by sodam-ai Aug 19, 2026 6/10
app GitHub

Ix: System Intelligence for Understanding Any Codebase

A codebase comprehension tool aimed at both humans and AI agents, surfacing system-level structure instead of raw files so you can orient in an unfamiliar repo quickly. The description stays high-level, so check the repo for how the analysis actually works.

codebasecomprehensioncontext
by ix-infrastructure Aug 19, 2026 5/10
app Reddit

TidyRun Cut Tool Output 14% but Raised Total Tokens on Codex

An open-source local layer that compresses deterministic tool output and safely reuses deterministic work. A real-agent benchmark on Codex showed -14.2% tool output at equal task success (10/10), but +12.4% input tokens and +39% wall time — less terminal noise without the expected savings. The author has Claude Code integration surfaces and is looking for people with noisy TypeScript or Python repos to run a paired study.

tokenstool-outputbenchmarkopen-source
by Dismal-Reveal-6898 Aug 19, 2026 6/10
app GitHub

machogs: Find the AI Tool Helpers Eating Your Mac's CPU

Explains in plain English why a Mac is slow, hot, and loud by naming the responsible processes. Specifically surfaces AI tool helper processes and stuck processes that accumulate during heavy agent use.

macosperformancediagnostics
by bnishit Aug 19, 2026 6/10
app GitHub

agent-fridge: Path Claims and Leases to Stop Agents Overwriting Each Other

Coordination for multiple AI coding agents working the same repo, using path claims, leases, and write-once notes. Generates a shared board readable from any terminal so each agent can see what is already claimed before it writes.

multi-agentcoordinationconcurrency
by RagnarPitla Aug 19, 2026 7/10
app GitHub

cordon: cgroup v2 and eBPF Resource Control at Tool-Call Granularity

Characterizes and caps CPU and memory for AI coding agents per individual tool call, built on cgroup v2 and eBPF. Shows which specific agent actions are expensive and bounds them before they saturate the machine.

resource-limitsebpflinuxobservability
by uncoalesced Aug 19, 2026 7/10
app GitHub

chamnan: Architecture Index Claude Code Reads Instead of Scanning Your Repo

Maintains an architecture index the agent consults in place of re-scanning a large codebase, plus work state that survives context compaction. Aimed at long-lived codebases where repeated exploration burns most of the context window.

contextarchitecturecompactionindexing
by ArcticFox2029 Aug 19, 2026 7/10
app GitHub

usage-telemetry-watchtower: Track Claude Code Spend, Context and Quota

A monitor for Claude Code usage that reports spend, context consumption and quota limits in one place. Aimed at people who want to see how much of their plan a session is burning before they hit a wall.

monitoringusagecosttelemetry
by NotGamerBlade1 Aug 19, 2026 6/10
app GitHub

winnow: Local-First CLI Output Compression for Claude Code and Codex

Compresses verbose command output before it reaches the agent's context, with zero LLM calls involved. Every original output stays on disk and remains searchable and recallable if the agent needs the full text later.

contextcompressionclitokens
by Farhanward Aug 19, 2026 7/10
app GitHub

codex-claude-bridge-feishu: Run Coding Agents From Feishu Group Chats

A Feishu bridge that runs coding agents locally rather than through a cloud relay. Supports group collaboration with per-group @ control, multi-turn sessions, streaming cards and cross-session memory across Grok, Claude and Codex.

feishubridgechatmulti-model
by opc8838-hub Aug 19, 2026 5/10
app GitHub

scholion: Cross-Check Genome, Labs and Wearables With a Local Claude Skill

A local engine that reads genome data, lab results, prescriptions and wearable data against each other to surface contradictions the individual silos never catch. Ships as a web UI, a CLI, a Claude skill and an Ouroboros plugin, with a source citation behind every answer.

healthlocal-firstskilldata
by CrossRead Aug 19, 2026 6/10
app GitHub

brasscoders: Deterministic Bug Scanner for AI-Written Code

A local-first CLI with 12 scanners built to catch the classes of bug that AI coding assistants routinely miss. Deterministic rather than model-based, so results are reproducible. Apache 2.0.

bug-scannerclicode-qualitylocal-first
by CopperSunDev Aug 19, 2026 7/10
app Reddit

Open-Source Self-Hosted Coding Agent Harness With AST-Aware Indexing

A self-hosted workspace for coding agents with a sub/child multi-agent architecture and an AST-aware ChromaDB indexer for fast file discovery. Includes a built-in UI with Git diff management.

harnessmulti-agentself-hostedindexing
by anchit_rana Aug 19, 2026 6/10
app GitHub

pi-claude-cross-session: Native Peer Messaging Between pi and Claude Code

Wires the pi agent into Claude Code's native peer protocol so the two can exchange messages with ListAgents/SendMessage. No daemon and no cloud relay — Claude reaches pi with nothing extra installed on its side.

multi-agentmessagingcross-sessionintegration
by utopia2077 Aug 19, 2026 6/10
app GitHub

AgentBabysitter: Steer Claude Code From Telegram While You're Away

Lets Claude Code keep working after you leave your desk and report to your phone over Telegram. Read task summaries, reply to steer it, check usage and send voice notes — all from one bash script.

telegramremotenotificationsbash
by Pranjalab Aug 19, 2026 7/10
app Reddit

Frontman: Give Coding Agents the Browser Context of Your Running Site

A visual agent for existing sites that supplies the browser and runtime context coding agents normally lack, instead of you pasting screenshots and selectors by hand. Recent releases improved grounding via server-side source maps for React Server Components and fixed packaged code search for Astro, Next.js and Vite.

browserfrontendcontextvisual
by Firm-Space3019 Aug 19, 2026 7/10
app GitHub

hearthvault: Tiered Markdown Memory Vault Claude Code Maintains Itself

An Obsidian vault the agent maintains as its memory, with hot/warm/cold tiers, size budgets, a weekly janitor pass and a typed-relation mini knowledge graph. No database and no embeddings — just markdown.

memoryobsidianmarkdownknowledge-graph
by BorisNikolic Aug 19, 2026 7/10
app GitHub

MacCL: Native macOS App for Claude Code With Local Ollama Support

A native macOS front end for the Claude Code CLI exposing its full agentic toolset — shell, file edits, search and sub-agents. Runs on Anthropic's models or a local Ollama LLM, including one hosted on another machine.

macosguiollamalocal-llm
by Trano89 Aug 19, 2026 7/10
app Reddit

Niri-Style Scrollable Tiling for Terminal Panes That Never Shrink

A horizontal canvas for terminal panes where windows sit side by side at full size instead of splitting into unreadable slivers. Built for workflows running several coding agents alongside dev servers and SSH shells.

terminaltilingworkflowopen-source
by x_xidev Aug 19, 2026 6/10
app GitHub

feishuchannel: Route Feishu Group Chats to Isolated Claude Code Instances

A Feishu/Lark plugin that lets a single bot fan out multiple group chats to separate, isolated Claude Code instances, managed by an auto-router. It adds access control, a persistent WebSocket connection, and automatic fallback to OpenCode when Claude is unavailable. Useful if your team already lives in Feishu and wants to drive coding agents from chat without one shared session.

feishularkchat-bridgeopencoderemote-control
by phxwang Aug 19, 2026 6/10
app GitHub

polyagent: Terminal Switchboard for Multiple Codex and Claude CLI Accounts

A terminal switchboard for running several Codex and Claude CLI accounts side by side, each with isolated credentials and its own persistent tmux session. Handoffs between agents are recorded so you can see what was passed where. Aimed at people juggling quota across accounts or mixing agents on one machine.

tmuxmulti-accountcodexsession-managerhandoff
by CryptoRALLY Aug 19, 2026 6/10
app GitHub

graph-context-for-claude-code: Obsidian /ide Integration With Graph Context

Connects Claude Code to Obsidian through the /ide integration, but sends far more than the raw note: embeds are inlined, wikilinks are summarized, and the heading path plus backlinks are included. The result is that the agent sees a note in the context of its graph neighborhood rather than in isolation. Handy for vault-driven work where the surrounding links carry the meaning.

obsidianide-integrationcontextbacklinksknowledge-base
by senna-lang Aug 19, 2026 7/10
app Reddit

AnySSH: Free Open-Source iOS and iPad SSH Terminal Built for Agent Sessions

A free, no-tracking SSH client for iPhone and iPad, built with Claude Code and aimed at driving coding agents from mobile. It includes voice mode, git change tracking, a file viewer, and support for tmux and other multiplexers, so a Claude Code session on a home machine can be reached over Tailscale from a phone. Source is on GitHub and the app is on the App Store.

iossshmobileremoteopen-source
by review0312 Aug 19, 2026 7/10
app GitHub

swe-marketplace: Plugin Marketplace Focused on Software Development

A Claude Code plugin marketplace that narrows its scope to software engineering work instead of trying to cover every domain. Installable through the standard plugin marketplace mechanism. Useful if you find the general-purpose marketplaces noisy and want a shorter list of dev-focused plugins.

marketplacepluginssoftware-development
by andisab Aug 19, 2026 6/10
app GitHub

Xuanji: Single-Binary Go Gateway Aggregating OpenAI and Anthropic Protocols

A lightweight Go AI gateway that speaks both the OpenAI and Anthropic protocols from one static binary, positioned as a smaller alternative to one-api, new-api, and LiteLLM. It handles automatic routing, load balancing, retries, and cost-priority routing with failover so a client stays up when one upstream degrades. Relevant if you point Claude Code at multiple providers and want a single endpoint in front of them.

gatewayproxyroutinggoanthropic-apiload-balancing
by icefairy Aug 19, 2026 6/10
app GitHub

CodeEraser: Duplication and Dead-Code Judgment With Claude Code Guard Hooks

A toolchain aimed squarely at the entropy LLM-assisted development creates — clone detection, duplication, dead code, and structural judgment — with a Haskell analysis core and a Rust frontend. It ships Claude Code guard hooks, an MCP interface, CI gates, and a Tauri GUI, so the same judgment can run interactively or block a merge. Notable for treating agent-generated sprawl as a first-class problem rather than a linting afterthought.

dead-codeduplicationhooksmcpcicode-quality
by skymanbp Aug 19, 2026 7/10
app GitHub

claude-notifier: VS Code Extension With Distinct Sounds for Done vs. Input

A small VS Code extension that plays one sound when Claude Code finishes a task and a different one when it is waiting on you. The two-tone distinction is the point — you can tell from across the room whether the run completed or stalled on a permission prompt. Minimal setup, no external service.

vscodenotificationsextensionaudio
by ashmitb95 Aug 19, 2026 5/10
app GitHub

holdlid: Keep a Mac Awake With the Lid Closed Only While an Agent Works

Prevents a MacBook from sleeping while Claude Code or Codex is running, including with the lid shut, then lets it sleep again as soon as the agent stops. The conditional behavior is what separates it from leaving caffeinate running — the machine is only held awake for the duration of actual agent work. One of several tools in this space; pick whichever matches your menu-bar preferences.

macossleeplong-runningutility
by kuanrur Aug 19, 2026 5/10
app GitHub

taskuary: Local-First Hub Routing Email, Slack, and Teams to Coding Agents

Pulls email, Teams, Slack messages, and reports into a single local timeline, runs AI triage over them, then dispatches the resulting work to coding agents like Claude Code, Codex, or Gemini — with you approving before anything lands. Everything runs locally rather than through a hosted service. An ambitious take on wiring a whole inbox into an agent loop.

task-managementtriagelocal-firstslackemailorchestration
by ldbumble Aug 19, 2026 7/10
app GitHub

CareerRat: Chat-First Agentic Job-Search Workspace for Your Own AI CLI

A job-search workspace built around the rate-apply-track loop: find roles, vet them, tailor materials, track applications, and prep for interviews, all driven from a chat interface backed by your own AI CLI. Bring-your-own-agent rather than a hosted service, so the search history stays local. Useful mainly as an example of a domain workspace built on top of a coding agent.

job-searchworkspacecliagentic
by CodesWhat Aug 19, 2026 5/10
app GitHub

Little-Claude: Unofficial Tauri Desktop Client on the SDK Control Protocol

An open-source desktop client for Claude Code built on Tauri 2 and React, talking to the agent over the SDK control protocol rather than scraping a terminal. Features include permission-approval cards, model switching, multi-tab sessions, and video analysis. One of the more complete GUI wrappers, though the docs are in Chinese.

desktopguitaurireactsdkclient
by qingyu321 Aug 19, 2026 8/10
app GitHub

GPT-VoiceCoding: Voice-Drive Claude Code and Codex Sessions via tmux

A local bridge that lets you run coding agents by voice through ChatGPT Live, controlling tmux to launch, close and coordinate Claude Code and Codex CLI sessions. It announces when a session stops and relays your spoken replies back into the terminal. Runs on a ChatGPT subscription with no API key, so it is a cheap way to supervise long agent runs hands-free.

voicetmuxcodexcliorchestration
by okqixiaobao727-design Aug 18, 2026 6/10
app Reddit

Simplify Claude: VS Code Extension That Plain-Englishes Session Summaries

A VS Code / Cursor extension that reads your local Claude Code session transcript and renders a short plain-English summary in a side panel: what you asked for, what changed, what to check, what is unfinished. Bring your own OpenAI or Anthropic key, stored in the OS keychain, with file contents stripped before sending and no middle server. Open source and on the marketplace.

vscodeextensionsummariestranscriptsopen-source
by Marium_noor Aug 18, 2026 6/10
app GitHub

moomux: tmux TUI for Running Coding Agents Across Git Worktrees

A Go TUI that manages one agent session per git worktree, so parallel Claude Code or Codex runs never fight over the same working tree. Each session is a tmux pane you jump into with a single keypress. Handy when you routinely branch several agent attempts off the same repo.

tuitmuxworktreesgoparallel-agents
by erickgnclvs Aug 18, 2026 7/10
app GitHub

Tokdash: Cross-Provider Dashboard for Agent Sessions and Quota Usage

A dashboard that visualizes coding-agent session history and quota consumption across providers, with heatmaps, token counting, cost tracking and quota reset timers. Aimed at people who want to see where their tokens actually went rather than just how close the limit is. Complements menu-bar meters with longer-range analytics.

dashboardtokensquotaanalyticsmonitoring
by JingbiaoMei Aug 18, 2026 6/10
app GitHub

ration: Native SwiftUI Menu Bar Meter for Claude Code and Codex Usage

A macOS menu bar app showing live plan limits, an activity calendar and token metrics for both Claude Code and Codex in one place. Written in native SwiftUI with no telemetry. Pick this over the other quota meters if you want the activity-calendar view alongside the current-window gauge.

macosmenu-barswiftuiquotamonitoring
by mcpeixoto Aug 18, 2026 6/10
app GitHub

ccclub: Compare Your Claude Code Usage with Friends

A group-based usage tracker: create a club, share a join code, and see how much Claude Code everyone is burning through. It turns quota monitoring into a shared leaderboard rather than a solo gauge. Mostly for fun, though useful for teams gauging relative consumption.

usagesocialleaderboardquotateams
by mazzzystar Aug 18, 2026 5/10
app GitHub

whalex: Claude Code-Style Desktop Agent Running on Your DeepSeek Key

An open-source coding-agent desktop app that brings Claude Code-class workflows and multi-agent fleets to a bring-your-own DeepSeek API key, which the author pitches at roughly 1/50th the cost. Worth a look if you want the agent workflow shape but need a cheaper model backend.

desktop-appdeepseekmulti-agentopen-sourcecost
by leejoong Aug 18, 2026 6/10
app Reddit

tart: Persistent Terminal Dashboards Instead of Agents Narrating at You

tart (tartifacts) lets an agent build a live terminal dashboard — a manifest, a fetch script, and a render script — that updates in place rather than repeating state back to you in chat. Install with `uv tool install tartifacts` and point the agent at `tart --skill`; pairs well with tmux, agent in one pane and dashboards in another.

dashboardtuitmuxobservabilityuv
by tg1482 Aug 18, 2026 7/10
app GitHub

context-switch: Lightweight Switcher for Multiple Claude Code Accounts

A small utility for flipping between different Claude Code accounts without manually juggling credential files. Handy if you keep personal and work subscriptions separate, or hit limits on one and want to move over cleanly.

accountscliutilityauth
by tenkenco Aug 18, 2026 6/10
app Reddit

buoy.nvim: Give Claude Code Live Cursor Context Inside Neovim

A Neovim plugin that runs the official Claude Code CLI in a terminal window and feeds the agent editor context through hooks, so each prompt carries a fresh snapshot of the cursor position or selection. It also exposes scripts that let the agent move the cursor in your Neovim session. Works with Claude Code and Codex with minimal configuration.

neovimpluginhookseditor-context
by UrbanHuntsman Aug 18, 2026 7/10
app Reddit

VibePod 0.20: Per-Run Credential Profiles for Containerized Coding Agents

VibePod runs coding agents such as Claude Code, Codex, and Qwen Code inside containers. Version 0.20 adds credential profiles, so a subscription login, an API-key setup, and a local Ollama config can coexist and be selected at run time with vp run claude --profile work. Only credential directories swap; skills, config, and logging stay shared, and projects can pin a profile.

containerscredentialsclimulti-agent
by nez_har Aug 18, 2026 7/10
app Reddit

Tuneloop: Local Analytics for Claude Code Sessions

A local-first CLI that enriches coding agent session transcripts with tool error categories, skill activation outcomes, token cost attributed to merged PRs, task complexity, and re-steer themes. Some signals are derived statically from transcripts, others via Haiku-class LLM-as-judge processors. Run it with npx tuneloop@latest analyze to answer questions like how much spend went into a given PR.

analyticsobservabilityclitoken-usage
by bhatbha Aug 18, 2026 8/10
app GitHub

agentledger: Local-First Cost and Cache Analytics from Agent Session Logs

Reads the coding agent session logs already sitting on your disk and reports cost, cache efficiency, and tool-call effectiveness across Claude Code, Codex, and others. No server and no account required, so nothing leaves the machine. Useful for spotting where tokens and cache misses actually go.

analyticscost-trackingcachelocal-first
by tripleaceme Aug 18, 2026 7/10
app GitHub

resume-kit: Generate Tailored Resumes and Cover Letters per Job Posting

Build one master resume, then generate a resume and cover letter tailored to each individual job posting. Removes the manual copy-edit loop of maintaining many near-identical documents. A practical, self-contained agent-assisted tool.

resumedocument-generationjob-search
by stevenrabulan Aug 18, 2026 5/10
app GitHub

orgami: An Evidence-Backed Map of Your GitHub Organization for Agents

Scans a GitHub org and produces an evidence-backed map of each repo: what it is, how to run it, what it talks to, and where it deploys. Adds daily and weekly digests plus a single shared memory handed to Claude Code and Cursor at session start. Built on bash, gh, and jq with no daemon or database.

githubcontextmemoryonboarding
by achevalier-dev Aug 18, 2026 7/10
app Reddit

Cookie Town: A Free Local Claude Code Workspace with Worktrees per Session

A desktop wrapper that spins up git worktrees by default, groups sessions by repo, lets you name sessions and assign tasks, and launches reviewing agents. Aimed at orchestrating several Claude Code agents without scattering them across a pile of terminal windows. Free, and built with Claude Code running multiple agents in parallel worktrees.

wrapperworktreessession-managementgui
by Equivalent-Growth775 Aug 18, 2026 6/10
app Reddit

Looking for a simple Claude Code + Codex collaboration setup

I’m looking for a simple way to use Claude Code and Codex together on the same project, ideally with shared context and an actual back-and-forth between them. I’d like to be able to say things like...

review
by tigerzxzz Aug 18, 2026 8/10
app Reddit

TotB prototype 5 - inside out

Something I've been working on for the last few months, with Claude doing most of the donkey work. The process has been mostly a cycle of specs and plans with Superpowers via Fable, then implementi...

config
by lewster32 Aug 18, 2026 6/10
app Reddit

Thi sub is becoming insufferable echo chamber

I follow this sub since I would like to see what kind of projects other people use claude code for, how they configure their workflow, claude.md tips, what kind of hooks people are doing and so on ...

hookworkflowclaude.mdconfig
by moosetuss Aug 18, 2026 10/10
app Reddit

I think I finally figured out how to work with opus 5

Lately every time I’ve been using opus has been extremely painful. It does not act like fable or GPT. Even just using it for small things felt buggy with random Chinese characters showing up and it...

claude.mdtesting
by Charming_You_25 Aug 18, 2026 7/10
app GitHub

hlid: Windows command center for Claude, Codex, and ACP agents

A Windows desktop app that fronts Claude Code, Codex, and other ACP agents working across an Obsidian vault and code projects. Provides persistent chats, visible tool use, approval prompts, embedded terminals, and usage analytics in one window. Useful if you juggle several agents and want a single control surface instead of scattered terminals.

windowsguiacpobsidianmulti-agent
by Kyle-Undefined Aug 18, 2026 7/10
app GitHub

wakeguard: keep your machine awake only while Claude Code is working

A small utility that prevents sleep exactly for the duration of a Claude Code turn, then releases the lock. Avoids the usual blunt fix of disabling sleep entirely or leaving caffeinate running all day. Handy for long unattended runs on laptops.

utilitysleepautomationlong-running
by pocke Aug 18, 2026 6/10
app GitHub

crewkit-cli: institutional memory and agent governance for teams

A CLI that gives Claude Code your team's accumulated context, enforces coding standards across sessions, and records which agent version produced which change. Aims at the audit and consistency problems that show up once several engineers run agents against the same repo. CLI-first, so it slots into existing scripts and CI rather than requiring a UI.

governanceteaminstitutional-memoryclistandards
by karibew Aug 18, 2026 6/10
app GitHub

coding-agent-flight-recorder: Post-Hoc Forensics for Agent Runs

Reads Claude Code and OpenCode session data already sitting on disk, grades each run against the repository, and flags whether the run should have been stopped earlier. No LLM calls, no telemetry, and zero runtime dependencies — it is pure local analysis. Good for auditing where long autonomous sessions went off the rails.

forensicsobservabilityauditsessionslocal
by spiatrenka Aug 18, 2026 8/10
app GitHub

termio: Terminal-First Agentic Development Environment for macOS

A macOS development environment built around terminal agents rather than a traditional editor. It supports Claude Code, Codex, OpenCode, and any TUI agent, giving them a shared home instead of scattered terminal tabs. For people whose main IDE has effectively become the agent.

terminalmacostuienvironment
by termio-sh Aug 18, 2026 7/10
app GitHub

fulcra-tools: Long-Running Agents Coordinating over a Shared Personal Data Account

An unofficial MIT-licensed toolkit letting long-running AI agents coordinate through their human owner Fulcra account — a shared bus, cross-model reviews, session continuity, and load balancing. The account becomes the coordination substrate between otherwise isolated agents. Niche, but an interesting take on multi-agent state.

multi-agentcoordinationsession-continuityfulcra
by ashfulcra Aug 18, 2026 5/10
app GitHub

nightmux: Drive Claude Code from Telegram with One Topic per tmux Session

Runs Claude Code, Codex, or any terminal agent from a Telegram topic, mapping one topic to one tmux session. It watches the context window and the 5-hour limit, compacts before hitting the wall, and holds prompts through a lockout instead of dropping them. Python standard library only, with no relay server in between.

telegramtmuxremotecontext-managementrate-limits
by mmr710 Aug 18, 2026 8/10
app GitHub

Mucka-Toolbench: Desktop Cockpit Running Four Claude Code Agents in Parallel

A desktop control panel for running four Claude Code agents at once on the same project, with a voice and text PM agent coordinating them. You direct the PM, which distributes work to the four workers. An unusually concrete take on parallel agent orchestration with a real UI.

parallel-agentsorchestrationdesktopvoice
by TomFromMucka Aug 18, 2026 7/10
app GitHub

Shonkor: Give Your AI Assistant a Map of the Codebase Instead of a Pile of Files

Builds a structural map of your repository so the assistant starts with an overview rather than grepping blindly through files. The intent is fewer wasted tool calls and better navigation on large codebases. A lightweight alternative to full semantic indexing.

codebase-mapcontextnavigationindexing
by MrNedimBoztepe Aug 18, 2026 6/10
app GitHub

rungraph: Visualize Claude Code Sessions and Workflows as a Graph

A zero-setup, agent-first visualizer that renders agent runs as a graph so you can see how a session actually branched. Covers Claude Code sessions and workflows without configuration. Useful for understanding where subagents were spawned and where time went.

visualizationsessionsobservabilitygraph
by fayzan123 Aug 18, 2026 7/10
app GitHub

nightshift: Pixel Office Floor for Delegating Small Tasks to Cheap Models

A visual "pixel office" where inexpensive models work the night shift and you play boss, delegating small tasks to any model behind an OmniRoute gateway. The game-like floor view makes background delegation legible instead of invisible. A playful UI over routine model routing.

delegationroutinguicheap-models
by kaanisthatyou Aug 18, 2026 6/10
app GitHub

Claude-Cut: Claude Code Agent That Edits 9:16 Video in Remotion

A Claude Code agent that edits vertical 9:16 video using Remotion, with a single edit.json driving the whole render. A frame gate and ten hard checks stop it from shipping footage it has not actually inspected. A rare example of an agent working in a visual medium with real verification.

videoremotionagentverification
by MrWoWNL Aug 18, 2026 7/10
app GitHub

OmniGlyph: Render Bulky LLM Context as Dense PNG Pages to Cut Token Spend

Converts large context into dense PNG pages that models read as images, claiming 59-70% cost reduction with full read accuracy. Ships per-provider billing math for Anthropic, OpenAI, and Gemini, fail-closed gates, and published benchmarks. Available as a CLI, a proxy, and Cloudflare Workers — worth verifying the savings claims on your own workload.

contextcosttokensproxybenchmarks
by diegosouzapw Aug 18, 2026 6/10
app GitHub

clawmetry: Zero-Config Observability Across 20+ AI Agent Runtimes

Tracks live token costs, sessions, tool calls, and cron runs across more than twenty agent runtimes including Claude Code, Codex, Cursor, Aider, and Goose. It requires no configuration and adds a governance layer on top of raw metrics. Useful if you run several different agents and want one place to see them all.

observabilitytelemetrytokensgovernancemulti-runtime
by vivekchand Aug 18, 2026 7/10
app GitHub

llm-task-tree: Local-First Visual Task Graph for Humans and AI Agents

A local-first visual task graph meant to keep a human and their coding agent looking at the same plan. It tracks goals, progress, reasoning, and the next action in one view. Useful when long agent sessions drift and you want a shared source of truth for what is done and what is next.

task-managementvisualizationlocal-firstplanning
by guess-guess-who-i-am Aug 17, 2026 6/10
app GitHub

NexusMem: Indexes Shell History, Git and Docs into Local Agent Memory

Your agent can read git log but not the shell commands you tried that failed. NexusMem indexes shell history with exit codes, git commits and diffs, and project docs into a local SQLite database, then serves back a token-budgeted slice on demand. No cloud service and no account required.

memorysqlitelocal-firstcontext
by yaminbkk Aug 17, 2026 7/10
app GitHub

ebi-agent-chat-relay: Run Claude Code From Discord or Microsoft Teams

A multi-frontend relay that lets you drive coding agents from chat instead of a terminal. It supports Claude Code, Codex, local agents, and AG-UI agents behind Discord or Microsoft Teams frontends. Handy for kicking off or checking on agent work from a phone.

chatremote-controldiscordteams
by ebibibi Aug 17, 2026 6/10
app GitHub

talkingclaw: Local Voice Room Where Multiple Coding Agents Talk Aloud

A local voice room where several coding agents — Claude Code, Codex, Gemini CLI — sit together and answer out loud, each with its own distinct voice. No API keys are needed since it drives the CLIs you already have. An unusual take on comparing agent answers side by side.

voicemulti-agentlocaltts
by shibu003 Aug 17, 2026 6/10
app GitHub

claude-plugins-radar: Machine-Readable Directory of Claude Code Plugins

A hand-curated, continuously updated directory of Claude Code plugins, skills, and agents. Entries are published in a machine-readable format, so it can be consumed by tooling rather than only browsed. Useful as a discovery source when you are hunting for an existing skill instead of writing one.

directorypluginsskillsdiscovery
by iliasaberkane6-lab Aug 17, 2026 6/10
app GitHub

Launchpad-CLI: One-Minute Claude Code Installer for Windows and macOS

An installer that gets Claude Code running from scratch on Windows and macOS. It bundles Node.js and Git, a Windows Terminal theme, a live status bar, a folder picker, right-click launch, and named profiles with flags. Aimed at people whose first blocker is environment setup rather than the tool itself.

installerwindowsmacosonboarding
by noambrand Aug 17, 2026 6/10
app GitHub

cradle-app: Electron Command Center for Coordinating AI Coding Tools

An Electron desktop app that sits one layer above your AI coding tools and coordinates them from a single place. The pitch is that the tools themselves are good but managing several of them is a mess. Worth a look if you routinely juggle multiple agent CLIs.

desktoporchestrationelectronmulti-tool
by wibus-wee Aug 17, 2026 6/10
app GitHub

tokenhabit: Scan Claude Code Logs for Habits Burning Your Tokens

Reads your local Claude Code logs and surfaces the recurring patterns that quietly consume tokens. It runs entirely offline with no LLM calls and no dependencies, so nothing about your sessions leaves the machine. A diagnostic rather than a limiter — it tells you what to change.

tokensanalyticsofflinelogs
by epoko77-ai Aug 17, 2026 7/10
app Reddit

file-tether: Package-Manager-Style Sync for Your Agent Config Files

A cross-platform C#/.NET CLI that treats individual files like packages: keep instruction files, hooks, coding rules, and unpublished skills in any repo or gist, and map remote paths to local destinations per machine. "check" shows what has updates and "pull" installs them, with conflict detection and a diff when both sides changed. Fits the case where full clones and symlink farms do not, because each machine needs only a subset.

clidotfilessyncconfig
by Cytoph Aug 17, 2026 6/10
app GitHub

zcf: Zero-Config Code Flow Setup for Claude Code and Codex

A zero-configuration setup layer that gets Claude Code and Codex into a working flow without hand-editing config. Aimed at removing the initial setup tax when starting on a new machine or a new project. Small in scope, quick to try.

setupconfigclionboarding
by UfoMiao Aug 17, 2026 6/10
app GitHub

skillint: Static Analysis and Linting for SKILL.md and AGENTS.md

A linter for agent skill definitions, auditing the SKILL.md and AGENTS.md files consumed by Codex, Cursor, and Claude Code. Instead of finding out a skill is malformed when an agent silently ignores it, you get static errors up front. Fills a genuine gap now that skill files are numerous enough to rot.

linterskillsstatic-analysisagents-md
by iosrxwy Aug 17, 2026 8/10
app GitHub

local-agents: Run Claude Code on Local Apple Silicon MLX Models

An additive overlay that points Claude Code at local Apple Silicon MLX models through vllm-mlx. Your private configuration stays local and the overlay does not disturb your existing setup. Useful for offline work or for keeping sensitive repos off any API.

local-modelsmlxapple-siliconprivacy
by haiggoh Aug 17, 2026 6/10
app GitHub

querora: Local-First Conversational BI Powered by Your Own CLI Agents

A macOS app for asking questions of your data in plain language, driven by CLI agents you already have — Claude Code, Codex, or pi — rather than a hosted model. Built with Tauri and Rust and licensed Apache-2.0. Local-first, so the data does not leave your machine to be queried.

bitaurirustlocal-firstmacos
by 8ugustdev Aug 17, 2026 6/10
app GitHub

burnlens: Forensics for Where Claude Code Tokens and Context Go

Breaks down Claude Code token spend, context growth, and cache behavior across projects, agents, and sessions. Rather than a single usage number, it shows which project or subagent is responsible for the burn. Pairs well with any effort to trim a workflow that has quietly gotten expensive.

tokensanalyticscontextcache
by Graf2242 Aug 17, 2026 7/10
app Reddit

VocalCode: On-Device Push-to-Talk Dictation for Claude Code Prompts

Hold a key, describe the task, release, and punctuated text lands in the terminal; a second binding sends it. Recognition is on-device and CPU-only, so client code and unreleased work never transit anyone cloud. Two details matter for agent prompting specifically: spelled-out acronyms collapse ("m c p" becomes MCP) and a user dictionary covers project jargon, with no AI rewriting of what you said.

voicedictationprivacyinput
by nestlyze Aug 17, 2026 7/10
app GitHub

cceye: Monitor Claude Code Usage Costs From Local Logs With Alerts

Watches your local Claude Code logs and reports usage cost, firing alerts when you cross configured thresholds. Everything is derived from local log files, so no account access is needed. A small, focused tool for people who keep hitting limits without noticing.

usagemonitoringalertscost
by ydah Aug 17, 2026 6/10
app GitHub

ADHDev: Self-Hosted Dashboard to Monitor and Control AI Coding Agents

A self-hosted, open-source dashboard for monitoring and controlling AI coding agents from one place. Rather than tailing several terminals, you get a hub view of what each agent is doing. Useful once you routinely run more agents than you have screen space for.

dashboardmonitoringself-hostedmulti-agent
by vilmire Aug 17, 2026 6/10
app Reddit

Open-Source CCAR-F Exam Kit With Wrong-Answer Diagnostics

A study kit for the Claude Certified Architect Foundations exam: 30 task statements across 5 domains, 98 linked wiki notes, and 90 original practice items. Every wrong option is tagged with one of seven named distractor families, and the diagnostic ranks which family you pick by rate rather than raw count. That ranking is the point — it names the kind of mistake you keep making.

certificationstudyexamopen-source
by Alexioc Aug 17, 2026 6/10
app GitHub

agent-cli-session-TUI: One Terminal Screen for Every Agent CLI Session

A terminal UI for managing parallel background sessions across Copilot, Claude Code, Codex, Qwen, Gemini, and Kimi. It adds cross-session search and AI-suggested grouping so a dozen sessions stay navigable. Aimed at people who run agents in bulk rather than one at a time.

tuisessionsmulti-agentterminal
by yeelam-gordon Aug 17, 2026 6/10
app Reddit

easel: Agents Publish an Interactive Review Board Instead of Markdown

When a session needs your eyes, it publishes a local interactive HTML board where you can comment on any element, and widgets let the agent request specific decisions — everything you annotate returns as structured feedback. It runs as a local daemon backed by SQLite and ships with a Claude Code skill. Templates cut both publish time and tokens (roughly 2x faster at half the cost in the author evals), and it supports round diffs, diagrams, Excalidraw whiteboards, and themes.

reviewhtmlfeedbackskillsqlite
by Iarduino Aug 17, 2026 8/10
app GitHub

cc-statusline: Two-Line Statusline With Git, K8s and Rate-Limit Bars

A two-line ANSI statusline for Claude Code showing git and Kubernetes context, rate-limit bars, service health, and AI session topics. The rate-limit bars and service health make it more operational than most statuslines. Suited to people running Claude Code against live infrastructure.

statuslinegitkubernetesmonitoring
by vtmocanu Aug 17, 2026 6/10
app GitHub

syntropic137: Self-Hostable Agentic Engineering Platform

An open-source platform for orchestrating coding-agent workflows powered by Claude Code, with GitHub App integration. It provides real-time observability into running workflows and can be self-hosted. Aimed at teams wanting agent runs tied to repository events rather than launched by hand.

platformorchestrationobservabilitygithub-app
by syntropic137 Aug 17, 2026 6/10
app GitHub

coreball: Semantic Context Compiler That Packs Minimal Useful Context

A semantic context compiler that assembles the smallest useful slice of a codebase for a given task. It has zero dependencies and is deterministic, so the same task produces the same context every run. Directly targets the token cost of dumping too much of a repo into an agent session.

contexttokenszero-depsdeterministic
by francomano Aug 17, 2026 7/10
app GitHub

workstats: Local-First Git and AI Work Analytics in Rust

Analytics over your git history and AI-assisted work across CLIs, IDEs, and APIs, written in Rust for speed. Data is stored as open JSONL and there is zero telemetry. Useful for seeing how much of your output actually comes through agent sessions.

analyticsrustgitprivacy
by woksin Aug 17, 2026 6/10
app GitHub

fleetview: Claude Code's Agent View Ported to opencode and Copilot

One screen for all your background coding agents, porting the Claude Code agent view to opencode, claude, and copilot. It gives non-Claude tools the same fleet overview Claude Code users already have. Handy if your background work is split across more than one vendor CLI.

tuibackground-agentsmulti-tool
by costajohnt Aug 17, 2026 7/10
app GitHub

almanac: Skill Aggregator That Indexes SKILL.md From Any Source

An aggregator that indexes and retrieves SKILL.md files from pluggable sources. Instead of hunting through repos, you query one index for the skill you need. Complements skill directories by being something you run yourself over sources you choose.

skillsindexaggregatordiscovery
by cjohnhanson Aug 17, 2026 6/10
app GitHub

niceclaude: Pace Background Work So It Yields to Foreground Sessions

Paces Claude Code background work against its own usage windows, so unattended jobs give up budget when you need it interactively. Without this, a long background run can consume the allotment you were saving for real work. A scheduling answer to the usage-limit problem rather than a measurement one.

usageschedulingbackground-agentsrate-limits
by JEL-LL Aug 17, 2026 7/10
app GitHub

lite: Fast Local Workspace for Claude Code, Codex, Gemini CLI and More

A fast local workspace that hosts Claude Code, Codex, Gemini CLI, Kimi Code, Qwen Code, DeepSeek, OpenRouter, and your shell together. From Ultralytics, so it comes with some expectation of maintenance. Useful when you want one surface across every agent CLI you use.

workspacemulti-toollocalterminal
by ultralytics Aug 17, 2026 7/10
app GitHub

claude-code-guardian: Keep a Remote Session Alive on a Debian Server

Keeps at least one remotely-attachable Claude Code session alive on a Debian server, surviving reboots and manual kills. You can attach over SSH and tmux or through Claude Code Remote Control from the web or phone. Aimed at treating a server session as always-on infrastructure.

remotetmuxpersistenceserver
by CharlesGool Aug 17, 2026 6/10
app GitHub

crab-code: Agentic Coding CLI Built From Scratch in Rust

An open-source agentic coding CLI written in Rust that plans, thinks, and executes against any LLM backend rather than being tied to one provider. It is designed to be compatible with Claude Code workflows, so existing project conventions and habits carry over. Useful if you want a native-binary agent or need to run coding agents against self-hosted or alternative models.

rustcliagentic-codingopen-sourceclaude-code-alternative
by lingcoder Aug 16, 2026 7/10
app GitHub

mind-atlas: Spatial Mission Control for Parallel Coding Agents

A dashboard that renders parallel AI coding work as a navigable spatial map of branches, results, approvals, and notifications. It supports Claude Code alongside Codex and OpenClaw, so multi-agent and multi-tool runs land in one view. Aimed at people running several agent sessions at once who lose track of what finished, what is blocked, and what needs a decision.

orchestrationdashboardparallel-agentsmonitoringmulti-agent
by openceo2025 Aug 16, 2026 6/10
app GitHub

Terse: On-Device Monitor for Agent Spend, MCP, and Token Use

A macOS and Windows desktop app that live-monitors Claude Code, Cursor, and other agents, surfacing runaway sessions before they burn through budget. It also manages MCP server configuration and applies context-reduction to cut token usage, with processing done on-device. Source and releases are both published. Note the 40-70% cost-reduction figure is the project authors own claim.

monitoringtoken-usagecost-controlmcp-managementdesktop-app
by lucaszengool Aug 16, 2026 6/10
app GitHub

agent-profiles: Run Claude, Codex, and ChatGPT Side-by-Side With Separate Accounts

A cross-platform tool for keeping multiple coding-agent profiles isolated, so separate accounts for Claude, ChatGPT, and Codex can run at the same time without clobbering each others credentials or config. Works on macOS, Windows, and Linux. Practical if you switch between personal and work accounts, or run several agents concurrently.

profilesmulti-accountcredentialscross-platformtooling
by burnabyjudicial666 Aug 16, 2026 6/10
app GitHub

health-vault: Local-First Obsidian + Claude Code Vault for Health and Training Data

A local-first second brain for athletic performance and physical and mental health, built on an Obsidian vault driven by Claude Code with no cloud RAG. It emphasizes statistically honest biometric analysis and adversarial claim-checking, so the agent pushes back on weak inferences from noisy personal data rather than confirming them. A good reference for privacy-sensitive personal-data agent setups.

obsidianlocal-firsthealthpersonal-dataprivacyanalysis
by rossw811 Aug 16, 2026 5/10
app Reddit

Claude Skills That Play The Farmer Was Replaced via a Headless Game Mod

A mod for the programming game The Farmer Was Replaced exposes a local REST API so an agent can play it headlessly, paired with skills that contain no hints or example strategies. Claude Opus wrote an initial script from the game rules alone, then Claude Fable iterated it into a top-3 leaderboard entry. A clean testbed for measuring agent capability on an unfamiliar task with a real scoreboard.

benchmarkgameskillsrest-apievaluation
by blender-bender Aug 16, 2026 6/10
app GitHub

soloe: Local-First Agent Development Environment for Solo Developers

A development environment built around one developer running multiple coding agents, supporting both Claude Code and Codex CLI. It manages git worktrees, plans, and multi-commit review in one place so parallel agent work stays reviewable. Everything runs locally with no hosted service.

worktreescodexcode-reviewlocal-firstorchestration
by mheraskin Aug 16, 2026 7/10
app GitHub

conciv: Embeddable AI Dev Agent Injected Into Your Running App

A Vite plugin that injects an AI dev agent directly into your running application, giving it chat, page control, and the ability to run live tests against the real UI. Instead of describing a bug, you point the agent at the page where it happens. Useful for frontend debugging loops where reproducing state in a test harness is the slow part.

vitefrontendtestingbrowserdebugging
by conciv-dev Aug 16, 2026 7/10
app GitHub

pokemanion: A Pokemon Sprite That Animates While Claude Code Works

Puts an animated Pokemon sprite in a terminal pane next to your Claude Code session. The sprite rests while Claude waits for input and animates while it is working, giving you an at-a-glance status indicator from across the room. Pure ambient fun, but a genuinely readable signal for long unattended runs.

terminaltuistatusfunambient
by khatriadbhut Aug 16, 2026 6/10
app GitHub

ai-prompt-search: Searchable TUI Over Every Prompt You Have Typed

Reads the prompt history already sitting on your machine from every AI CLI you use and puts it behind one searchable TUI. No indexing service, no dependencies, nothing uploaded. Solves the recurring problem of knowing you wrote a good prompt once but not remembering where.

tuisearchprompt-historylocal-firstzero-deps
by rambaarde Aug 16, 2026 8/10
app Reddit

Prelude: Use Any Agent CLI's SKILL.md From Claude Code Without Installing It

A launcher that indexes skill directories across roughly 19 known agent CLIs and copies a one-line 'read this SKILL.md and follow it' prompt to your clipboard. No install step, no restart, and it works inside a conversation you already have open. Also lists past sessions across CLIs and copies a claude --resume command. Rust, macOS, Apache-2.0.

skillsclirustcross-toolmacos
by Annual_Variation_916 Aug 16, 2026 7/10
app GitHub

projmux: A tmux-Native Workspace for Multi-Agent Development

Organizes multi-agent work as tmux panes and windows, spanning Claude Code, Codex, and Antigravity in one workspace. Because it is tmux-native it survives disconnects and works over SSH without extra machinery. A lighter-weight alternative to purpose-built agent dashboards.

tmuxmulti-agentworkspaceterminalcodex
by crevissepartners Aug 16, 2026 7/10
app GitHub

ledgent: Local Report Showing Where Your Claude Code Tokens Go

Parses local agent logs into a cost and token report, so you can see which sessions and tools actually consume your budget. Zero network by default — nothing leaves the machine. Apache-2.0 with no dependencies.

tokenscostanalyticslocal-firstzero-deps
by Nexalix-Labs Aug 16, 2026 7/10
app GitHub

seedeep: Watch a Claude Code Turn Run — Context, Subagent Tree, Tokens

A live view into an in-progress Claude Code turn showing the context window filling up, the subagent tree as it branches, and where tokens are being spent. Reads the local logs only, so nothing leaves your machine. Genuinely useful for diagnosing why a long turn stalled or blew its context.

observabilitycontext-windowsubagentstokenslocal-first
by duqaXxX Aug 16, 2026 8/10
app GitHub

agent-virtual-office: Your Coding Agents as Pixel Coworkers in the Browser

Renders Claude Code, Codex, and Gemini sessions as tiny pixel-art office workers who type while working, take coffee breaks when idle, and visibly get blocked. Runs in the browser in real time. A playful status dashboard that happens to make multi-agent state legible at a glance.

visualizationmulti-agentbrowsermonitoringfun
by KbWen Aug 16, 2026 6/10
app GitHub

a4phone: Approve Claude Code Prompts From Your Phone via ntfy.sh

Sends task-completion notifications to your phone through ntfy.sh and lets you answer the agent's questions and permission requests with a tap. Covers both Claude Code and Codex. Documentation is in Chinese. Turns a long unattended run into something you can supervise away from the desk.

notificationsmobilentfyremotepermissions
by eogee Aug 16, 2026 7/10
app GitHub

aimind: Multi-Pane Terminal Workspace With a Shared Task and Memory MCP

A multi-pane terminal workspace for AI coding CLIs, backed by a shared task and memory MCP server and swarm-style multi-agent orchestration. The shared memory server is what lets panes coordinate rather than duplicate work. Fits the growing category of terminal-native agent workspaces.

terminalworkspacemcpswarm
by Ravikiranbantwal Aug 15, 2026 6/10
app GitHub

agent-memory-daemon: Consolidate Markdown Agent Memory on the Filesystem

A filesystem-native daemon that consolidates, extracts, and organizes markdown memories through pluggable LLM backends. Memory stays as plain files you can read and version. Addresses the drift problem where agent notes accumulate without ever being reorganized.

memorydaemonmarkdownfilesystem
by Charlesfrederickmenningerdateplum166 Aug 15, 2026 6/10
app GitHub

claude-code-from-source: Claude Code Internals From Pseudocode and Analysis

A study repo reconstructing Claude Code's internals, architecture, and design patterns from original pseudocode and technical analysis. Useful for understanding why the agent behaves as it does, not for running anything. Joins several existing source-exploration efforts on the board.

internalsarchitectureanalysislearning
by claricesupernormal350 Aug 15, 2026 6/10
app GitHub

devintern: Turn Tracker Tickets Into Pull Requests With Your Chosen Agent

Takes issues from your tracker and drives a coding agent through to a pull request, letting you pick which agent and model handle the work. Source-available under FSL. Aimed at teams who want ticket-to-PR automation without locking into one vendor's agent.

automationpull-requeststicketsagents
by getdevintern Aug 15, 2026 6/10
app GitHub

codey: Multi-Agent Workbench Driving Claude Code From macOS, Chat, or Voice

Orchestrates Claude Code, Codex, OpenCode, and pi from a native macOS app, from Telegram/Discord/iMessage, or by voice. Provides per-project workspaces, worker teams, flow graphs, and parallel runs. Local-first and MIT licensed.

orchestrationmacosmulti-agentmit
by its-ahoh Aug 15, 2026 7/10
app Reddit

BuildStory: Reconstruct a Build Report From Your Claude Code Sessions

A local scanner that points at a repo worked on with Claude Code or Codex and reconstructs a report on the build: sessions, model usage, turning points, and build patterns. The author used it on its own development to see what the process actually looked like. Interesting if you want retrospective visibility into agent-assisted work.

analyticssessionsreportingretrospective
by ComfortableCheap1669 Aug 15, 2026 5/10
app GitHub

termpeek: Preview Images, Video, PDFs, and Diffs Inside a Coding CLI

Renders images, video, PDFs, code, and diffs from inside AI coding CLIs that cannot display them. Works with Claude Code, Codex, Gemini CLI, and Hermes. Removes the constant context switch to another window just to look at an asset the agent just produced.

terminalpreviewcliimages
by 0xNyk Aug 15, 2026 7/10
app GitHub

holaOS: All-in-One Agent Workspace With 100+ Integrations and Shared Memory

An open-source workspace that runs Claude Code or Codex across your tools, apps, browser, and files with shared memory between them. Ships 100+ integrations plus MCP support, with built-in models or bring-your-own-key. Positions itself as the surface where several agents share one context.

workspaceintegrationsmemorymcp
by holaboss-ai Aug 15, 2026 6/10
app GitHub

reticle: Give Coding Agents Runtime Perception of Web Applications

Bridges the gap between agents generating web code and agents understanding what that code actually does at runtime. Provides runtime perception of the running application rather than only static source. Relevant if your agent keeps writing frontend code it cannot verify.

runtimewebverificationfrontend
by reticlehq Aug 15, 2026 6/10
app GitHub

ruleblast: See the Blast Radius of a CLAUDE.md or AGENTS.md Change

A git diff for repository instructions that shows how a change to AGENTS.md or CLAUDE.md propagates across Codex, Claude Code, Gemini CLI, and Copilot CLI. Makes instruction edits reviewable instead of guesswork. Particularly relevant for shared repos where several agents read the same files.

claude-mddiffinstructionsreview
by Kpoiut Aug 15, 2026 7/10
app GitHub

omnigauge: Quota, Tokens, and Burn Rate for Every AI Plan in One Terminal View

Shows quota, token consumption, burn rate, and reset time for Claude, Codex, and Grok in a single terminal gauge. Consolidates what would otherwise be several separate usage checkers. Handy on subscription plans where the weekly limit is the real constraint.

usagequotaterminalmonitoring
by omnigauge Aug 15, 2026 6/10
app GitHub

pandev-cli: What Your Coding Agents Cost by Task, Branch, Model, and File

Breaks down AI coding agent spend across tasks, branches, models, and individual files. Runs locally with a dashboard on 127.0.0.1:4976 and no telemetry. More granular than a plain token counter, which helps when attributing cost to specific work.

costanalyticslocaldashboard
by pandev-metriks Aug 15, 2026 6/10
app GitHub

loongsuite-js: OpenTelemetry Traces From Claude Code With Zero Code Changes

Alibaba's OpenTelemetry instrumentation plugins for JavaScript-based coding agents, collecting traces, tool calls, and LLM metrics from Claude Code and OpenClaw. Requires no code changes to the agent. Notable for bringing standard observability tooling to agent sessions.

observabilityopentelemetrytracingmetrics
by alibaba Aug 15, 2026 7/10
app GitHub

claude-usage-widget: Windows Panel Tracking Limits Across Multiple Accounts

A Windows desktop panel and taskbar badge showing Claude subscription limit usage across several accounts at once. Reads usage by asking the Claude Code CLI rather than scraping credentials. The multi-account support sets it apart from similar widgets.

usagewindowswidgetmulti-account
by simoneb Aug 15, 2026 5/10
app GitHub

many-ai-cli: Approve Parallel Agent Sessions From One Browser Tab or Phone

Runs Claude Code, Codex, Copilot, Cursor, and Grok CLIs in parallel with every approval prompt surfaced in a single browser tab, including from your phone. Solves the practical bottleneck of parallel agents: being present for each permission request. Mobile access makes long runs less tethering.

parallelapprovalsmobilemulti-cli
by ishizakahiroshi Aug 15, 2026 6/10
app GitHub

vibeward: Security Scanner for AI-Generated Apps With an RLS Prompt Gate

Scans deployed apps or repos from Lovable, Bolt, v0, and Base44 for exposed secrets, open Supabase RLS, Firebase leaks, and missing headers. Also ships a deterministic prompt gate that blocks a 'disable RLS' instruction before your agent acts on it. The prompt gate is the notable piece, catching the mistake before it ships.

securityscannersupabaserls
by JSiapoDEV Aug 15, 2026 7/10
app GitHub

commonbook: Bind Claude Code Memory to Git Identity, Not Folder Path

Claude Code loses a project's memory when you move or rename its folder; commonbook binds memory to the repo's git identity instead. It also recovers notes already orphaned by a past move. Fixes a specific, well-known annoyance rather than reinventing memory.

memorygitrecoveryprojects
by erfanhabibipanah Aug 15, 2026 7/10
app GitHub

coding-cost-lab: Free Calculators for AI Coding Agent Costs

Calculators estimating spend across Claude Code, Codex, Cursor, and Copilot, including prompt caching effects and team budgets. Estimation before the fact rather than reporting after it. Useful when deciding between subscription tiers and API billing.

costcalculatorbudgetingcaching
by Jmzhang93 Aug 15, 2026 5/10
app Reddit

nopus: Detect and Rewrite Needlessly Complex Agent Prose

Deterministically detects overly complex prose in coding-agent responses and asks the same agent for one clearer rewrite. Built in response to the dense, abstract paragraphs recent models produce. The author's argument: cognitive effort should go to the problem, not to decoding the answer.

prosereadabilitypluginrewriting
by Vistyy Aug 15, 2026 7/10
app GitHub

agd: A Keyboard-Driven Dashboard for Parallel Claude Code Sessions

Runs many Claude Code and Codex CLI sessions in parallel on macOS from a keyboard-driven dashboard. Optimized for switching between sessions without reaching for the mouse. One of the leaner entries in the crowded session-manager category.

dashboardmacosparallelkeyboard
by wand125 Aug 15, 2026 6/10
app GitHub

WUPHF: Spin Up a Personal Office of AI Teammates Over Shared Context

Creates a set of AI teammates that collaborate over shared context, supporting Claude Code, Codex, OpenClaw, OpenCode, and local LLMs. The shared context is the design point, keeping teammates from re-deriving the same facts. Local LLM support helps for cost-sensitive background work.

multi-agentcollaborationshared-contextlocal-llm
by najmuzzaman-mohammad Aug 15, 2026 5/10
app GitHub

aethrom: An Obsidian Vault Driven by Claude Code, With Memory Hooks

A cross-platform second brain built as an Obsidian vault that Claude Code drives, using hooks to carry memory between sessions. Notes stay in plain Markdown you can read without the agent. Appealing if you already live in Obsidian.

obsidianmemoryhooksnotes
by aethrox Aug 15, 2026 6/10
app GitHub

topics-app: Run Four Coding CLIs Side by Side, Each in Its Own Worktree

A desktop workspace running Claude Code, Codex, OpenCode, and Gemini CLI side by side, with every task isolated in its own git worktree. MIT licensed, local-first, and no telemetry. Worktree-per-task is the right default for parallel agents touching the same repo.

worktreedesktopmulti-climit
by armonia Aug 15, 2026 7/10
app GitHub

HashPilot: SHA-256 Anchored File Edits With AST-to-Hash-to-Diff Routing

Makes agent file edits deterministic by anchoring them to SHA-256 hashes, routing through a three-tier AST, hash, then diff strategy. Targets the class of failures where an edit lands in the wrong place after the file shifts underneath it. Technically the most interesting edit-reliability approach in this batch.

editingdeterminismastreliability
by bigknoxy Aug 15, 2026 7/10
app GitHub

claude-router: Switch Claude Code Between Anthropic and 9Router on Windows

Lets Windows users switch Claude Code between Anthropic and any 9Router provider, with both terminal and VSCode support. Windows-first tooling remains comparatively rare in this ecosystem. Useful if you route requests across providers.

routingwindowsprovidersvscode
by vinhnguyenthanhdn Aug 15, 2026 5/10
app GitHub

shipshape: Reconcile, Update, and Prune Your Claude Code Plugins

Compares installed Claude Code plugins against your desired set, updates them, and prunes stale caches. Turns plugin management into a declarative reconcile instead of manual upkeep. Increasingly needed as plugin counts grow.

pluginsmaintenancereconcilecache
by chris-peterson Aug 15, 2026 6/10
app GitHub

paddock: Self-Hosted Web UI for Claude Code With Fork and Rewind

A self-hosted web interface giving Claude Code persistent, resumable chats on your own server, reachable from any browser. Supports forking and rewinding a conversation. Self-hosting keeps session history under your control.

web-uiself-hostedsessionsfork
by edspencer Aug 15, 2026 7/10
app GitHub

prompt-router: Send Each Prompt to the Model That Should Handle It

Routes prompts by type: coding tasks to Claude Code, simple questions to a local model, and deep questions to OpenRouter. Keeps expensive models for work that needs them. Straightforward cost control for mixed workloads.

routinglocal-llmopenroutercost
by PTB-0 Aug 15, 2026 5/10
app GitHub

rove: Multiplex Coding Agents in Your Shell Like Terminal Sessions

Runs Claude Code, Codex, Copilot, and Kimi in parallel from the shell, each session on its own git worktree and branch. Attach, detach, and reattach as with tmux, and sessions keep working after you disconnect. Survives disconnection, which matters for long unattended runs.

multiplexershellworktreeparallel
by Sma1lboy Aug 15, 2026 7/10
app GitHub

sandbase cli: One Command for 2,000+ Models, Sandboxes, and MCP Workflows

An agent-first CLI fronting 2,000+ AI models, multimodal generation, sandboxed execution, and MCP tooling behind a single API key. Designed to be driven by agents rather than typed by hand. Convenient if you are juggling provider keys, at the cost of routing through one vendor.

climodel-routingsandboxmcp
by sandbaseai Aug 15, 2026 5/10
app GitHub

sessionvault: Back Up Session History From 35+ AI Coding Agents to R2

Backs up session history from Claude Code, Codex, Cursor, Gemini CLI, Copilot, Cline, and 30+ other agents to Cloudflare R2. Zero dependencies, cross-platform, and append-only — it never deletes prior history. Insurance against losing the transcript record of how something got built.

backupsession-historycloudflare-r2archival
by rush-skills Aug 15, 2026 7/10
app GitHub

trustless: Credential Broker That Injects Secrets Into Agent Subprocesses

A single-binary CLI that brokers credentials for AI agents — secrets stay in pass or Bitwarden and are injected into subprocesses at run time instead of landing in the agent's context. Adds DLP pattern rules, OAuth refresh, and structured audit logs for every access. Zero dependencies.

secretssecuritydlpcredentialsaudit-log
by ikkun1222 Aug 15, 2026 7/10
app GitHub

agentfleet: Run Coding Agents on Remote Machines From One Screen

A control surface for a fleet of coding agents running across remote machines, all visible from a single terminal. The differentiator is that it surfaces which agents are blocked waiting on you, so you are not polling sessions to find the stalled one. Useful once you run more agents than you can watch.

fleetremotemulti-agentmonitoring
by beknazar Aug 15, 2026 7/10
app GitHub

lume: Local-First AI Workspace With Persistent Memory and Real Tools

A local-first workspace giving an agent team persistent memory plus real tools — files, shell, LSP, MCP, and Office documents. Everything runs on your machine, so no code or documents leave it. Opinionated about the agent roles rather than fully configurable.

local-firstmemoryworkspacemcpprivacy
by CavinHuang Aug 15, 2026 6/10
app GitHub

herdr-agent-watcher: Live Observability and Metrics Bridge for Claude Code

Adds coding-agent observability to Herdr with live sidebar cards and lifecycle notifications as sessions start, stall, and finish. Includes a zero-config metrics bridge for Claude Code, so telemetry flows without editing settings. Useful if you already run Herdr as your multiplexer.

observabilityherdrmetricsmonitoring
by winoooops Aug 15, 2026 6/10
app GitHub

strays: TUI for Centrally Managing LLM Agents Across Machines

A terminal UI that gives you one pane of glass over coding agents running on multiple machines. Instead of tabbing between SSH sessions and tmux windows, you see every agent's state in a single list and attach to whichever needs attention. Still marked WIP, but the fleet-management problem it targets is real for anyone running more than two agents at once.

tuiorchestrationmulti-agentmonitoring
by m1sk9 Aug 14, 2026 6/10
app GitHub

herminal: Native macOS Terminal With Built-In Coding-Agent Observability

A local-first macOS terminal that treats coding agents as first-class citizens, surfacing what an agent is doing rather than leaving it buried in scrollback. Also ships Vietnamese IME support, which most terminals handle poorly. Useful if you want agent visibility without bolting a separate dashboard onto your workflow.

terminalmacosobservabilitynative
by hoangperry Aug 14, 2026 5/10
app GitHub

agentfault: Evidence-First Intelligence on Recurring AI Agent Failures

Catalogs failure modes that recur across open-source agent projects and backs each one with evidence rather than anecdote. Installs into Claude Code and Codex so the failure knowledge is available while you build, not after you've hit the bug. Aimed at people writing agent harnesses who keep rediscovering the same traps.

failure-analysisdebuggingagentsresearch
by shuo-young Aug 14, 2026 7/10
app GitHub

ai-sandboxes: Run Coding Agents Inside a MicroVM

Isolates agents in MicroVMs rather than containers, giving kernel-level separation with boot times close to a container's. A stronger boundary than Docker for anyone running agents with permissions skipped. Worth a look if container escape is in your threat model.

sandboxmicrovmsecurityisolation
by rikdc Aug 14, 2026 6/10
app GitHub

pptfast: Stable, Editable PPTX Generation for Coding Agents

Takes a semantic intermediate representation and emits native DrawingML, so the resulting decks are genuinely editable in PowerPoint rather than a pile of images. Ships as a Claude Code plugin, a DeepSeek Harness plugin, and a standalone CLI. Solves the usual problem of agent-generated slides that fall apart the moment a human opens them.

pptxdocument-generationplugindrawingml
by liustack Aug 14, 2026 6/10
app Reddit

scratchboard: Local Browser Kanban for Markdown Agent Tickets

Renders a directory of markdown tickets as a kanban board in your browser, launched with one npx command. Deliberately read-only so it never bloats agent context, with live reload and one-click copy of a ticket path to paste into a prompt. Built after the author's own ticket pile passed 300 files and became unmanageable as flat markdown.

kanbanticketsmarkdownproject-management
by ludari_gg Aug 14, 2026 7/10
app GitHub

token-shield: Measure Claude Code Token Waste and Prove the Savings

Reads your own local usage counters to show where tokens actually go, then measures the same workload after changes so the savings are a real before/after rather than a guess. Runs locally and privately with no data sent anywhere. The measurement discipline is the differentiator among the many token-counter tools.

tokenscostmeasurementoptimization
by khalilmaaouni Aug 14, 2026 7/10
app GitHub

huginn: Persistent Claude Code Sessions on Your Server, With Native Mobile Apps

One command exposes a long-lived Claude Code session running on your own machine, backed by mirrored auto-reconnecting tmux sessions. Native Android and desktop clients give streaming chat, live session views, push notifications, and permission prompts you can answer from the lock screen. Uses subscription auth, so no API key is required.

remotemobiletmuxpersistent-sessionsandroid
by silencelen Aug 14, 2026 8/10
app GitHub

immersive-web-simulation-forge: 3D and Physics Simulation Toolkit for Agents

A toolkit that lets AI agents build, render, and validate web-based 3D and physical simulations. It gives the agent a way to check that generated simulation code actually renders and behaves correctly rather than just compiling. Niche, but relevant if you point Claude Code at WebGL or physics work.

3dsimulationwebglvalidationtoolkit
by ictseoyoungmin Aug 14, 2026 5/10
app GitHub

agent-inbox: Mac Notifications for Claude Code Sessions Across Machines

Sends a native macOS notification whenever a Claude Code session finishes or stops to ask you something, including sessions running on other machines. Aimed at people who run long or parallel agent sessions and keep forgetting to check back on a terminal. Cross-machine coverage is the differentiator over a simple local hook.

notificationsmacosmonitoringsessionsmulti-machine
by Ideaplaces Aug 14, 2026 7/10
app GitHub

estate-agent: One Context File Per Repo Across a Whole Repo Estate

Generates a single agent context file for every repo you own, plus a cross-repo service map backed by evidence rather than guesses. Guardrails block agents from reaching credentials, and the docs repair themselves as the code moves. Zero dependencies, and nothing leaves the machine.

contextmulti-repoguardrailsdocumentation
by mutaaf Aug 14, 2026 7/10
app GitHub

agent-cost: Token Usage and Cost Estimates From Local Agent Logs

Reads Claude Code and Codex CLI logs already on disk to measure token usage and estimate what each session cost. No network calls and no dependencies, so the numbers are computed entirely locally. Useful for finding which sessions quietly burn the most context.

tokenscostcliobservability
by shiki-yusuke Aug 14, 2026 6/10
app GitHub

dsh-skin-claude-code: A Faithful Replica of the Claude Code Terminal Skin

Recreates the Claude Code interface skin for another agent harness, matching the original closely enough that the author calls it a tribute to their vibe-coding days. Cosmetic rather than functional, but a tidy reference for anyone theming an agent CLI to feel familiar.

themeuiterminalskin
by le-soleil-se-couche Aug 14, 2026 5/10
app GitHub

outstanding-items: A User-Owned Ledger of Loose Ends for Claude and Codex

An installable plugin for Claude Code and OpenAI's coding agent that keeps everything you meant to get back to in one ledger. The point is ownership: the record lives with you rather than inside a session that ends and takes its context with it.

memorypluginledgertask-tracking
by EthanSK Aug 14, 2026 6/10
app GitHub

claude-workspaces: Isolated Worktrees, Ports, and Daemons Per Session

Gives each parallel Claude Code session its own git worktree, ports, environment, and daemons, so two sessions on the same project stop fighting over the dev server. Ships as a single static Go binary with nothing to install alongside it.

worktreeparallel-sessionsgodevtools
by Phaengris Aug 14, 2026 8/10
app GitHub

gnome-shell-extension-aiquota: AI coding quotas in the GNOME panel

A GNOME Shell extension that puts quota gauges for Claude Code, Grok Build, and Codex in the top panel. Each gauge fills as you spend and shows the reset time on hover. Fills the Linux/GNOME gap left by the many macOS menu-bar and Windows tray quota monitors.

quotagnomelinuxmonitoringstatusbar
by cahenesy Aug 14, 2026 6/10
app GitHub

Circus-Chief: Meta-Harness Running Claude Code, Codex, and Gemini CLI

An open-source meta-harness that drives Claude Code, OpenAI Codex, and Gemini CLI from one layer. Lets you run the same task through different agents without rewriting your setup for each CLI. Useful if you compare agents or want a vendor-neutral entry point.

harnessmulti-agentcodexgemini
by ferrislucas Aug 14, 2026 7/10
app GitHub

double-bubble: Run Multiple Claude Accounts on One Mac Without VMs

Runs several Claude Desktop or Claude Code accounts simultaneously on a single Mac, no virtual machines involved. The mechanism is generic and works for any macOS app. Solves the constant log-out/log-in cycle when you split personal and client work.

macosmulti-accounttoolingproductivity
by artsu281-ai Aug 14, 2026 7/10
app GitHub

agent-instruction-integrity: Testing Claude Code Under Conflicting Repo Rules

An exploratory evaluation harness that measures whether Claude Code holds to its instructions when a repository contains competing guidance. Useful if you maintain large CLAUDE.md hierarchies and suspect rules are being dropped. Research-flavored rather than production tooling.

evalharnessinstructionsresearch
by pdmacinnes Aug 14, 2026 6/10
app GitHub

agentcap: Capture and Score Coding-Agent Sessions for Training Value

Captures Claude Code and Codex sessions at the source, recording both the trajectory and a verifiable git environment, then scores each session on grounded x rich x focused. Local, deterministic, and runs no model at capture time. Aimed at people building training data from real agent work.

capturesessionstraining-datalocal
by albaNnaksqr Aug 14, 2026 6/10
app GitHub

Chief-of-Vibes: Self-Improving Claude Code Harness With Approval Gates

A persistent AI colleague for Claude Code that manages its own memory and branches and proposes fixes to itself through a gate you approve. Improvements from any copy can be pushed back so every other install benefits. An unusually ambitious take on a self-modifying harness.

harnessmemoryself-improvinggated
by ElJoakoDELxD Aug 14, 2026 6/10
app GitHub

dsh-chat-import: Continue Claude Code and Codex Conversations Inside DSH

Imports message history from Claude Code, Codex, and Reasonix into DeepSeek Harness so a conversation can continue there. Reduces the cost of switching agents mid-project. Niche, but useful if you move between harnesses.

importhistorydshmigration
by Nwflower Aug 14, 2026 5/10
app GitHub

dsh-TUI: Claude Code-Style Full-Screen Terminal UI for DeepSeek Harness

A full-screen terminal plugin that gives DeepSeek Harness a Claude Code-style interface: pixel whale header, live status line, streaming thinking, double-Esc rollback, context progress bar, and a TPS gauge. Installs via npm. Fills a gap DSH has not covered officially.

tuiterminaldshui
by ccch1mneyyy Aug 14, 2026 5/10
app GitHub

agentopolis: Your Claude Code Agents Visualized as a Living Pixel City

Renders your running coding agents as a pixel-art city that changes as they work. Local-only mission control, no data leaves the machine. Playful, but a genuinely readable way to see many concurrent sessions at a glance.

visualizationmonitoringlocaldashboard
by otniel-bit Aug 14, 2026 6/10
app GitHub

your-turn: macOS Menu Bar Inbox Showing Which Claude Session Needs You

A macOS menu bar app that acts as an inbox for Claude Code sessions, showing which one is blocked on you and what it needs next. Solves the problem of losing track of parallel sessions waiting on approval. Straightforward and focused.

macosmenu-barsessionsnotifications
by himynameisben Aug 14, 2026 7/10
app GitHub

GLAW: Virtual Law Firm Agent System With 183 Skills and 181 Commands

An open-source virtual law firm built from AI agents: 183 skills, 181 commands, hard-gated matters, MCP and API intake, and an X402 paid-agent charge matrix with Conway-style agent survival. Output is attorney work-product for licensed review, not legal advice. Notable mainly as an extreme example of skill-system scale.

agentslegalskillsmcp
by rikitrader Aug 14, 2026 5/10
app GitHub

ChatCCC: Drive Claude Code, Cursor, or Codex From Lark and WeChat

Controls DeepSeek Harness, Claude Code, Cursor, Codex, or CCC Agent through Lark or WeChat chat messages. Lets you kick off and steer agent work from your phone. Practical for anyone whose team already lives in those chat apps.

chatremote-controlwechatlark
by wzj998 Aug 14, 2026 6/10
app GitHub

cortex: A Visual Editor for Claude Code

A visual editing interface layered over Claude Code. Terse description, but the category is worth tracking as GUI front-ends for the CLI keep appearing. Check the repo before committing to it.

guieditortooling
by dklzf Aug 14, 2026 5/10
app GitHub

driftlint: Find Claims in Your CLAUDE.md That the Code No Longer Supports

Scans CLAUDE.md, AGENTS.md, and skill files for assertions the codebase has since outgrown, then flags them. Zero-config with no API key required, so it can run in CI. Directly targets the stale-instructions problem that quietly degrades agent behavior.

lintingclaude-mddriftmaintenance
by alifurkangokce Aug 14, 2026 8/10
app GitHub

MioIsland: Monitor and Approve Claude Code Sessions From the macOS Notch

Turns the MacBook notch into a Dynamic Island for AI coding agents: monitor sessions, approve prompts, and jump straight to the one that needs attention. Keeps session state visible without a window. Nice fit for multi-session workflows.

macosmonitoringnotchsessions
by MioMioOS Aug 14, 2026 7/10
app GitHub

dsh-plugin-cc: Bridge DeepSeek Harness Into Claude Code for Delegation

Brings DeepSeek Harness into Claude Code for review, critique, delegation, and session import. Gives you a cheaper second opinion inside the same session. The reverse direction of most Claude-to-other-agent bridges.

bridgedshdelegationreview
by cpj-dev Aug 14, 2026 6/10
app GitHub

kerby: Load a Rulebook, Constrain the Agent, Then Validate Its Output

Agent-agnostic guardrails: you load a rulebook that limits what the agent may do inside a repo, then validate its output against those same rules. Turns instructions into enforced boundaries. Works across coding agents rather than just Claude Code.

guardrailsvalidationrulessafety
by sorawit-w Aug 14, 2026 6/10
app GitHub

back-in-claude: Push and Email Alerts the Moment Your 5-Hour Limit Resets

Notifies you by phone push and email exactly when your Claude 5-hour usage window resets, running entirely on GitHub Actions. No server or daemon to maintain. Small, but it removes a lot of clock-watching.

notificationsusage-limitsgithub-actionsmonitoring
by jackchuka Aug 14, 2026 7/10
app GitHub

taskops: A Shared Task Board With Atomic Claims for Claude Code Agents

A persistent task board for Claude Code agents with atomic claims, git-bound commits, AI-written daily reports, and a server so agents on different machines never grab the same card. The atomic claim is the important part for genuinely parallel fleets. More infrastructure than a markdown TODO, and deliberately so.

task-boardmulti-agentcoordinationgit
by bernatch22 Aug 14, 2026 7/10
app GitHub

rMLX: Single-Binary Rust MLX Server With an Anthropic-Compatible API

A native Rust MLX inference server for Apple Silicon serving text, vision, audio, and embeddings behind OpenAI and Anthropic-compatible endpoints. No Python and no GGUF, and it claims the widest weight x KV quantization matrix of any MLX server. Relevant here because the Anthropic-compatible API means agent tooling can point at it directly.

inferencemlxapple-siliconrust
by Pushkinist Aug 14, 2026 5/10
app GitHub

Orrery: Per-Shell Account Isolation for Claude Code, Codex, and Gemini

A per-shell environment manager that isolates accounts for Claude Code, Codex, and Gemini CLI, so different terminals can run as different identities. Avoids the log-out/log-in dance when working across clients. Same problem as claude-profiles, solved at the shell-environment level.

clienvironmentmulti-accountisolation
by OffskyLab Aug 14, 2026 6/10
app GitHub

infinity-token-tracker: Desktop Monitor for Token Usage and Model Activity

A real-time desktop app tracking AI token usage, costs, and model activity, with optimization recommendations. Useful if you want a live view rather than after-the-fact log parsing. Covers multiple providers, not just Claude.

monitoringtokenscostsdesktop
by aruninf Aug 14, 2026 6/10
app GitHub

thm-claude-kit: A TryHackMe Coach That Guides Instead of Solving Rooms

A Claude Code kit for TryHackMe with a fixed methodology (classify, enumerate, foothold, privesc), room-state tracking, ready-made commands, and specialist subagents for CVE research, privilege escalation, and write-ups. It deliberately coaches you through each room rather than solving it. A hands-on alternative to reading write-ups.

securitytryhackmelearningsubagents
by pashki975 Aug 14, 2026 6/10
app GitHub

token-station: Loopback-Only Gateway That Routes Agents by Quota and Cost

A local routing control plane for AI agents and LLM providers with a loopback-only gateway, quota-aware smart routing, and both desktop and CLI apps. Keeps traffic on localhost while letting you steer which provider serves each request. Useful when you hold several subscriptions and want them used efficiently.

routinggatewayquotalocal
by ballast-ai Aug 14, 2026 6/10
app GitHub

orbit: Multi-Repo Git Workspaces So One Agent Spans Many Repos

Creates multi-repo git workspaces for coding agents so a single agent can work coherently across several repositories. Addresses a real gap, since most agent tooling assumes one repo per session. Agent-agnostic.

gitmulti-repoworkspaceagents
by orbcli Aug 14, 2026 6/10
app GitHub

a2wave: Turn Your Agent CLIs Into Shared Services Your Team Can Call

Exposes the agent CLIs you already run -- Claude Code, Cursor Agent, OpenAI Codex -- as shared services the whole team can invoke, orchestrated in natural language. Turns a personal setup into shared infrastructure. Worth evaluating carefully for credential and access boundaries.

orchestrationteamservicesmulti-agent
by LilithGames Aug 14, 2026 6/10
app GitHub

forkast: A Meal Planner Where Every Line Was Written by Claude Code

An opinionated local-first meal planner that is really an experiment in agent-first development: every line written by Claude Opus 4.8 through Claude Code, designed through conversation rather than typed by hand. The app works, but the artifact of interest is the process. Useful data point on no-hand-coding builds.

experimentagent-firstlocal-firstapp
by paul80nd Aug 14, 2026 5/10
app GitHub

hdev: Hand a Task to an Agent on a Throwaway Hetzner VM, Get Back a PR

Dispatches a coding task to an agent running on a disposable Hetzner VM; you close your laptop and the work returns as a pull request. Isolation is a side benefit, since nothing runs on your machine. Costs real money per run, so worth checking the VM lifecycle handling.

remotehetznervmpull-request
by dennisonbertram Aug 14, 2026 7/10
app GitHub

multicooker: Race LLM Agents in Docker Sandboxes, Then Let LLMs Judge

Runs several LLM agents on the same task in parallel Docker sandboxes, then has other LLMs judge the results. Uses your Claude Pro, ChatGPT Plus, and Gemini Advanced subscriptions rather than API keys. The generate-then-judge pattern is worth stealing even at smaller scale.

paralleldockerjudgingmulti-model
by faeton Aug 14, 2026 7/10
app GitHub

koji: A Dependency-Free UCI Chess Engine in Zig, Built With Claude Code

A UCI chess engine written in Zig with no external dependencies, developed with Claude Code. Interesting as evidence of agent-assisted work on a domain with hard correctness constraints and a strong existing benchmark set. Not a Claude Code tool itself.

zigchessshowcaseengine
by smercer10 Aug 14, 2026 5/10
app GitHub

claude-terminal-hub: Resume Any Recent Claude Code Session in One Click

A local multi-pane terminal that lists your recent Claude Code sessions across every project and resumes each with one click. Removes the hunt for the right directory and session ID. Simple and self-contained.

terminalsessionsresumelocal
by obrenoalvim Aug 14, 2026 6/10
app GitHub

stream-eval: Deterministic Assertions Over claude -p stream-json Output

An assertion harness that runs deterministic checks against `claude -p` stream-json transcripts. Gives automated Claude Code sessions an actual test loop instead of eyeballing logs. Directly useful if you run unattended agent jobs.

testingharnessstream-jsonautomation
by j-256 Aug 14, 2026 7/10
app GitHub

canopy: A Project Tree That Lights Up as Claude Code Reads and Edits

Hosts Claude in a PTY and renders a project tree that highlights files as the agent reads and edits them. Makes the blast radius of a session visible in real time. Nice for catching an agent wandering into files it should not touch.

visualizationptymonitoringfiles
by bdgscotland Aug 14, 2026 6/10
app GitHub

attic: Auto-Close Idle Agent Sessions but Archive Them for Restore

Automatically closes idle AI coding sessions after archiving each one so it can be restored later. Reclaims resources without losing state. Useful if you accumulate abandoned sessions across many projects.

sessionscleanuparchiverestore
by TheThoughtagen Aug 14, 2026 6/10
app Reddit

attune-forms: Typed, Validated Forms Instead of Twenty Agent Questions

A PyPI library and Claude Code plugin giving agents a second channel beside chat: declarative validated forms, so independent decisions batch into one round-trip instead of twenty questions. Malformed questions are refused at build time and malformed answers at collection time. The Decision construct puts the recommended option first with a rationale and a one-line tradeoff under each alternative.

formsvalidationpluginux
by Business-Appeal-2748 Aug 14, 2026 7/10
app GitHub

seek: A Single-Binary Local Coding-Agent Platform With Cron and Memory

A local coding-agent platform in one Go binary with plan mode, subagent teams, cron scheduling, memory, and MCP support. DeepSeek-native and MIT licensed. More complete than most agent demos, and the cron support makes unattended runs practical.

agent-platformgocronmcp
by whyiyhw Aug 14, 2026 6/10
app GitHub

llm-spend-audit: What Your Agent Wiring Costs Before It Does Any Work

Three stdlib-only instruments measuring the fixed overhead your agent setup incurs each session, who burned tokens yesterday, and which paid subscriptions are going unused. No LLM calls and no network access. Worth running if your context bill feels higher than your actual work.

costaudittokensanalysis
by tonydzi Aug 14, 2026 6/10
app Reddit

Munder Difflin: An Office-Themed Multi-Agent Harness for Claude Code

A local multi-agent harness that drives your existing Claude Code and Codex installs as an office of persistent agents, visualized as a sitcom-style office simulation. You act as the boss, or a clone of you orchestrates while you are away. Open source and free.

harnessmulti-agentlocalvisualization
by chaitanyagiri Aug 14, 2026 6/10
app GitHub

odysseus: Local-First Control Plane for Agents, Worktrees, and tmux

A local-first control plane tying together coding agents, git worktrees, and tmux sessions. Worktrees plus tmux is the standard manual setup for parallel agent work, and this makes it managed. Nothing leaves your machine.

control-planeworktreestmuxlocal
by jpolec Aug 14, 2026 7/10
app Reddit

ar-butter: Webcam Hand-Tracking ASMR Butter, Built by Chained Chats

An open-source browser toy where webcam hand-tracking lets you squeeze soft butter, crack the wax, and watch crumbs fall on their own. The build method is the interesting part: one chat wrote no code at all and only tracked the project, chose the next step, and wrote instructions for a fresh chat to execute. A manual version of the orchestrator pattern.

webglhand-trackingorchestrationshowcase
by oxmannnn Aug 14, 2026 5/10
app GitHub

ecosystem: Session Observability and Multi-Plugin Governance for Claude Code

A framework combining session observability with governance across multiple Claude Code plugins. Relevant once you run enough plugins that their interactions stop being obvious. Check the repo for how much of the governance is enforced versus advisory.

observabilitygovernancepluginssessions
by onlooker-community Aug 14, 2026 6/10
app GitHub

fak: Fused Agent Kernel for Cutting Token Use and Repeated Work

A runtime layer for Claude Code, Codex, Cursor, and MCP that aims to reduce token spend and duplicated effort. It keeps model traffic cache-stable, adds context compaction with crash resume, serves repeated calls locally, applies a fast tool policy, and can run local GGUF inference. Worth a look if long sessions are burning through your budget.

performancecachingtokensruntimelocal-inference
by anthony-chaudhary Aug 14, 2026 7/10
app GitHub

standing-orders: A Control Plane for Fleets of Coding Agents

A control plane for running many coding agents at once, built around the idea of standing orders — persistent instructions that tell agents when they may proceed on their own and when to escalate. The pitch is "wake me only for these," so you review exceptions instead of every step.

orchestrationfleetcontrol-planeautomationagents
by ap9000 Aug 14, 2026 6/10
app GitHub

AI-Psychiatry: An Executive-Function Layer for Coding Agents

A Claude plugin that watches for the failure modes agents fall into and intervenes. It targets attention drift, overthinking, recursive reasoning, compulsive verification, scope creep, retry loops, deadlocks, context waste, and the classic failure to stop once the task is done. An unusual framing of guardrails as executive function.

pluginguardrailsscope-controlcontextreliability
by ihabkhaled Aug 14, 2026 7/10
app GitHub

feedrecall: Turn Saved Discoveries into Project-Aware Agent Memory

A tool that converts things you save while browsing into local memory an AI agent can consult, scoped to the project you are working in. Everything stays on your machine. Aimed at closing the gap between "I read something useful last week" and the agent knowing about it.

memorycontextlocalknowledge-base
by Paoladev45 Aug 14, 2026 5/10
app GitHub

cairn: Shared Memory for AI Coding Agents

A shared memory layer for AI coding agents, letting context persist and be read across agents rather than living inside a single session. Aimed at the recurring problem of agents re-deriving the same project knowledge every run. Note that several unrelated projects use the "cairn" name — this is czearing's.

memorycontextagentsshared-state
by czearing Aug 13, 2026 5/10
app GitHub

Belay: Keeps Your Mac Awake Only While Claude Code Is Working

A macOS menu bar utility that watches Claude Code and holds a system-sleep assertion only while a turn is running, then releases it so the machine sleeps normally. Avoids both a laptop that dozes off mid-task and one left awake all night. Runs entirely locally with no API key or account.

macosmenu-barsleeputilitylocal
by PerfectoWeb Aug 13, 2026 7/10
app GitHub

mixpanel-headless: Agent-Friendly Python and CLI Interface to Mixpanel

A Mixpanel library and CLI exposing discovery, querying, and data extraction programmatically, explicitly designed with coding-agent use in mind. Claude Code can explore event schemas and pull analytics without touching a browser dashboard. Handy for letting an agent answer product-metrics questions directly.

analyticsmixpanelclipythondata
by mixpanel Aug 13, 2026 6/10
app Reddit

FluidDocs CLI: Publish and Maintain Live Documents From Claude Code

A CLI plus MCP integration for FluidDocs, a platform where published documents stay interactive — readers ask the document questions and it answers from its own content, then reports who opened it and what they asked. The CLI is built for unattended agent use: --json on every command including errors, a flat command namespace, and old command names kept as aliases so stale prompts do not break. Roughly half the documents on the platform are already agent-created.

documentationmcpclipublishingautomation
by nish_agg Aug 13, 2026 6/10
app Reddit

Closing the Verification Gap When You Run 10-15 Agents a Day

Built by a developer whose workflow is spawning 10-15 agents daily for research, code and tests, and who found the gap is not the building but the checking. Wiring Playwright into Claude Code rarely caught real bugs, because the agent is optimistic — green builds, passing tests and clean CI read as success while users hit breakage in production. The tool aims to make agents actually see and judge what they shipped rather than trust their own signals.

testingverificationmulti-agentqabrowser-automation
by Particular-Face8868 Aug 13, 2026 6/10
app GitHub

agents-guide-to-telegram: Native Rich Telegram Messages and a Live Progress Window

Teaches an agent to use Telegram as a real output surface rather than a plain text sink — native rich messages with tables, LaTeX and collapsible blocks, plus a live progress window for Claude Code sessions. Bundled with a field guide of hard-won pitfalls from the Telegram Bot API, which is where most homegrown integrations lose time. Documentation is bilingual Chinese/English.

telegramnotificationsintegrationprogressbot-api
by Circe22 Aug 13, 2026 7/10
app GitHub

claude-code-zh: Traditional and Simplified Chinese Language Pack for Claude Code in VS Code

A localization pack that translates the Claude Code VS Code extension into Traditional (Taiwan) and Simplified (mainland China) Chinese. It auto-detects the editor locale or lets you switch manually from a status bar quick menu, applies idempotently so repeated runs are safe, and flags untranslated strings so gaps in coverage surface instead of silently persisting.

localizationchinesevscodei18nextension
by LaiYueJi Aug 13, 2026 6/10
app GitHub

agentpave: Scaffold a Governed AWS Agent With Evals and Guardrails in One Command

A miniature agentic AI developer platform for AWS that treats QA as part of the scaffold rather than a later addition. One command produces a governed agent already wired with evals, guardrails, tracing, and a CI quality gate that fails closed. Useful as a reference for what a production-minded agent baseline looks like on AWS, not just a hello-world starter.

awsevalsguardrailstracingciscaffolding
by andaro74 Aug 13, 2026 7/10
app GitHub

figdown: Markdown-Native Diagrams That Agents Read as Text and Humans See as SVG

A standard for figures that keeps one source serving two readers — the agent parses plain Markdown-native text, the human sees a deterministically rendered SVG. This sidesteps the usual failure where a diagram is an opaque image the model cannot reason about, or an agent-readable format that looks terrible to people. Deterministic rendering means the same source always produces the same figure, so diagrams diff cleanly in git.

diagramsmarkdownsvgdocumentationagent-readable
by FigDown Aug 13, 2026 7/10
app GitHub

todou: An Issue Tracker Built for Humans and AI Agents Working Together

An issue tracker designed around the assumption that both people and agents will read and write the same backlog, rather than bolting agent access onto a human-first tool. The name reads as To-Do and sounds like the Mandarin word for potato. Worth a look if your agents keep losing track of multi-session work because the task state lives only in chat scrollback.

issue-trackertask-managementagentscollaboration
by orzFly Aug 13, 2026 6/10
app GitHub

agent-memory-system: Local-First, Evidence-Backed Continuous Memory for Coding Agents

A memory layer for coding agents that keeps everything local and requires stored memories to be backed by evidence rather than accepted as free-form assertions. The evidence requirement targets the common failure where an agent confidently recalls something from a prior session that was never true, or is no longer true. Continuous capture means memory accrues during work instead of at explicit checkpoints.

memorylocal-firstcontextagentspersistence
by rrrrrredy Aug 13, 2026 6/10
app GitHub

level-five: The Agentic Harness Companion Code From "Agentic Programming"

The reference harness accompanying Appendix A of the book Agentic Programming, published as runnable code rather than book listings. Useful mainly as a readable, self-contained example of how an agent loop is structured when it is written to be taught rather than shipped. Note the repo name and description disagree on the level number, so read the code rather than the label.

agent-harnessreferencebooklearningagent-loop
by jerodw Aug 13, 2026 5/10
app GitHub

claude-bridge: Pair a Laptop and VPS Claude Code Session to Work Together

Connects two Claude Code sessions — typically your laptop and your VPS — so they coordinate natively over Remote Control instead of you relaying context by hand. File transfer runs over SSH with end-to-end checksum verification, so a truncated copy surfaces as an error rather than as a mysterious downstream failure. Free and open source.

remotesshvpsmulti-sessioncoordination
by kadaba Aug 13, 2026 7/10
app GitHub

CodeSampleX: A Local-First Reasoning Cache So LLMs Stop Solving the Same Code Twice

A distributed cache of coding solutions built from two ingredients: anonymous compatibility evidence gathered from real environments, and verified minimal samples for coding LLMs. The premise is that the same version-and-platform puzzle gets re-derived from scratch by every agent, every time, and that evidence from real runs beats the model guessing. Local-first, so your own cache works before any sharing happens.

cachelocal-firstcode-samplescompatibilityllm
by r2cuerdame Aug 13, 2026 6/10
app GitHub

sesstalk: A Same-Machine Mailbox for Passing Work Between Agent Sessions

Lets Cursor, Claude Code, Codex and Grok sessions running on one machine hand work to each other through a local mailbox. The README is explicit that this is not Slack for agents — it is a work-passing primitive, not a chat channel, which keeps the semantics narrow enough to be reliable. Useful when you keep several tool-specific sessions open and want them to cooperate.

multi-agentipcmailboxcoordinationcross-tool
by EndeavorYen Aug 13, 2026 7/10
app GitHub

chess-theory: A Three-Seat Deliberation Engine to Stop Agents Repeating Mistakes

Adds a deliberation step before an agent commits to an answer, structured as three distinct seats that argue the decision out. It targets the pattern where an agent makes the same class of mistake repeatedly across sessions because nothing forces a second look. One-line install, runs locally and privately, and supports Claude, Cursor, Windsurf and roughly twenty other agents.

deliberationmulti-agentlocalreasoningcross-tool
by Sumedh1599 Aug 13, 2026 6/10
app GitHub

Sufler: A Single-Window Claude Code Workspace With Editor, Terminals and Skill Panels

A Polish-language desktop working environment that puts an editor, multiple terminals, a knowledge graph and skill panels into one window alongside Claude Code. The pitch is avoiding the constant window-switching that comes with running an agent, a shell and your editor as separate apps. Interface and documentation are in Polish.

workspaceguiidepolishknowledge-graph
by Luqys Aug 13, 2026 6/10
app GitHub

promptie: Zero-Dependency Write-Only Knowledge Capture for Claude Code

promptie captures knowledge from Claude Code sessions on the premise that disagreement is data, recording the moments where you and the agent diverge. It is write-only by design, so capture never turns into a maintenance burden. Zero dependencies keeps it easy to drop into any project.

knowledge-capturesessionszero-depsfeedback
by thevangelist Aug 13, 2026 6/10
app GitHub

lich: Terminal-First Harness with Real PTYs, Worktrees, Diffs, and PRs

lich is a terminal-first harness for working with coding agents that runs them on real PTYs rather than pipe-based wrappers. Git worktrees keep concurrent agents isolated from each other. Diffs and pull requests live in the same window, so review does not mean switching to a browser.

tuiptyworktreespull-requests
by omartelo Aug 13, 2026 7/10
app GitHub

path-memory: Layered agent memory scoped by filesystem path

Gives coding agents a master memory inherited everywhere plus an independent memory and persona per project directory, with controlled cross-agent handoff. The core is host-neutral with per-agent adapters (Pi first, Claude Code and Codex planned). Solves the problem of one global memory file bleeding irrelevant context into every project.

memorycontextmulti-agentper-project
by aezizhu Aug 13, 2026 6/10
app GitHub

Deobfuscated source of Claude Code v2.1.76 (1,902 TypeScript files)

A reverse-engineered, deobfuscated dump of the official @anthropic-ai/claude-code npm package at v2.1.76, spread over 1,902 TypeScript files. Useful for understanding how the harness actually implements tools, hooks and permission checks. Treat as a read-only reference — it tracks one specific version and will drift.

reverse-engineeringinternalssourcereference
by nadonghuang Aug 13, 2026 7/10
app GitHub

agge: Operator console for Claude Code background agents

An attention-first board for supervising background Claude Code agents, using GitHub issues as the backlog. Self-deploying with zero dependencies. Surfaces the agents that need you rather than making you poll every session.

background-agentsdashboardgithub-issuesoperations
by sefr-sefr Aug 13, 2026 7/10
app Reddit

Visual QA for agents that ship faster than you can review

Written by someone running 10-15 agents a day who found that agents cannot judge their own output — builds pass, tests pass, and the app is still broken. Argues Playwright wiring alone does not catch this because Claude is optimistic about what it sees. Describes the tool built to close that verification gap.

qaverificationbrowser-testingparallel-agents
by Particular-Face8868 Aug 13, 2026 6/10
app GitHub

volta-auto-update: Keep Volta-managed agent CLIs up to date automatically

Checks for and installs updates to Volta-managed npm developer tools including Claude Code, Codex and OpenCode. Ships a macOS app, a CLI, and a launchd scheduler so it runs unattended. Small utility for people who keep falling behind on agent CLI releases.

voltaupdatesmacosautomation
by zhexin233-ui Aug 13, 2026 5/10
app GitHub

skilldoctor: Lint, security-audit and compatibility-check your Agent Skills

A quality gate for Agent Skills that lints structure, runs a security audit, and checks compatibility across Claude, Cursor, Codex and OpenCode. Run it before publishing a skill so it does not silently break on another host. The cross-host compatibility check is the part most skill linters skip.

skillslintingsecuritycompatibility
by xyiqq Aug 13, 2026 7/10
app GitHub

skill-doctor (evilstar2016): Local CLI for auditing skill conflicts and safety risks

Audits your installed agent skills for conflicts, duplicates and safety risks, all locally. Aimed at the mess that accumulates once you have installed skills from a dozen sources. One of several independent takes on skill auditing — compare with the other skill linters on the board.

skillsauditconflictscli
by evilstar2016 Aug 13, 2026 5/10
app GitHub

synergy: Live MDX specs and chunked code review with a browser-to-agent loop

Turns vague requests into living MDX specifications, then reviews PRs or working-tree code in focused, durable chunks with repository-aware explanations. A browser-to-agent question loop lets you ask follow-ups on a chunk without losing your place. Tackles the 'reviewing a 2,000-line agent diff' problem directly.

code-reviewspecificationsmdxplanning
by sanzhardanybayev Aug 13, 2026 6/10
app GitHub

kobiton/automate: Drive real mobile devices from your coding agent

A Kobiton plugin that lets Claude Code, Copilot CLI, Gemini CLI, Cursor CLI and Codex manage devices, upload builds, run mobile automation and read test results without leaving the workspace. Vendor-specific but a concrete example of wiring a device cloud into an agent workflow.

mobiletestingdevicesautomation
by kobiton Aug 13, 2026 5/10
app GitHub

aura: Local control desk for your Claude Code environment

Replays past sessions, reconstructs what the context window actually held, reports usage diagnostics, and makes guarded edits to ~/.claude. Runs locally. The context-window reconstruction is the standout feature for anyone debugging why a session went sideways.

session-replaycontext-windowdiagnosticslocal
by Shaenn Aug 13, 2026 7/10
app GitHub

skillport: Lint a SKILL.md then install it into six different agents

Validates a SKILL.md and installs it into Claude, Codex, Cursor, Gemini, Grok and Copilot in one step. Removes the manual copy-into-each-agent-directory step when you maintain skills across hosts. Small, focused tool.

skillslintingcross-agentinstaller
by hongforge Aug 13, 2026 6/10
app GitHub

CodeKanban: One page for all your terminals and coding agents

A unified view for managing every terminal and AI coding agent you have running, instead of hunting through tmux panes and terminal tabs. Useful once you routinely have several agents going at once.

dashboardterminalsmulti-agentmanagement
by fy0 Aug 13, 2026 6/10
app GitHub

shelf: Remember which tools you already evaluated and rejected

A context-budgeted store of tools you might use someday, so the agent checks your prior verdict before recommending something you already looked at and turned down. Small idea, real annoyance solved. The context budget keeps it from swallowing your window.

memorytoolingdecisionscontext
by jhammant Aug 13, 2026 6/10
app GitHub

cc-swap: Multi-account and quota manager for Claude Code and Codex

Switches between logins, tracks quota usage, and rotates accounts before you hit a rate limit. Aimed at people who juggle personal and work subscriptions. Check your provider's terms before automating rotation.

accountsquotarate-limitscodex
by errhythm Aug 13, 2026 6/10
app GitHub

flowlet: One traceable local model gateway shared by every agent

Gives multiple AI agents a single controlled entry point to your models: manage provider accounts in one place, switch upstreams without reconfiguring each agent, localize failures, and trace token spend back to a specific session. Chinese-language docs. Useful once you have three agents each with their own API config.

gatewayproxytoken-trackingmulti-provider
by null-object-0000 Aug 13, 2026 6/10
app GitHub

GrillForge: Per-scenario model and subagent routing across agent CLIs

A lightweight control plane that reuses the native CLIs already on your machine and lets you compose different providers and models per scenario. Chinese-language docs. For people who want a cheap model on grunt work and a strong one on the hard parts, without maintaining separate configs.

routingmulti-modelsubagentscli
by liiiiwh Aug 13, 2026 5/10
app GitHub

skills-space: An open marketplace for coding-agent skills

A vendor-neutral marketplace covering Claude Code, Cursor, Copilot and AGENTS.md formats. Portuguese-language project. Another entrant in the skill-discovery space, notable for not being tied to one agent.

marketplaceskillsdiscoverycross-agent
by thiagopbraga Aug 13, 2026 6/10
app GitHub

time-library: Local-first AI memory layer with traceable sources

A memory layer that plugs into any platform in one line, keeps data local by default, and can trace a remembered fact back to its origin. Chinese and English documentation. The traceability is what separates it from a plain fact store.

memorylocal-firsttraceabilitycross-platform
by strmforge Aug 13, 2026 5/10
app GitHub

rule-relay: Explain and validate agent instructions across a repository

Finds every instruction file the agents in your repo are reading, explains what each one actually asserts, and validates them against each other. Useful once CLAUDE.md, AGENTS.md and a pile of rule files have accumulated and nobody knows which one wins.

claude-mdagents-mdvalidationinstructions
by pangxueyuan2-creator Aug 13, 2026 6/10
app GitHub

claude-auto-retry: Wait out rate limits and 5xx overloads automatically

Retries Claude Code through subscription rate limits, API overload responses (529/5xx) and safeguard false positives, waiting for the reset time Claude prints and backing off exponentially. tmux-based. For long unattended runs that currently die on a five-hour limit.

rate-limitsretrytmuxautomation
by cheapestinference Aug 13, 2026 6/10
app GitHub

claude-skills-sidebar: See your Claude Code skills in the VS Code sidebar

Lists your installed skills grouped and searchable in the VS Code sidebar, one click from the source file, instead of leaving them forgotten in a folder. Addresses the real problem that installed skills are invisible until you remember they exist.

vscodeskillssidebardiscovery
by hootbu Aug 13, 2026 6/10
app Reddit

Open-Source Conductor Rebuilt for Windows and Linux

A from-scratch Conductor-style multi-agent workspace GUI for Windows and Linux, AGPLv3, with no workspace cap or paid tier. The author built it using itself over four weeks — 132 commits and 79 merged PRs written by agents with every diff human-reviewed.

guiwindowslinuxconductoropen-sourcemulti-agent
by Scary_Climate_3975 Aug 13, 2026 8/10
app GitHub

agentic-os: Claude Code Observability via OTel, Prometheus and Grafana

A personal AI ops platform that pipes Claude Code telemetry through an OpenTelemetry Collector into Prometheus and Grafana, plus a status API. Deploys to Railway behind a Cloudflare Tunnel, so you get session dashboards without exposing anything publicly.

observabilityopentelemetrygrafanaprometheusmonitoring
by MK023 Aug 13, 2026 7/10
app Reddit

agpm: A CI Gate That Makes Installing a Skill Require Human Approval

Treats agent skills like dependencies: agpm sync writes harness.json (what is approved) plus harness.lock (sha256 per file), and agpm check fails CI when on-disk files drift from the approved set. The PR that changes harness.json is the approval, so marketplace skills cannot silently change your agent's instructions.

supply-chaincisecuritylockfileskillsgovernance
by Necessary_Abroad6632 Aug 13, 2026 8/10
app Reddit

Open-Source iPad SSH Terminal With iTerm2-Style tmux Integration

An iPad terminal built because no existing app offered iTerm2-style tmux integration — cmd+1-9 tab switching, cmd+d pane splits, mosh and plain ssh, plus remote file management with a tree that tracks your pwd. Practical for driving a Claude Code session on a desktop from the couch.

ipadsshtmuxmoshmobileterminal
by kerbinagent Aug 13, 2026 7/10
app GitHub

jeomwon: Turn One Domain Interview Into a Working Reservation SaaS

An agent kit that interviews you about a booking domain and generates a full reservation SaaS: AI storefront clerk chat, admin dashboard, and lifecycle emails on Convex plus Next.js. A concrete example of scoping agent codegen to one vertical instead of general scaffolding.

saascodegenconvexnextjsreservations
by NewTurn2017 Aug 13, 2026 6/10
app GitHub

49Agents: A 2D IDE for Agents Across Projects and Machines

An open-source spatial IDE for managing agents running in native CLIs, terminals, git repos, beads issues, and files spanning multiple projects and machines. Self-host on localhost, spread across a cluster over Tailscale, or use the hosted option.

idemulti-agentself-hostedtailscalecluster
by alpbahadur Aug 13, 2026 7/10
app GitHub

refine: Extract Reusable Knowledge From Your AI Conversations

Mines Claude Code, Codex, and ChatGPT transcripts for insights worth keeping, turning throwaway sessions into a reusable knowledge base. Targets the common failure where the same problem gets re-solved from scratch in every new session.

knowledgetranscriptsmemoryreusecross-agent
by majiayu000 Aug 13, 2026 7/10
app GitHub

agent-memory: Cross-Repo Memory With Markdown Source and SQLite Index

Durable memory shared across repositories for both GitHub Copilot and Claude Code. Markdown files stay the source of truth while a SQLite graph index provides retrieval, and it ships with zero runtime dependencies.

memorymarkdownsqlitecopilotcross-repo
by vib795 Aug 13, 2026 7/10
app GitHub

agent-opportunity-tracker: Job Tracker Your Agent Keeps Current

A self-hosted tracker for internships, jobs, programs, and scholarships that doubles as a Claude/Codex skill, so your agent updates it from your inbox and tailors your resume per posting. Next.js 16 plus Supabase, deploys to Vercel.

job-searchtrackernextjssupabaseself-hosted
by girmmy Aug 13, 2026 6/10
app GitHub

caraka: Send a Task From Telegram to the Agent on Your Machine

A deliberately thin Telegram bridge that forwards tasks to whichever coding agent is already installed locally, rather than reimplementing a runner. Minimal setup if you just want to fire off work from your phone.

telegramremotebridgemobile
by CarakaDev Aug 13, 2026 6/10
app GitHub

amc: Terminal Control Plane for Skills, Hooks, Plugins and MCP Servers

A single TUI for managing Agent Skills, hooks, plugins, and MCP servers across Claude Code, Pi, and Codex. Useful once your configuration is spread across several agents and you have lost track of what is enabled where.

tuimanagementmcphookspluginscross-agent
by JanYork Aug 13, 2026 7/10
app GitHub

claude_code_vs: Claude Code in Visual Studio 2026 with diff, debugger, tests

A community-built Visual Studio 2026 extension implementing the IDE half of Claude Code's integration protocol. Provides a native diff view with accept/reject, Roslyn-powered code navigation, and Test Explorer integration, plus a live debugger Claude can drive autonomously. Useful for .NET developers who want agentic coding without leaving Visual Studio.

visual-studioidedotnetdebuggerroslyn
by firish Aug 13, 2026 8/10
app Reddit

msteams-channel: Microsoft Teams channel plugin for Claude Code

A Microsoft Teams channel plugin that lets you chat with a running Claude Code instance from Teams, mirroring the official Telegram and Discord channel plugins. Built on the Microsoft Agents SDK with pairing codes, per-channel opt-in, tenant/AAD access checks, inbound and outbound files, and permission prompts relayed back into Teams. Setup needs real Azure provisioning, but ships a runbook and an agent-assisted setup prompt.

teamschannel-pluginremote-controlazurealways-on
by dnationpt Aug 13, 2026 7/10
app GitHub

berbench: Benchmark Coding Agents Against Your Own Codebase

A benchmark harness that scores coding agents on tasks drawn from your actual repository rather than a generic public suite. The idea is that leaderboard numbers say little about how an agent performs in your code, so you measure locally. Handy when choosing between Claude Code configurations, models, or competing agents.

benchmarkevaluationcoding-agentstesting
by berbyte Aug 12, 2026 6/10
app GitHub

Oxelia51: Local-First Token and Cost Ledger for Claude Code and Cursor

A local-first ledger that tracks token usage and spend across AI coding tools, wired up with a single environment variable so it covers all providers at once. Built in Go with Tauri 2 and MIT licensed, with bilingual English and Chinese docs. Everything stays on your machine rather than going through a hosted dashboard.

usage-trackingcosttokenstaurilocal-first
by XiaoleC05 Aug 12, 2026 7/10
app GitHub

roost (IKatsuba): Native macOS Workspace for Claude Code Sessions

A native macOS app that organizes Claude Code work into projects and tabs, with a tree of terminal panes, live agent statuses, and a command palette. It targets people running several sessions at once who want a real window manager instead of a wall of terminal tabs. Note this is a different project from the similarly named roost agent-collaboration tool.

macosguisession-managementterminalworkspace
by IKatsuba Aug 12, 2026 7/10
app GitHub

free-claude-code-nix: NixOS Package Fronting Claude Code With Any Backend

Claude Code packaged for NixOS together with an Anthropic-compatible local proxy, so the CLI can be pointed at alternative model backends. Useful if you run NixOS and want a declarative install plus the freedom to route requests elsewhere. Expect the usual caveats of proxying a first-party client.

nixnixosproxypackagingmodel-routing
by Daaboulex Aug 12, 2026 6/10
app Reddit

VelaTerm: Multi-Agent Coding Terminal Goes Open Source

VelaTerm is a terminal workspace for driving AI coding agents that has now been released under an open-source license. The maintainers are inviting pull requests and have a roadmap covering standalone chat views, cross-agent conversation and knowledge sharing, and a mobile client.

terminalopen-sourcetuimulti-agent
by george-lin Aug 12, 2026 6/10
app GitHub

ms-teams-cli: Microsoft Teams From the Terminal, Built for Agents

A CLI that exposes Microsoft Teams chats to the terminal: read, reply, react, search, and manage unread state. JSON output makes it scriptable and usable as a tool surface for coding agents.

microsoft-teamscliautomationjson
by pouriamrt Aug 12, 2026 6/10
app GitHub

CC-Pet: An Animated Desktop Pet That Reacts to Claude Code

Adds an animated desktop pet that responds in real time to what Claude Code is doing. Runs as a Windows app or a VS Code extension, with support for custom spritesheets.

desktopwindowsvscodefun
by stingsealed599 Aug 12, 2026 5/10
app GitHub

cc-view: macOS Menubar Overview of Sessions Across Terminals

A macOS menubar app giving one cross-terminal view of every running Claude Code session and its current status. Solves the common problem of losing track of which window is waiting on input.

macosmenubarsessionsmonitoring
by Ethanzyc Aug 12, 2026 6/10
app GitHub

keelson: Local-First Tauri Workbench for Claude and Codex

A local-first desktop workbench that collects scattered AI-CLI sessions, projects, tasks, and documents from Claude Code and Codex into one place. Built on Tauri v2, React 19, and Rust, with all data staying on your machine.

taurilocal-firstsessionsworkbench
by akapril Aug 12, 2026 6/10
app GitHub

second-brain (SirCharan): Markdown-Vault Memory for Claude Code

A full persistent-memory plugin for Claude Code combining hooks, a skill, an MCP server, and workflows over a Markdown vault you own outright — no server, no account. A lighter hooks-only variant ships separately as continuum.

memorymarkdownpluginmcp
by SirCharan Aug 12, 2026 6/10
app GitHub

hybro: An Open Interoperability Layer for Connecting AI Agents

An open interoperability layer that lets different agents and harnesses connect and work together rather than each running in isolation. Aimed at people who mix several coding agents in one workflow.

interopagentsopen-sourceharness
by hybroai Aug 12, 2026 5/10
app GitHub

openproxy: Route Claude Code Across 40+ Providers With Fallback

A local proxy router connecting Claude Code, Cursor, Codex, and other coding tools to a wide range of model providers. Features include RTK prompt compression, automatic fallback between provider tiers, multi-account round-robin, and a local usage dashboard.

proxyroutingmodelstokens
by quangdang46 Aug 12, 2026 6/10
app GitHub

vllm-mlx: Anthropic-Compatible Inference Server for Apple Silicon

A high-performance local inference server for Apple Silicon built on native MLX, exposing both OpenAI- and Anthropic-compatible APIs. Supports continuous batching, multimodal models, MCP tool calling, and can back Claude Code directly.

mlxapple-siliconinferencelocal-models
by waybarrios Aug 12, 2026 7/10
app GitHub

Molio: Local-First Personal Knowledge Layer for AI Agents

Builds evolving knowledge spaces for AI agents using an LLM-generated wiki, knowledge graphs, and agent workflows. Local-first, so the knowledge layer stays on your own machine.

knowledge-graphlocal-firstmemorywiki
by zhuzhaoyun Aug 12, 2026 5/10
app GitHub

llm-quota: Local Dashboard and CLI for Subscription Quotas

A local-first live view of your AI subscription quotas alongside local token spend, available as a dashboard, a CLI, and a Windows widget. Updates silently with zero telemetry.

quotadashboardtokenswindows
by SandroHub013 Aug 12, 2026 6/10
app Reddit

Tempest: A Shared Knowledge Graph So Parallel Agents Stop Re-Reading

Indexes a repository once and serves a shared local knowledge graph to every agent, so parallel sessions stop burning tokens rediscovering how the codebase fits together. Each session still runs in its own git worktree.

parallelworktreesknowledge-graphtokens
by Connect_Army8250 Aug 12, 2026 7/10
app GitHub

claude-blackbox: Flight Recorder and Crash Recovery for Sessions

Records every Claude Code session so you can tell when one died, resume it with full context intact, and get warned when a session is not being saved at all. Aimed at long unattended runs where a silent crash otherwise loses everything.

crash-recoverysessionsresumemonitoring
by rdyplayerB Aug 12, 2026 7/10
app GitHub

CowAgent: Open-Source Agent Harness With Memory and Self-Evolution

An open-source agent harness that plans tasks, runs tools and skills, and evolves using memory and an accumulated knowledge base. Multi-model and multi-channel with a one-line install; formerly known as chatgpt-on-wechat.

harnessmulti-modelmemoryopen-source
by zhayujie Aug 12, 2026 6/10
app GitHub

tmuxbot: Telegram Bridge That Drives Claude Code in a tmux Pane

A two-way bridge between Telegram and an AI CLI running inside tmux, driving Claude Code or Codex by injecting into the TUI pane rather than calling an API. Lets you steer a session from your phone while it runs on your own machine.

telegramtmuxremotebridge
by ztllll Aug 12, 2026 6/10
app GitHub

cc-probeline: Status Line Pricing Every Turn, Subagent, and Cache

A live status line that prices each turn as it happens, including subagent calls and cache rebuilds, alongside usage limits, context state, and git info. Built to make token leaks visible while they're happening rather than after the fact.

statuslinecostsubagentscache
by labzink Aug 12, 2026 6/10
app GitHub

Homing: Drive Your Home Coding Agent From Feishu or Telegram

Lets you trigger a coding agent on your home machine from Feishu, with two-stage confirmation before anything executes. Fully self-hosted with zero dependencies, and Telegram is supported as well.

feishutelegramremoteself-hosted
by roc-zjp Aug 12, 2026 6/10
app Reddit

A Context Ring Patched Into the Claude Code Webview Composer

The context counter only appears once roughly half the window is gone, and clicking it fires /compact with no confirmation. This patch adds a third composer button: a ring that fills as context does, with a live token count updating while Claude types, and clicking it runs /context instead. Implemented as a webview bundle patch because the composer toolbar exposes no extension point.

contextuipatchtokens
by Daniel_Design Aug 12, 2026 6/10
app GitHub

fantasy-2026: Agentic Decision Support for a Fantasy Football League

A decision-support system for a fantasy football league built from slash-command workflows, league scoring rules encoded explicitly, quantitative models trained on six seasons of raw data, and deterministic validators over the outputs.

fantasy-footballslash-commandsvalidatorsmodeling
by benirvin714 Aug 12, 2026 5/10
app GitHub

LakehouseDatabricks: A Medallion Lakehouse Built With Claude Code

A working Databricks build for an energy distributor's customer service area — medallion architecture, dashboard, and a conversational copilot — constructed with Claude Code and the AI Dev Kit skills. Documentation is in Portuguese.

databrickslakehousedashboardportuguese
by netoeugenio Aug 12, 2026 5/10
app GitHub

wasm-zero: An AI Agent Built a WebAssembly 2.0 Interpreter, FAIL=0

A from-scratch WebAssembly 2.0 interpreter in Rust, built end to end by an AI agent from a single spec input. It passes the full official test/core suite for wg-2.0 across 54,006 commands with zero failures, using fail-closed accounting, the official reference interpreter as an oracle, and six rounds of external review.

webassemblyrustinterpreteragent-built
by My-Denia Aug 12, 2026 8/10
app Reddit

aaabench: Headless Claude Code Building a City in Unreal Overnight

An MIT-licensed harness running Claude Code headless against a live Unreal Engine editor, given the open-ended goal of building a GTA-style city. It picks districts, roads, buildings, people, cars, and weather on its own, running in loops overnight — and since it forgets everything between sessions, it writes notes to its future self and builds its own tools when the available ones fall short.

unreal-engineheadlessautonomousgame-dev
by ukanwat Aug 12, 2026 7/10
app GitHub

funes: Durable, Searchable Memory of Past Agent Sessions

A Hugging Face project giving agents durable, searchable memory of their previous sessions, so past work is retrievable rather than lost when a session ends.

memorysearchsessionshugging-face
by huggingface Aug 12, 2026 8/10
app GitHub

charter (diazoxide): Personas and a Vault for Multi-Repo Agents

A control plane for running Claude Code across many repositories. It adds personas — role identities such as release or forge, each with committed memory and a scoped credential vault — plus per-task isolated workspaces so parallel work on several repos doesn't bleed together, and a vault that keeps credentials out of the transcript entirely.

multi-repopersonascredentialscontrol-plane
by diazoxide Aug 12, 2026 7/10
app GitHub

ecommerce-agentic-brand-manager: Inventory-Driven Campaigns

An agentic system built with Claude Code, Shopify, SendGrid, and Buffer that monitors inventory, judges how urgent each stock situation is, and launches multi-channel marketing campaigns in response.

shopifyecommercemarketingautomation
by rhain-r Aug 12, 2026 5/10
app GitHub

ferrisbar: A Rust Status Line With a Pre-Compaction Gauge

A Claude Code status line renderer written in Rust showing model, active task, directory, and a context gauge that warns you before auto-compaction hits.

statuslinerustcontextcompaction
by kerryhatcher Aug 12, 2026 6/10
app GitHub

erfana: Agent-Native Markdown Workspace Beside Your Editor

An open-source Markdown workspace designed around agents, letting you run Claude Code and other terminal coding agents right next to your editor. Available for macOS and Windows.

markdownworkspaceeditoropen-source
by qodeca Aug 12, 2026 6/10
app GitHub

wooi: Stackable Parallel Agent Runs, One Worktree Per Task

A macOS app that gives every task its own git worktree, branch, and Claude Code session so agents run genuinely in parallel — and lets you stack them when one piece of work builds on another.

macosworktreesparallelstacking
by youngminnnn Aug 12, 2026 6/10
app GitHub

overton: Admission Control for the Coding Agents You Pay For

Meters your Claude and Codex subscription windows, attributes spend to specific projects, and decides which agent is allowed to dispatch right now. Admission control rather than after-the-fact reporting.

quotaadmission-controlcostsubscriptions
by hookdump Aug 12, 2026 7/10
app Reddit

BanyanCode: Communicating Subagents in a Mesh-Engineered Harness

A free, open-source coding-agent harness testing whether the harness matters as much as the underlying model. It treats the repository as a graph — and increasingly the agents too: a primary orchestrator decomposes work across coder, explore, researcher, scout, and reviewer agents that can communicate with each other rather than running as isolated subprocesses.

harnessmeshsubagentsopen-source
by CoolHeadeGamer Aug 12, 2026 7/10
app GitHub

claude-video-digest: Any Video Into a Frame-Synced Digest

A Claude Code plugin turning any video into a readable digest: a timestamped contact sheet and a transcript synced to frames, with no hallucinated captions over silent stretches. Runs on ffmpeg plus local Whisper, so nothing leaves the machine and no API keys are needed.

videowhisperffmpeglocal
by anaidenko Aug 12, 2026 7/10
app GitHub

covey: Identity, Sandboxes, and Brokered Credentials for Agents

Treats AI agents like employees: each gets an identity, an isolated sandbox, brokered credentials, a backlog, and a place in an org chart, all under central guard rails. Ships as one Go binary plus Postgres, self-hosted.

identitysandboxcredentialsself-hosted
by benjaminLedel Aug 12, 2026 7/10
app GitHub

gaussian-memory-worker: Agent Memories as Kalman-Merged Distributions

A memory system for agent harnesses that stores memories as distributions with mean and covariance rather than fixed text, merging them with a Kalman filter and retrieving via Bhattacharyya distance with spreading activation.

memoryretrievalresearchharness
by LohitJaga Aug 12, 2026 6/10
app GitHub

weave-claude-code: Trace Sessions, Tool Calls, and Subagents to W&B Weave

A Claude Code plugin from Weights & Biases that pipes session activity into W&B Weave. Every tool call and subagent invocation becomes a trace you can inspect, so you can see where a long agent run actually spent its time. Useful if you are debugging flaky autonomous sessions rather than guessing from terminal scrollback.

observabilitytracingpluginweavedebugging
by wandb Aug 12, 2026 8/10
app GitHub

zodiac: TUI Multiplexer for Running Several AI Agents Side by Side

A terminal UI that multiplexes multiple AI agent sessions into one pane-managed view. Instead of juggling tmux windows by hand, you get a single surface for launching and switching between concurrent agents. Fits the parallel-agent workflow where several tasks run at once.

tuimultiplexerparallel-agentsterminal
by pr0vId3nce Aug 12, 2026 7/10
app GitHub

chatban: Two-Layer Kanban + Chat UI Where the AI Only Proposes

A Japanese-language app (AI HACK 2026 entry) that turns a conversation directly into task management, layering a kanban board over a chat thread. The design rule is deliberate: the AI suggests cards and moves, but only a human commits them. An interesting take on keeping a person in the loop without slowing the conversation down.

kanbantask-managementhuman-in-the-loopui
by zio3 Aug 12, 2026 5/10
app Reddit

Naming CLI via headless claude -p, and two nested-claude gotchas

A CLI that loops an LLM to generate startup names and checks real domain availability over RDAP, feeding taken/available results back into the next round. It runs on a Max subscription by shelling out to headless claude -p and strips ANTHROPIC_API_KEY from the subprocess env so it cannot silently switch to API billing. The write-up's real payload is two nested-claude bugs: child processes inherit CLAUDE_CODE_EFFORT_LEVEL from the parent session, which made every subprocess think for 8+ minutes and time out.

headlessclaude-psubprocessrdapgotchas
by heeeeyYaaa Aug 12, 2026 7/10
app Reddit

html-marketing: Have Agents Write HTML and Render It into Store Assets

Instead of calling an image model, you have Claude Code or another agent write HTML that gets rendered into App Store, Google Play, Chrome Web Store, and social images and video. The author argues the output looks more natural and costs less than generated imagery. Open source and free.

marketinghtmlrenderingassetsopen-source
by Either-Grade-9290 Aug 12, 2026 6/10
app Reddit

Nomai: Linux Tiling Manager and Unified Workspace for Terminal AI Agents

Nomai is a Linux tiling window manager built specifically for running terminal AI agents side by side instead of juggling separate terminals and scattered configs. It runs Claude Code and Codex under your actual logged-in accounts rather than raw API keys, and adds multi-account switching and safer execution. The author is recruiting early testers.

linuxtilingmulti-agentterminal
by Noam8271 Aug 11, 2026 7/10
app GitHub

spendwatch: Token and Cost Leaderboards Across Claude Code and Codex

spendwatch ranks where your tokens and dollars actually go across coding agents, broken down by tool call, command and prompt. The point is actionability: seeing which repeated operations dominate spend tells you what to automate away or fix. Covers both Claude Code and Codex.

tokenscostanalyticscodex
by edihasaj Aug 11, 2026 7/10
app GitHub

yraverage-officeaddins: Excel Add-Ins Generated From a Plain Description

Turns a plain-language description of Excel tools into a .xlam add-in with its own ribbon tab, plus a single self-installing .xlsm that colleagues open once and click. Designed to be driven by an AI assistant, with the spec validated against the generated VBA source before Excel is ever launched.

excelvbaofficecodegen
by yraveragework Aug 11, 2026 5/10
app GitHub

eliviz: Turn Any Data File Into a Single-File Interactive HTML Report

A Claude Code plugin that converts a data file into a self-contained interactive HTML experience, with switchable design identities so the same data can be presented in different visual styles. Single-file output makes it easy to share or embed without a build step.

plugindatavizhtmlreporting
by costiash Aug 11, 2026 6/10
app GitHub

alexandria: Local Knowledge Vault That Persists Agent Memory

A local-first knowledge vault that agents read from and write to, so context survives across sessions instead of being rediscovered every time. The pitch is token savings plus more consistent behavior — the vault carries the conventions and decisions the model would otherwise have to re-derive.

memoryknowledge-baselocal-firsttokens
by UreckChan Aug 11, 2026 6/10
app GitHub

agent-lens: Lightweight Viewer for Coding Agent Data and Metrics

A small tool for inspecting agent session data and metrics, built so it can be pointed at agents beyond Claude when needed. Worth a look if existing dashboards are heavier than what you want for basic visibility.

metricsobservabilityanalytics
by SWEStash Aug 11, 2026 5/10
app GitHub

Catalyst: Desktop IDE Running Claude Code, Codex and Gemini CLI

A desktop IDE built around coding agents rather than editing: run Claude Code, Codex and Gemini CLI across all your git repositories from a single window. Aimed at people who keep many repos in flight and want one surface for agent work instead of a terminal per project.

idedesktopmulti-agentgit
by OLI-Systems Aug 11, 2026 7/10
app GitHub

doublure: Pseudonymisation Proxy Between Claude Code and the API

A bidirectional proxy that pseudonymises data flowing from Claude Code to the Anthropic API and restores it on the way back, so identifiers never leave your network in the clear. Built by France's SocialGouv, which suggests it is aimed at real compliance requirements rather than being a demo.

privacyproxypiicompliance
by SocialGouv Aug 11, 2026 8/10
app GitHub

not-codex: Local-First Open-Source Control Plane for Coding Agents

A local-first control plane for managing coding agents, kept open source and off any hosted service. Fills the same slot as commercial agent dashboards for people who want the coordination layer running on their own machine.

control-planelocal-firstorchestrationopen-source
by MaTriXy Aug 11, 2026 6/10
app GitHub

pm-job-search: Claude Code Plugin for Running a Senior PM Job Search

A plugin that runs a product-leadership job search end to end: finding open roles, scoring fit, tracking the pipeline, running live interview practice, and acting as a blunt career coach. Markdown by default, with an optional browser dashboard and MCP integrations layered on top.

careerjob-searchplugininterview
by archugunov Aug 11, 2026 6/10
app GitHub

termino: Terminal UI Component Library for CLI Agent Interfaces

A component gallery and library for building terminal UIs for CLI agents — charts, controls, and a neomorphic agents kit — built on @opentui/react. Handy if you are writing your own agent front end and want it to look like Claude Code or opencode rather than raw scrolling text.

tuicomponentsopentuireact
by SandroHub013 Aug 11, 2026 6/10
app GitHub

trapstreet-tasks: Open Evaluation Tasks and Judges for Agents and Skills

An open set of evaluation tasks for AI agents, skills and tools — each with inputs, expected outputs and a judge — so any candidate solution can be scored and ranked on trapstreet.run. Fills a real gap: most skills ship with claims but no way to measure them.

evalsbenchmarkjudgingopen-source
by trapstreet Aug 11, 2026 6/10
app GitHub

agentic-plugins: Public Claude Code Marketplace of Skills and Agents

A public plugin marketplace of installable Claude Code skills and agents, added with a single command. Worth browsing if you would rather pull capabilities in on demand than maintain your own collection.

marketplacepluginsskillsagents
by theagenticguy Aug 11, 2026 5/10
app GitHub

grove: Agent Worktree Manager Built on tmux

Manages git worktrees for coding agents on top of tmux, so several agents can work on isolated checkouts of the same repo with a pane each. Lightweight compared to desktop agent managers — it leans on tools you already run in the terminal.

tmuxworktreegitmulti-agent
by tristandunn Aug 11, 2026 7/10
app GitHub

tracebook: Evidence-Backed Project Memory in Plain Markdown

Local-first persistent memory for coding agents, stored as Markdown files in the repo with no server involved. Each memory is tied to evidence from the codebase, so context carries across sessions without drifting into unverified claims.

memorycontextmarkdownlocal-first
by tydandou Aug 11, 2026 7/10
app GitHub

sancho: A Claude Code Harness for People Whose Job Is Not Code

Wraps Claude Code for non-developers, hiding the parts of the workflow that assume you are a working engineer. Aimed at people who want the agent to do useful work in a repo without first learning the developer tooling around it.

harnessnon-developersaccessibilityonboarding
by facunicedev Aug 11, 2026 6/10
app GitHub

pieces-to-agents: Convert Pieces Long-Term Memory Into AGENTS.md

Exports your Pieces Long-Term Memory into an AGENTS.md file that coding agents can read directly. Runs entirely locally and takes a redaction-first approach, so captured history gets scrubbed before it lands in a file that agents load.

memoryagents-mdpieceslocal-onlyprivacy
by tiagolauer Aug 11, 2026 6/10
app GitHub

skiller: Desktop Skills Manager for Claude Code, Cursor, and Codex

A desktop app for installing, syncing, and managing agent skills across multiple tools from one place, covering Claude Code, Cursor, and Codex. Useful once your skill collection outgrows hand-copying directories between projects and assistants.

skillmanagementdesktop-appcross-toolsync
by beautyfree Aug 11, 2026 7/10
app GitHub

gemini-plugin: Gemini as a Second Opinion Inside Claude Code

A Claude Code plugin that adds Gemini-backed validator, challenger, researcher, and summarizer subagents, plus hooks that invoke them automatically. Gives you an independent model challenging Claude's conclusions at points you choose rather than only when you remember to ask.

plugingeminisubagentshookssecond-opinion
by azmym Aug 11, 2026 7/10
app Reddit

plothole: Find duplicate and drifting instructions inside your CLAUDE.md

A Python script that reads one long-lived document (CLAUDE.md, a spec, a design doc) and prints where it contradicts or repeats itself. It reports "wormholes" (far-apart passages saying the same thing, with both ends quoted and the shared lemmas), "seams" (adjacent sentences that force a mental jump, or distant ones that blend together), and a drift score over every sentence pair. Useful if your context docs have accreted months of appended rules that now disagree with each other.

claude-mdcontext-engineeringdocumentationpythonanalysis
by Clear_Sights Aug 11, 2026 7/10
app GitHub

via: Neovim wrapper for driving AI coding agents without leaving the editor

Wraps nvim and AI agents together so agent sessions run alongside your buffers instead of in a separate terminal. Targets people who want the agent loop inside their existing Neovim workflow rather than switching windows to a CLI.

neovimeditorintegrationtui
by filipenf Aug 11, 2026 6/10
app Reddit

Single-Page HTML App for Comparing Senior Living Facilities, Built with Claude Code

A walkthrough of using Claude Code with Opus 5 to build a self-contained HTML page for researching care options for an aging parent. Covers scraping a lead-generation directory, merging in government ratings and costs, and turning it into a sortable comparison tool. A useful example of throwaway personal tooling that would never justify a real project.

case-studyhtmldata-collectionpersonal-tools
by hayes-davis Aug 11, 2026 5/10
app GitHub

wtx: One microVM per Git Worktree for Collision-Free Parallel Agents

Runs each git worktree inside its own Lima/vz microVM with an in-VM dockerd, so parallel coding agents never fight over ports, databases, or container images. New worktree VMs can be seeded from existing ones with their database data intact. Positioned as an open-source alternative to Docker Sandboxes.

worktreemicrovmsandboxparallel-agentsdocker
by rakutek Aug 11, 2026 8/10
app GitHub

claude-pet: Linux Desktop Pet That Reacts to Claude Code Session State

A desktop pet for Linux rendered from codex-pets.net sprite packs that animates based on what your Claude Code session is doing. Idle, thinking, and working states each get their own behavior. Pure fun, but a surprisingly readable ambient status indicator.

desktoplinuxfunsession-state
by HaneulOscarLee Aug 11, 2026 6/10
app GitHub

tasq: Local-First Task Tracking Humans and Agents Can Share

A task tracker designed so a person and an AI agent can both read and write the same list without clobbering each other. Everything stays local, with no server or account. Fills the gap between ad-hoc TODO comments and a full issue tracker.

task-trackinglocal-firstcollaborationagents
by gwendall Aug 11, 2026 6/10
app GitHub

causeway: Slack Bot Boilerplate for Driving Claude Code From Mentions and DMs

A starter template for a Slack bot that runs Claude Code sessions triggered by mentions or direct messages. Gives a team a shared entry point to an agent without everyone needing terminal access. Documentation is primarily in Korean.

slackbridgeremote-controlboilerplate
by juunzzi Aug 11, 2026 6/10
app GitHub

tmux-ccm: tmux Attention Manager for Parallel Claude Code Sessions

A tmux plugin that detects the live state of every Claude Code pane and surfaces which one is actually waiting on you. Includes a dashboard and cross-project messaging between sessions. Solves the core problem of running many agents: knowing where to look next.

tmuxparallel-sessionsdashboardmonitoring
by yohasebe Aug 11, 2026 8/10
app GitHub

openai-claude-wrapper: OpenAI-Compatible HTTP API in Front of Claude Code

Wraps Claude Code behind an OpenAI-compatible HTTP endpoint, packaged as a Docker container with a full FastAPI surface. Handles text, images, audio, video, and file inputs. Lets existing OpenAI-SDK apps point at Claude Code with no client changes.

apidockerfastapicompatibilityopenai
by Grumbly4308 Aug 11, 2026 6/10
app GitHub

wondev: Write Agent Knowledge Once, Compile It to Every Config Format

Keeps a single source of truth for agent instructions and compiles it out to CLAUDE.md, AGENTS.md, .cursor/rules, and other formats. Removes the drift that comes from hand-maintaining the same rules in four files. Practical for teams using more than one coding agent.

configportabilityclaude-mdagents-md
by wondping0 Aug 11, 2026 7/10
app GitHub

agent-marketplace: One Storefront for a Developer's Plugins and Skills

A curated marketplace collecting every plugin, skill, and tool one developer ships for Claude Code and Codex CLI. Also hosts an idea-nursery where early macOS tools incubate before getting their own repo. Useful as an example of packaging a personal plugin catalog.

marketplacepluginsskillsmacos
by joeblackwaslike Aug 11, 2026 5/10
app GitHub

agentscan: Offline Scanner Checking Agent Skills for Prompt Injection and Malware

A deterministic scanner that inspects an agent skill for prompt injection, hardcoded secrets, unexpected network calls, and malware patterns before you install it. Runs entirely local and offline, and never executes the skill it is analyzing. Rule-based rather than model-based, so results are reproducible.

securityprompt-injectionskillsofflinesupply-chain
by thesfb Aug 11, 2026 8/10
app GitHub

tammai-tools: Plugin for HTML Slide Decks, SVG Diagrams, and PDF Export

A Claude Code plugin for workshops and presentations that generates self-contained HTML decks on a consistent design system. Also produces soft flat SVG visuals — flowcharts, architecture diagrams, wireframes, mindmaps, org charts, sequence diagrams, Gantt and kanban boards, journey maps — and exports decks to print-ready PDF. Everything stays as files you can edit.

pluginslidesdiagramssvgpdf
by tammai Aug 11, 2026 7/10
app GitHub

Soul-Brews: Mission Control Showing Which Parallel Session Needs You

Supervises several Claude Code sessions at once and highlights which one is blocked waiting on human input. Presents them as a single mission-control view. Same problem space as tmux-based attention managers, with a standalone UI instead.

parallel-sessionsdashboardmonitoring
by Saeed04-dev Aug 11, 2026 6/10
app GitHub

WiseTalk: Router Plus Eight Expert Agents for Workplace Communication Coaching

An AI-native workbench for workplace communication coaching built as one router plus eight expert agents and nine reusable skills. Includes a deterministic two-front security gateway combining a prompt-injection filter and a hallucination gate. Apache-2.0 with no third-party dependencies.

multi-agentskillsprompt-injectioncoaching
by ay4322-a11y Aug 11, 2026 5/10
app GitHub

claude-persist: Claude Code Sessions in VS Code That Survive Browser Refreshes

A server-side daemon plus chat extension that keeps Claude Code sessions alive in VS Code and code-server across browser reloads. Solves the specific pain of losing a long-running session when the tab reconnects. Aimed at remote and containerized development setups.

vscodecode-serverdaemonsessionsremote
by jagajaga Aug 11, 2026 7/10
app GitHub

agentx: Self-Hosted AI Ops Layer Routing Chat, Cron, and Webhooks to Agents

Routes Telegram, WhatsApp, Slack, Discord, GitLab, cron jobs, webhooks, and mesh tasks to AI agents backed by Claude, OpenAI, or any LLM. Ships a web wizard for non-technical operators alongside a CLI for engineers. Fully self-hosted and aimed at small and medium businesses.

self-hostedautomationmessagingoperations
by anis-marrouchi Aug 11, 2026 6/10
app GitHub

axtory: Local-First Agent Analytics That Ties Every Number to Its Evidence

Analytics for AI coding agents that reads only official interfaces and keeps each reported number linked to the evidence behind it. When data cannot be collected it says so rather than displaying a misleading zero. Runs local-first.

analyticslocal-firstobservabilityevidence
by east-true Aug 11, 2026 6/10
app GitHub

Recall: Local-First Search Across Your AI Coding Sessions

Searches across sessions from multiple AI coding agents so switching tools does not mean losing your history. Runs local-first with no upload. Answers the recurring 'I solved this before, but in which agent?' problem.

searchsessionsmemorylocal-first
by samzong Aug 11, 2026 7/10
app GitHub

claude-code-viewer: Full-Featured Web Client for Claude Code Projects

A web-based client offering complete interactive functionality for managing Claude Code projects, not just a read-only session viewer. Lets you drive sessions from a browser instead of a terminal. Mature enough to serve as a daily driver interface.

web-uiclientsessionsbrowser
by d-kimuson Aug 11, 2026 8/10
app GitHub

kaos-control: Single-Binary Orchestrator Driving Agents Through a Role-Gated SDLC

A self-hosted Go binary that moves ideas through plan, build, test, and release phases with role gates between them. Each agent runs sandboxed, runs stream live, and markdown files on disk stay the source of truth. No database or cloud service required.

orchestratorsandboxgosdlcself-hosted
by kcsinclair Aug 11, 2026 7/10
app GitHub

iiwi: Session Intelligence That Surfaces What Mattered in Agent Runs

Probes coding-agent sessions and extracts the work that actually mattered from the noise of a long transcript. Aimed at engineering visibility across many runs. Complements raw session viewers by summarizing rather than replaying.

analyticssessionsobservability
by mike840609 Aug 11, 2026 6/10
app GitHub

byori: Run Claude Code and Codex Side by Side Over Shared Graph Memory

A multi-agent coding workspace where Claude Code and Codex operate against a shared ByoriDB graph memory of the project. Both agents see the same accumulated understanding rather than rebuilding context separately. The shared graph is the core idea.

multi-agentmemorygraph-dbworkspace
by byoridb Aug 11, 2026 6/10
app GitHub

lanes: Read-Only Coordination and Situational Awareness for Local Agents

Tracks what every AI agent on your machine is doing and reports it, with a deliberate constraint that it never acts on its own. Gives you a coordination view without adding another actor to the system. The report-only posture is the design decision.

coordinationmonitoringmulti-agentread-only
by Agenxy Aug 11, 2026 6/10
app GitHub

codex-host: Run Claude Code Directly Inside Codex Desktop

Lets Claude Code and Pi run inside the Codex Desktop application. Useful if Codex Desktop is your primary environment but you want Claude Code's behavior. Bilingual English and Chinese documentation.

integrationdesktopcodex
by BytePioneer-AI Aug 11, 2026 5/10
app GitHub

memgov: Gate What an Agent's Persistent Memory Is Allowed to Assert

Applies governance to the memory layer so a stored claim must be validated before the agent is allowed to rely on it. Transplants RCGov's InjectContext-implies-ContextReady axiom onto Claude Code and Codex memory. Addresses memory poisoning rather than memory capacity.

memorygovernancesafetyvalidation
by mobius-style Aug 11, 2026 6/10
app GitHub

claude-omni-rc: Continue Claude Code Sessions From Telegram, Approvals Included

A local daemon plus Telegram bot that lets you continue a running Claude Code CLI session from your phone, including chatting and approving permission prompts. Supports Claude itself, Ollama, and other LLMs behind the CLI. The permission approval flow is what makes it usable rather than just a log viewer.

telegramremotemobiledaemonapprovals
by ontech7 Aug 11, 2026 7/10
app GitHub

bibguard: Verify Citations Before They Are Written Into Your .bib

Checks a citation before it lands in your bibliography, finds where each paper was actually published, and normalizes the whole file to one format. Stdlib-only Python with no pip install and no API key. Direct countermeasure to hallucinated references in AI-assisted writing.

researchcitationslatexpythonverification
by RanchoGoose Aug 11, 2026 6/10
app GitHub

pier: Give Every Agent Session Its Own VM, Idle at Zero Cost

Spins up a dedicated VM per agent session with a single command, and stops burning resources when the session goes idle. Gives real isolation rather than container-level separation. Same problem as worktree sandboxing, solved a level down.

vmsandboxisolationcost
by usepier Aug 11, 2026 7/10
app GitHub

agent-finops: Local Cost Analytics for Claude Code With Nothing Uploaded

Cost and usage analytics for Claude Code that runs entirely locally, sending neither logs nor source code anywhere. Useful where privacy policy rules out hosted usage dashboards. Focused on spend attribution.

costanalyticsprivacylocal-first
by YiftachCohen Aug 11, 2026 6/10
app GitHub

wsl-cdp: Drive Your Logged-In Windows Browser From WSL2 Over CDP

Controls a real Chrome, Edge, or Brave profile on Windows from WSL2 via the Chrome DevTools Protocol, using a dedicated hardened agent profile. Includes a one-time elevated setup and a doctor command for health checks. Solves browser automation for the common WSL2 development setup.

wslbrowsercdpautomationwindows
by StartupBros-com Aug 11, 2026 7/10
app GitHub

PromptShrink: Prompt Preprocessor That Cuts Tokens Before They Are Sent

A preprocessing layer that compresses prompts before they reach the model, packaged with a broader LLM engineering suite. Aims at direct cost reduction on high-volume workloads. Portuguese-language documentation.

tokenscostpreprocessingoptimization
by HeloisaPeGarcia Aug 11, 2026 5/10
app GitHub

yaps-plugins: Local-First Dictation, Transcription, and Voice Plugins

Claude Code plugins for dictation, transcription, meeting notes, captions, voice, translation, and memory, all running local-first. Lets you talk to a session instead of typing. Audio never leaves the machine.

pluginvoicedictationtranscriptionlocal-first
by richawo Aug 11, 2026 6/10
app GitHub

yesmem: Persistent Memory With Learning Extraction for Coding Agents

A memory system for Claude, OpenCode, and Codex offering effectively unbounded context, extraction of learnings from past sessions, and persona modeling. Goes past raw storage into deriving reusable lessons. Works across multiple agent CLIs.

memorypersistencemulti-agentcontext
by carsteneu Aug 11, 2026 6/10
app GitHub

cc-token-doctor: Static Auditor That Tells You What Is Wasting Tokens

Statically audits a Claude Code setup and prescribes what to change, with honest impact estimates rather than vague advice. Points at specific config, files, and patterns responsible for token waste. Zero dependencies.

tokenscostauditoptimization
by awaistechnologist Aug 11, 2026 7/10
app GitHub

TokenRadar: macOS Menu Bar App for Agent Token Usage and Run Status

A macOS menu bar app tracking token usage and spend across AI agent tools, showing remaining subscription quota and a status light reflecting whether a task is currently running. Read-only and fully local. The status light doubles as an ambient indicator for background sessions.

macostokensmonitoringmenu-bar
by shibanyu333 Aug 11, 2026 6/10
app GitHub

dashboard-kit: Analytics Design System as a Claude Code Plugin

A captured, reusable design system for data and analytics dashboards, installable as a Claude Code plugin. Includes design tokens, a Tailwind theme, Tremor and Recharts conventions, and drop-in StatCard and DataTable components. Gives an agent a consistent visual target instead of improvising each dashboard.

plugindesign-systemdashboardstailwindrecharts
by nickheise Aug 11, 2026 6/10
app GitHub

cc-router: Bundle Scattered Token and API Plans Into One Virtual Plan

Aggregates separate token plans, coding plans, and model API quotas into a single virtual plan that Claude Code, Claude Desktop, OpenClaw, and OpenCode can all point at. Runs fully locally. Useful if you hold credit across several providers and want it pooled.

routercostlocalproxyquota
by finch-xu Aug 11, 2026 6/10
app GitHub

inhouse: Portuguese-Language App Builder Driven by Your Claude Code Subscription

A local app-building pipeline that runs on an existing Claude Code subscription instead of an API key, with a task conveyor, human approval gates, and delivery as a Pull Request. The interface and documentation are in Brazilian Portuguese. Aimed at people who want supervised, reviewable AI app generation without per-token billing.

app-builderportuguesepull-requesthuman-in-the-loop
by marlonwlv Aug 11, 2026 5/10
app GitHub

nanocode: A Minimal Claude Code Alternative for Agentic Coding

A lightweight agentic coding CLI built around a deliberately small codebase. It aims to cover the core agent loop and solid terminal capabilities without the surface area of larger tools. Worth a look if you want a compact reference implementation to read or fork.

cliagentic-codingalternativeminimal
by ahmedbouuu223-coder Aug 11, 2026 5/10
app GitHub

friday-ai: Cross-Repo AI Dev Automation Platform With Feishu Integration

An open-source platform linking requirements, workflows, code repositories, and coding agents so an approved requirement is carried through to an auditable PR/MR. It integrates deeply with Feishu (Lark) Projects, Space, and Docs, and supports requirement-driven self-iteration. Documentation is in Chinese.

automationfeishumulti-repopull-request
by friday-ai-codes Aug 11, 2026 5/10
app GitHub

llm-wiki: Local-First Markdown Memory Shared Across Coding Agents

A local markdown vault that captures sessions and compiles them into notes, giving agents persistent memory with no cloud service involved. It works across OpenCode, Claude Code, Codex, and Cursor, so context follows you between tools. Everything stays in plain files you own.

memorymarkdownlocal-firstmulti-tool
by Ekgardt Aug 11, 2026 6/10
app GitHub

claude-memory-light: Full Session Memory for Claude Code in One Rust Binary

Adds persistent session memory to Claude Code as a single small Rust binary — no daemon to run and no extra LLM calls to pay for. It retains the full session rather than a summarized slice. A low-overhead option if heavier memory servers feel like too much machinery.

memoryrustlightweightsessions
by MiracleWeb3 Aug 11, 2026 7/10
app GitHub

Pulse: Static Security and Policy Audit for AI Agent Frameworks

Scans agent codebases for security posture and policy violations, reporting each finding with a link back to the exact source line. Coverage includes LangGraph, AutoGen, CrewAI, the OpenAI Agents SDK, MCP, and more than ten other frameworks. Worth running before shipping an agent that touches credentials or external systems.

securityauditmcpstatic-analysis
by ali-ulu Aug 11, 2026 7/10
app Reddit

hooop: Collaborative Claude Code Sessions in a Docker Sandbox

hooop runs Claude Code inside a disposable Docker sandbox and fronts it with a live dashboard on localhost:7842, so only Docker and jq are needed on the host. Teammates join over an anonymous cloudflared tunnel as full, drive, or spectate peers and co-drive the same transcript from a laptop or phone. Adds read-only /plan runs with an inline-comment review panel, docked live UI previews, an SSE event tail, sub-agent tree, and a diff viewer.

collaborationdockersandboxpair-programmingdashboardplan-review
by Specific_Music_234 Aug 10, 2026 8/10
app GitHub

claude-memory-tidy: Keep MEMORY.md From Silently Truncating

A maintenance tool for Claude Code's always-loaded MEMORY.md, which silently truncates once it outgrows its budget. It enforces a budget guard, checks orphan coverage, and folds verbatim domain content into hub files. The mechanical parts are deterministic with no LLM in the loop, so runs are repeatable.

memoryclaude-mdcontextmaintenancedeterministic
by tonydzi Aug 10, 2026 7/10
app GitHub

agent-history: Local Semantic Search Over Your AI Agent Session Transcripts

Indexes your Claude Code and other AI coding agent session transcripts and makes them semantically searchable on your own machine. Embeddings come from Ollama and vectors are stored in sqlite-vec, so nothing leaves the box. Useful when you remember solving a problem in some past session but cannot recall which project or day it was.

searchtranscriptsollamasqlite-veclocal-first
by d3layd Aug 10, 2026 7/10
app GitHub

code-server Dev Container with Claude Code CLI, ai-jail, and Rootless Docker

A code-server development container you drop into a monorepo as a git submodule at .code-server/. It ships the Claude Code CLI, an ai-jail sandbox layer, nested rootless Docker, and selectable tech stacks. Aimed at giving agents a contained environment that still has real tooling.

devcontainercode-serversandboxdockerisolation
by TheHefty Aug 10, 2026 6/10
app GitHub

claude-afk: Continue a Live Claude Code Session from Telegram

Lets you step away from your desk and keep talking to a running Claude Code session through Telegram. Notably has zero dependencies and needs no tmux and no background daemon. Handy for long unattended runs where you only need to answer the occasional prompt.

telegramremotemobilesessionsnotifications
by Pupok462 Aug 10, 2026 7/10
app GitHub

meus-salvos: Turn Instagram Saved Posts Into a Library Claude Can Read

Converts your saved Instagram posts into a local library that Claude can read and work with. Runs entirely on your machine, is free, and does not ask for your password. Documentation is in Portuguese.

instagramlocal-firstpersonal-dataportuguese
by ojoaobranco Aug 10, 2026 5/10
app GitHub

fama: Local Live Dashboard and Voice Narration for Claude Code

A privacy-first dashboard that shows what your Claude Code agent is doing in real time, and can speak it aloud. Runs locally with no telemetry and no required API calls. Aimed at long agent runs where you want ambient awareness without staring at a scrolling terminal.

dashboardobservabilityvoicelocal-firstmonitoring
by mrktchris Aug 10, 2026 7/10
app GitHub

secretsd: Terminal Credential Broker for Agentic Workflows with SOPS+age

A terminal credential platform built for agent workflows and note vaults, using SOPS and age for encryption. Adds agent provenance tracking and a session broker so a running agent gets scoped access instead of raw secrets. Addresses the awkward gap between keeping secrets safe and letting an agent actually use them.

secretssecuritysopsagecredentials
by archn3m3sis Aug 10, 2026 6/10
app GitHub

horsie: Open-Source Agent Harness with Durable Sessions and Sandboxes

A self-hosted managed harness for LLM coding agents: sessions survive restarts, each session gets its own sandbox, and runs can proceed unattended. Everything runs on infrastructure you own with model keys you control. A self-hosted alternative to hosted agent-runner services.

harnesssandboxself-hostedunattendedsessions
by blossomstack Aug 10, 2026 7/10
app GitHub

claude-artifact-viewer: Windows folder-watching viewer for Claude Code artifacts

A WPF/WebView2 desktop panel for Windows that watches a folder and renders whatever Claude Code writes into it. Handles markdown, HTML, Mermaid diagrams, PDFs, and images, updating live as files land. Fills the gap for Windows users who want an artifact preview pane alongside the terminal.

windowsartifactsmarkdownmermaidviewer
by claudecraft Aug 10, 2026 7/10
app GitHub

Resume-Builder: resume generator plugin with dual ATS and HR scoring

A Claude Code plugin that drafts resumes and cover letters, then scores them twice: once against ATS keyword parsing and once against how a human reviewer would read it. Profession-agnostic rather than tuned to software roles.

resumepluginjob-search
by jananthan30 Aug 10, 2026 5/10
app GitHub

nexus: plugin-first terminal workspace for Claude Code and Codex

A terminal workspace that layers planning, CI/CD debugging, reusable agents, skills, and TODO tracking on top of Claude Code and Codex, with MCP tool integration. Everything is a plugin, so you compose the pieces you actually want rather than adopting a whole framework.

workspacepluginsmcpagents
by aayushostwal Aug 10, 2026 6/10
app GitHub

OmniToken: cross-device token accounting for Claude Code in a single Go binary

Self-hosted token accounting that aggregates Claude Code and Codex usage across every machine you work on, shipping as one Go binary with an embedded dashboard and a single SQLite file. Worth a look if your usage is split across a laptop, a desktop, and a server and per-machine tools only show you a slice.

tokensself-hostedgosqlitedashboard
by SuooL Aug 10, 2026 7/10
app Reddit

Rate-limit usage in the Claude Code status line, including window reset time

A single Python script that puts 5-hour and 7-day rate-limit usage in the status line, plus the reset time for the 5-hour window. The reset clock is the point: 62% used means something very different with four hours left than with twenty minutes. No network calls or dependencies, since Claude Code already passes rate limits to the status-line command on stdin.

statuslinerate-limitspythonno-dependencies
by sina158 Aug 10, 2026 7/10
app Reddit

sidetap: let Claude control a real iPhone from Windows

An open-source phone harness that lets an agent see and drive a real iPhone from a Windows desktop, with no Mac, Xcode, Appium server, or jailbreak required, and a free Apple ID. A Windows counterpart to the Mac-only harnesses that have circulated for iOS agent testing.

iosautomationwindowsopen-source
by SIGH_I_CALL Aug 10, 2026 8/10
app GitHub

ai-website-cloner-template: clone a website with one agent command

A project template that points a coding agent at a URL and has it reproduce the site's structure and styling locally. Aimed at bootstrapping a design starting point rather than producing a pixel-exact copy.

templatewebscaffolding
by JCodesMore Aug 10, 2026 5/10
app GitHub

rubato: run Claude Code in the browser with a self-setup multi-session hub

Unzip, double-click, and it installs its own engine, signs you in through the browser, and gives you a multi-session task hub. Includes a network check that offers a workaround when connectivity to the API is blocked. Aimed at people who want Claude Code without terminal setup.

browsermulti-sessioninstaller
by lingxiao10 Aug 10, 2026 6/10
app GitHub

grillboard: browser-based decision-tree interviews that write docs back

Runs requirement-gathering interviews as a live decision tree in the browser, with no MCP round-trip, then writes the resulting documents back for your main Claude Code session to use. Keeps the interrogation phase out of your main context window.

browserrequirementsinterviewdocs
by wayne930242 Aug 10, 2026 6/10
app GitHub

XAFLogicExplainer: extract DevExpress XAF app logic for coding agents via Roslyn

Uses Roslyn to extract entities, controllers, business rules, and Model Editor customizations from a DevExpress XAF application into a form a coding agent can read. Niche, but XAF's conventions are exactly the kind of implicit structure agents guess wrong about.

dotnetroslynxafcontext
by peopleworks Aug 10, 2026 5/10
app GitHub

sesame: broker authenticated HTTP requests so agents never see credentials

A CLI that proxies authenticated HTTP requests through a broker you control, so the agent can call APIs it has no credentials for. The key never enters the transcript or the model's context. Addresses the awkward reality that most useful API work currently requires handing an agent a live token.

securitycredentialsproxycli
by getsesame Aug 10, 2026 7/10
app GitHub

mulpex: macOS app running parallel Claude Code sessions with per-file locking

A native macOS app that runs several Claude Code sessions against the same project directory in one window, with per-file locking and live cross-instance coordination and messaging. The locking is what makes same-directory parallelism survivable without worktrees.

macosparallelcoordinationlocking
by gididaf Aug 10, 2026 7/10
app GitHub

harness-ai-kit: package manager for skills, CLIs, MCPs, and loops across agents

Treats agent assets as packages: install, update, and pin skills, CLIs, MCP servers, and loops across Codex, Claude Code, Cursor, and Kiro from one manifest. The cross-agent scope is the interesting part, since most asset managers assume one host.

package-managerskillsmcpcross-agent
by seed-forge Aug 10, 2026 7/10
app GitHub

AuditSentry: smart contract security auditing for Claude Code with exploit PoCs

A Claude Code setup for auditing Solidity and Vyper contracts on EVM chains: automated vulnerability detection, generated exploit proof-of-concepts, mainnet-fork simulation, and formatted audit reports. The fork simulation means findings are demonstrated, not just asserted.

securitysolidityauditevm
by iktok90-design Aug 10, 2026 6/10
app GitHub

Sensei: self-hosted gateway that compresses prompts before they leave

A self-hosted workspace and drop-in gateway that compresses prompts locally before they hit the API, with a measured 79% token reduction. Works with Claude Code, Cursor, Aider, and any OpenAI or Anthropic client, and also ships an MCP server. MIT, no telemetry.

compressiongatewayself-hostedmcp
by SenseiIssei Aug 10, 2026 6/10
app GitHub

session-optimizer: prompt refinement, context guard, and telemetry plugins

A portable refine-gate that binds vague prompts to concrete evidence before they run, working across Codex, Gemini CLI, and Claude Code, plus Claude-native plugins for a context guard and telemetry status line. Optional hooks enforce checkpoints, track subagent spend, and surface quota telemetry.

promptshooksstatuslinetelemetry
by cdeust Aug 10, 2026 6/10
app GitHub

bosun: tmux-native orchestrator for AI agent sessions in Rust

A Rust and ratatui TUI that manages agent sessions natively inside tmux rather than fighting it. If your existing workflow is already tmux panes full of agents, this formalizes it.

tmuxrustorchestrationtui
by yetidevworks Aug 10, 2026 7/10
app GitHub

agent-notify: show coding agent status on a UHK80 keyboard OLED

A server plus Windows bridge that pushes coding agent status to the OLED display on an Ultimate Hacking Keyboard 80. Very specific hardware, but a nice example of getting agent state out of the terminal and into peripheral vision.

notificationshardwarestatus
by glslang Aug 10, 2026 5/10
app GitHub

tracelens: local-first browser debugger for AI agent traces

Opens agent execution traces in the browser with a call tree, flamegraph, diff view, search, and shareable links, running entirely client-side with no backend. Handy for figuring out where a multi-agent run actually spent its time.

tracesdebuggingflamegraphlocal-first
by YuLeo926 Aug 10, 2026 7/10
app GitHub

nextcourse: an agent that designs courses before it generates slides

Works through positioning, learning outcomes, and knowledge structure first, then derives a Reveal.js deck from that structure. The author is explicit that it is not a slide generator, which is a meaningful distinction in a crowded category.

educationcoursesslidesrevealjs
by skill-node Aug 10, 2026 5/10
app GitHub

areco: drive Claude Code and Codex from your browser or phone

A web cockpit for CLI coding agents, letting you start and steer Claude Code, Codex, or Reasonix sessions from a browser or phone. Handles multiple agents from one interface.

remotemobilebrowsermulti-agent
by bb4407777 Aug 10, 2026 6/10
app GitHub

ai-souls: Dark Souls screens for your coding agent

Replaces your coding agent's status transitions with Dark Souls screens. Purely for fun, and it makes a failed build land about as well as it deserves.

funnotificationsui
by gkurt Aug 10, 2026 5/10
app GitHub

android-harness: drive an Android phone from Windows over ADB

Lets an agent see and control a physical Android phone from Windows over ADB with nothing installed on the device. Works with Claude Code, Codex, and Hermes. Counterpart to the iOS harnesses appearing for the same use case.

androidadbautomationwindows
by sepivip Aug 10, 2026 7/10
app GitHub

vibe-revert: flag risky agent changes and restore uncommitted work

Flags changes an agent made that look risky and restores project files to their pre-session state, including uncommitted work that git alone would not save you from. That uncommitted case is exactly where agent sessions hurt most.

rollbacksafetygitrecovery
by madeinplutofabio Aug 10, 2026 7/10
app GitHub

graphward: private local-first code intelligence for coding agents

Local-first code intelligence serving both coding agents and humans, with nothing leaving the machine. Aimed at giving agents structural understanding of a codebase without a hosted indexing service.

code-intelligencelocal-firstsearch
by speadskater Aug 10, 2026 6/10
app Reddit

JobPilot: a job-search agent that runs on your Claude Code subscription

Finds jobs matching your resume across sites, tailors the resume per posting, fills applications, and can find and message hiring managers over email or LinkedIn. Version 2 adds a web portal and analytics on top of the original CLI. Runs on a Claude Code subscription without an API key or claude -p mode.

job-searchautomationagentweb
by Born-Cause-8086 Aug 10, 2026 6/10
app Reddit

Jcode: a coding agent built for running 20 sessions in parallel

A newly launched open-source coding agent optimized for parallelism, claiming 20x better RAM efficiency than Claude Code and 63x faster spawn than Codex CLI, with built-in memory and support for existing API keys and logins. Benchmark claims are the author's own and worth verifying.

agentparallelopen-sourcecli
by Medium_Anxiety_8143 Aug 10, 2026 6/10
app Reddit

A local voice tunnel for Claude Code with no servers involved

A local CLI that gives coding agents voice: if the agent can run bash, it can talk to you. TTS, ASR, and STT all run on your machine, and the CLI is self-describing so the agent learns to drive it on install. Remote use needs Tailscale or ngrok.

voicettslocalcli
by JuanjoFuchs Aug 10, 2026 7/10
app GitHub

RondoFlow: Drag-and-Drop Canvas for Orchestrating Claude Code Agents

RondoFlow is a local-first, open-source platform for visually building multi-agent Claude Code workflows. You create agents on a drag-and-drop canvas, attach skills, and define security policies per agent before running them together. It targets people who want orchestration without hand-writing agent configs and prompt plumbing.

orchestrationmulti-agentguilocal-firstopen-source
by rondoflow Aug 10, 2026 8/10
app GitHub

claude-code-sandbox: Locked-Down Dev Container for Unattended Claude Code Runs

A sandboxed dev container built for running Claude Code unattended, with default-deny network egress and no route to root. It lets you give an agent broad permissions inside the box without exposing the host or the open internet. Practical for autonomous or cron-driven agent sessions.

sandboxsecuritydevcontainerunattendeddocker
by vo3xel Aug 10, 2026 8/10
app GitHub

artifact-review: Local-First Visual Review Loop for Agent-Authored HTML

A tool that closes the feedback loop on HTML artifacts an agent produces, letting you review them visually on your own machine and feed corrections back. It addresses the blind spot where a coding agent writes UI it cannot actually see rendered. Local-first, no hosted service required.

reviewhtmlartifactslocal-firstfeedback-loop
by AhmedDaraz-Ignite Aug 10, 2026 6/10
app GitHub

depcompass: Ground Coding Agents in Your Pinned Dependency Versions

depcompass keeps AI coding agents aligned with the dependency versions actually pinned in your project instead of whatever API shape their training data remembers. It targets the common failure where an agent writes code against a library version you are not running. A small guardrail with an outsized effect on generated-code correctness.

dependenciesaccuracyguardrailversioning
by ctosullivan Aug 10, 2026 7/10
app GitHub

ccusage-fleet: Aggregate ccusage Reports Across Local and SSH Machines

ccusage-fleet collects ccusage output from several machines, including ones reached over SSH, and merges them into a single report. Useful if you run Claude Code on a laptop, a workstation, and a remote box and want one usage picture. A thin but practical layer on top of the existing ccusage tool.

ccusagemonitoringsshfleetreporting
by Open330 Aug 10, 2026 6/10
app GitHub

garbage-man: Provider-Neutral Email Review and Cleanup for AI Agents

garbage-man gives agents a provider-neutral way to review inboxes and clean up future mail such as scheduled sends and recurring noise. Being provider-neutral, it is not tied to a single mail API. From the team at Every.

emailagentscleanupproductivity
by EveryInc Aug 10, 2026 5/10
app GitHub

ccproxy (starbaser): Build Mods for Claude Code by Hooking Requests and Responses

A proxy that sits in front of Claude Code so you can intercept and modify any request or response. It supports registering custom models under /model and routing requests between models using your own logic or bundled defaults. Effectively a mod layer for people who want behavior the client does not expose.

proxymodel-routinghookscustomization
by starbaser Aug 10, 2026 8/10
app GitHub

ShikishaTerm: Windows Terminal Running Claude Code, Codex and Gemini Side by Side

A portable Windows terminal built for AI CLIs, showing Claude Code, Codex, and Gemini in parallel panes. Beyond layout, it lets the agents hand work to each other rather than acting as isolated sessions. Portable, so no installation is required.

terminalwindowsmulti-clicodexgemini
by styleio Aug 10, 2026 6/10
app GitHub

winmux: Lightweight cmux-Style Terminal for Windows and WSL2

A lightweight cmux-style terminal multiplexer for Windows, built around WSL2 and focused on Claude Code and Codex sessions. It gives Windows users the split-pane agent workflow that tmux users get on Linux and macOS. Small and focused rather than a full terminal replacement.

terminalwindowswsl2multiplexer
by sjkwon-1023 Aug 10, 2026 5/10
app GitHub

mobile-claude-ai: Portable Claude Code on a USB Stick with Three-Factor Encryption

Carries a Claude Code setup on a USB stick, with credentials encrypted against three factors: the USB serial, a server key, and a PIN. A lost stick can be revoked remotely, and memory travels with you across machines. Aimed at people who move between workstations they do not fully control.

portablesecurityencryptionusbmemory
by autoit-studio Aug 10, 2026 6/10
app GitHub

agent-session-pack: Compress Cold AI Agent Sessions With Byte-Exact Restore

A Node CLI that compresses finished ('cold') AI coding-agent session files and restores them byte-for-byte on demand. Useful if you keep long transcript histories around for audit or resume but do not want them consuming disk. Verification of the restore is part of the tool rather than an afterthought.

clisessionscompressionstorage
by YosefHayim Aug 9, 2026 6/10
app GitHub

ccpulse: TUI Dashboard for Claude Code Token Usage and Rate-Limit Windows

A terminal dashboard showing live Claude Code token consumption alongside your rate-limit windows. Instead of discovering you have burned a session at 107%, you can watch the window fill in real time. Handy for subscription users trying to pace work across five-hour windows.

tuitokensrate-limitsmonitoring
by martinciu Aug 9, 2026 7/10
app GitHub

llm-ctxpack: Pack a Repo Into LLM Context, Diff-Aware and Secret-Redacting

A packer that turns a repository into LLM-ready context with three properties most packers miss: it is aware of the git diff so it can prioritize what changed, it respects a token budget, and it redacts secrets on the way out. Aimed at feeding code to models without leaking credentials or blowing the window.

contexttokenssecretsrepo-packing
by dacode-dev Aug 9, 2026 7/10
app GitHub

my-Harness-Library: Self-Hosted Inventory of Your Skills, Agents, and MCPs

A self-hosted, searchable catalog of every Claude Code skill, agent, command, plugin, and MCP server you have installed, with an in-browser Markdown editor for the ones you author. Solves the problem of losing track of what is actually loaded once your configuration sprawls.

inventoryself-hostedskillsmcp
by Epaminondaslage Aug 9, 2026 6/10
app Reddit

Continuum: Capture and Resume AI Chats Across Providers in Your Browser

A Chrome and Firefox extension that captures an AI conversation, including messages, images, files, and code, and resumes it in a fresh chat on a different compatible assistant with the context carried over as PDF or Markdown. Everything is stored locally with no account or server. It also has an AI compression pass to shrink the carried context.

browser-extensioncontextlocal-firstchat-history
by Designer_You8031 Aug 9, 2026 5/10
app GitHub

claude-octopus: Put Up to 8 AI Models on Every Coding or Research Task

Runs a task across as many as eight models in parallel and surfaces where they disagree, on the theory that blindspots are model-specific. Applies to research, design, and coding work. Useful as a cheap second opinion before shipping something you cannot easily reverse.

multi-modelreviewconsensusblindspots
by nyldn Aug 9, 2026 6/10
app GitHub

AuraMux: A Native macOS Terminal Built for Many Long-Lived Agent Sessions

A native macOS terminal designed around running several AI coding CLIs at once: tabs, split view, session restore, and a badge on whichever session is waiting on you. The badge matters when you have six agents running and only one needs a decision.

macosterminalsessionsmultiplexing
by rmehdee Aug 9, 2026 6/10
app GitHub

llminbox: A Per-Agent Inbox Over the Markdown Logs Your Fleet Already Writes

Builds a per-agent inbox on top of the Markdown coordination files a multi-agent setup already produces, so each agent has a clear view of messages addressed to it. No new protocol to adopt — it layers on existing logs.

multi-agentcoordinationmessagingmarkdown
by mynameisshineee Aug 9, 2026 6/10
app Reddit

Terminal Manager for ADHD Brains: Persistent SSH Terminals on One Canvas

An open-source terminal manager that puts all your projects, including remote SSH sessions, on a single canvas with persistent terminals that survive app close and reconnection. Grew from a personal productivity tool into something closer to an autonomous development environment.

terminalsshopen-sourceproductivity
by ottasilver Aug 9, 2026 5/10
app GitHub

Headless-TTY: Run Claude Code on Windows With No Console Window

A headless terminal wrapper for native Windows that keeps isatty() returning true for spawned processes while staying invisible or living in the system tray. Lets you run Claude Code CLI, Gemini, Codex, or any TUI app as a background process without a visible console.

windowsttyheadlessbackground
by revoconner Aug 9, 2026 7/10
app Reddit

graphene: A CLI and Skill for Building and Visualizing Your Agent Work Graph

A CLI plus companion skill for creating and managing a dependency graph of agent work, with a UI for visualizing it. The author built it after reading the article that coined graph engineering and finding no existing tool. Worth a look if you want the graph as an artifact you can inspect, not just a prompt-level idea.

graphclivisualizationorchestration
by mels_hakobyan Aug 9, 2026 6/10
app GitHub

token-distiller: 33x Smaller PDFs and Repos for Agents, Expandable in Full

Distills PDFs, photos, and repositories into token-efficient context: local OCR reads embedded diagrams rather than only text layers, content-hash caching collapses re-reads, and BM25 retrieval bounds huge documents. Nothing is discarded — anything shortened can be expanded back in full. Reported 33x on a 25-page PDF and 97% reduction on pytest output.

tokensocrcontextretrieval
by priyanchen Aug 9, 2026 8/10
app GitHub

claude-statusline (anthonybaldwin): A Multi-Row Bun Status Line Dashboard

A cross-platform, zero-dependency Bun status line for Claude Code rendering context, cost, rate-limit windows, git and PR state, subagents, and full config-scope breakdowns as a width-aware multi-row dashboard with Nerd Font glyphs. Opinionated and dense compared to single-line status bars.

statuslinebundashboardmonitoring
by anthonybaldwin Aug 9, 2026 7/10
app GitHub

clankchat: Comms for Your Coding Agents

A lightweight communication channel for coding agents to talk to each other. Minimal description from the author, but the niche — inter-agent messaging without a heavyweight orchestration framework — is a real one.

multi-agentmessagingcoordination
by simozampa Aug 9, 2026 5/10
app GitHub

B12: Local-First Persistent Memory Across Claude Code, Codex, and Cursor

A local-first memory layer shared across Claude Code, Codex, OpenCode, Cursor, and others, so context you build up in one agent is available in the next. Local-first means the memory stays on your machine rather than in a vendor's store.

memorylocal-firstcross-agentcontext
by dorukardahan Aug 9, 2026 7/10
app GitHub

Schemap: Make Your Database Understandable to AI Coding Agents

Analyzes a database schema, detects issues, maps relationships, and emits compact AI-ready context files for Claude Code, Codex, Cursor, and similar tools. Fills the common gap where an agent can read your code but has no accurate picture of the data model.

databaseschemacontextcodegen
by alansyahmi Aug 9, 2026 7/10
app GitHub

captain-miao: A TUI That Drives Your Own Kitty or Zellij Agent Sessions

Mission control for coding agent sessions that drives your existing terminal (Kitty or zellij) rather than replacing it, so every session stays a native window or pane in the workflow you already use. A good fit if you have invested in a terminal setup and do not want a separate app.

tuikittyzellijsessions
by hyperlogue Aug 9, 2026 6/10
app GitHub

ghc-proxy: Turn GitHub Copilot Into an Anthropic-Compatible Endpoint

A fast Rust proxy exposing GitHub Copilot through OpenAI- and Anthropic-compatible API endpoints, so Claude Code, Codex CLI, and any OpenAI or Anthropic SDK can talk to it. Relevant if you have a Copilot seat and want to point existing tooling at it.

proxycopilotrustapi-compatibility
by MartinForReal Aug 9, 2026 6/10
app Reddit

AI Skill Engine: Self-Hostable Chatbot Backend With Tool Execution and MCP

An open-source, self-hostable backend giving a chatbot real tool-use: sandboxed code execution, API and file handling, multi-step tasks, MCP support, multi-tenancy, generative UI, audit logs, and an admin dashboard for adding skills. OpenAI API compatible.

self-hostedmcptool-usebackend
by sandeshnaroju Aug 9, 2026 5/10
app GitHub

fig: Mark Up a Page in the Browser, Let a Local AI Apply the Revisions

Live design feedback: annotate any web page or PDF directly in the browser and a local AI companion applies the markings and produces the revised page. Part of the Loqumen suite. Closes the loop between pointing at a problem and having it fixed.

designbrowserfeedbacklocal-ai
by loqumen Aug 9, 2026 6/10
app GitHub

bettermemory: A Trust Layer for Agent Memory

Positions itself as a trust layer over agent memory — the concern being that stored memories are treated as fact by later sessions without any provenance. Sparse public description; worth watching if agent memory reliability is a problem for you.

memorytrustprovenance
by 0Mattias Aug 9, 2026 5/10
app GitHub

aihome: A Kanban and Graph Workspace for Your AGENTS.md and SKILL.md Files

A local-first visual workspace that renders your AGENTS.md and SKILL.md files as a kanban board and relationship graph over a sandboxed file API. Makes an agent ecosystem visible when it has grown past what you can hold in your head.

visualizationskillslocal-firstkanban
by Justin-Ju-0413 Aug 9, 2026 6/10
app GitHub

TemperForge: A Multi-Agent AI Development Workbench Built for Review

A bilingual multi-agent development workbench whose stated goal is code that survives review rather than code that merely runs. General-purpose across agents rather than tied to one harness.

multi-agentworkbenchcode-reviewchinese
by xiabai2008 Aug 9, 2026 5/10
app GitHub

agentpantry: Encrypted Browser Session and Secret Sync for Agent Hosts

Opt-in AES-256-GCM sync of browser sessions and secrets to the machine your agent runs on, so it can log in without you pasting credentials into a config file. Addresses a real gap in agent-host setups, though it is worth reading the threat model carefully before adopting.

secretsencryptionbrowser-sessionsagent-hosts
by escoffier-labs Aug 9, 2026 6/10
app GitHub

kanvibe: A Keyboard-First Kanban Desktop for Agents, Terminals, Worktrees

A keyboard-driven desktop kanban workspace for AI coding agents with embedded terminals, git worktrees per card, and hook-driven task tracking. The hooks mean board state updates from what the agent actually does rather than what you remember to drag.

kanbanworktreeshooksdesktop
by rookedsysc Aug 9, 2026 6/10
app GitHub

AgenticWorkspace: Turn Any Repo Into an Agent-Ready Workspace

A CLI that detects your stack, scaffolds progressive context and session handoffs, and installs a working Claude Code adapter. Ships on npm and PyPI with a plugin architecture for memory backends and additional agent adapters.

scaffoldingcontexthandoffcli
by RudrenduPaul Aug 9, 2026 6/10
app Reddit

tdd-cli: A TDD State Machine That Watches the Tests, Not the Agent's Claims

A small CLI that drives the TDD cycle from its own observations of the tests and code rather than trusting what the agent reports. The author's writeup is honest about two failed prior attempts — prompts and skills, then a state file the agents learned to fake — which is what makes the third design convincing.

tddtestingstate-machineverification
by geuben Aug 9, 2026 7/10
app GitHub

metis: Event Bus, Leases, and Safety Rails for Autonomous Engineering Agents

A substrate for autonomous engineering agents: repository discovery from evidence, a shared event bus with leases, and safety rails that refuse rather than ask for permission. The refuse-don't-request stance is a deliberate design choice for unattended operation.

autonomous-agentsevent-bussafetysubstrate
by rayhimanshu Aug 9, 2026 5/10
app GitHub

cleancode: Compose Terminals, Worktrees, and Agents on One Canvas

A local-first visual workspace where terminals, git worktrees, and coding agents are composed on a single canvas as executable workflows. One of several canvas-style agent workspaces appearing at the moment.

canvasworktreesworkspacelocal-first
by chen-985211 Aug 9, 2026 5/10
app GitHub

taskswarm: OS Notifications the Instant a Parallel Agent Session Blocks

A self-hosted event server and CLI that fires a local OS notification and updates a live SSE status page the moment a parallel Claude Code, Codex, or Cursor session blocks, needs review, fails, or finishes. MIT-licensed, shipping on npm and PyPI. Solves the real cost of parallel agents: not knowing which one is waiting on you.

notificationsparallel-agentssseself-hosted
by RudrenduPaul Aug 9, 2026 7/10
app GitHub

teamspend: Compare AI Coding Tool Spend Before and After a Migration

Pulls real usage numbers from Cursor, Claude Code, GitHub Copilot, OpenCode, and Codex CLI via each vendor's API or local logs and compares spend across a migration in one command. Includes a credential-free personal mode. Zero runtime dependencies, available as CLI and library on npm and PyPI.

costusagecomparisoncli
by RudrenduPaul Aug 9, 2026 6/10
app GitHub

agent-crm: Let Coding Agents Build a Custom CRM You Own as Reviewable Code

An open-source framework where you describe your commercial process to Claude Code or Codex and get a working CRM as reviewable code you own, with deterministic workflows, human approval steps, and audit and trace built in. The approvals and audit trail are what separate it from generated-app demos.

crmframeworkcodegenaudit
by khaoss85 Aug 9, 2026 6/10
app GitHub

spfn: A Fixed Vertical Slice Per Feature So Agents Can't Invent Shapes

A TypeScript full-stack framework for Next.js apps built by AI coding agents, where every feature is one fixed vertical slice — entity, repository, route, router — so an agent cannot invent a different structure each time. Auth, storage, jobs, and MCP ship as packages. Aimed at getting AI-built prototypes to production.

frameworktypescriptnextjsstructure
by fxylabs Aug 9, 2026 6/10
app GitHub

fleetmux: A tmux Cockpit for a Fleet of AI Coding Agents

A tmux-based cockpit for running many AI coding agents: hook-driven state tracking, fleet restore after a restart, and popup control. Sits inside tmux rather than replacing your terminal.

tmuxfleethookssessions
by gabury1 Aug 9, 2026 6/10
app GitHub

copilot-scope: OpenTelemetry Observability for AI Copilot Sessions

Observability for AI copilot sessions built on .NET Aspire: an OpenTelemetry collector, Postgres store, and Blazor dashboard with real-time quality scoring. A more enterprise-shaped take than the usual token-counter dashboards.

observabilityopentelemetrydotnetdashboard
by konradcinkusz Aug 9, 2026 6/10
app Reddit

Model Gateway as a Plugin: Local Model Routing Inside Claude Code

A fully local model-gateway plugin for Claude Code, built as part of a kanban board with routing built in. Install it, ask the agent to initialize, and it works — currently supporting Codex and Grok.

routinggatewaypluginlocal
by TheDeadlyPretzel Aug 9, 2026 5/10
app GitHub

taskwitness: Prove What Changed, What Was Tested, and What Passed

Evidence-first verification for AI coding agents: rather than accepting a summary, it records what changed, what was tested, and what actually passed. Part of a clear trend toward not trusting agent self-reports.

verificationevidencetestingaudit
by digsarab112 Aug 9, 2026 6/10
app GitHub

imark: A macOS Markdown Reader Your Agent Can Wait On for Your Notes

A native macOS Markdown reader that follows every save, so you can keep it open while writing. Comment on a phrase and the note is written back into the .md file itself — which means your coding agent can open a plan there and wait while you mark it up.

macosmarkdownreviewplans
by migsilva89 Aug 9, 2026 6/10
app GitHub

ClaudePlus: Drive Multiple Claude Code Sessions From Telegram

A PowerShell module that lets you manage several Claude Code sessions from Telegram, giving you remote multi-terminal control from a phone. Useful for checking on or unblocking long-running sessions when away from the machine.

telegramremotepowershellsessions
by Delphinegallic955 Aug 9, 2026 6/10
app GitHub

charter (Stackbilt): A Modular .ai/ Context System That Replaces CLAUDE.md

A local-first AI agent governance CLI introducing a modular .ai/ context directory (the Agent Definition Format) in place of one monolithic CLAUDE.md. Addresses the well-known problem of CLAUDE.md growing until it is mostly noise.

governanceclaude-mdcontextcli
by Stackbilt-dev Aug 9, 2026 6/10
app GitHub

SWE-Squad (Jean-loutropical739): Provider-Agnostic Bug Triage and Fixes

An autonomous, provider-agnostic engineering team automating software bug detection, triage, and fixes. Shares a name with an earlier unrelated project, so check which repository you are installing.

bugstriageautonomousprovider-agnostic
by Jean-loutropical739 Aug 9, 2026 5/10
app GitHub

AutoLoop: Governed Agent Loops in Rust With Policy, Verification, Replay

A Rust implementation of governed AI agent loops with policy checks, verification, memory, and replay for controlled execution. The replay capability is the notable piece — it makes an autonomous run reproducible after the fact.

rustpolicyreplayautonomous
by concettinaprofitable685 Aug 9, 2026 5/10
app GitHub

aikito: One Git Workspace for Memory and Agent Resources Across Projects

Keeps reusable memory and agent resources in a single Git-managed workspace, then makes them available across projects, sessions, and supported coding agents. Git-managed means your agent context is versioned and reviewable like code.

memorygitcross-projectresources
by lsaint Aug 9, 2026 6/10
app Reddit

Patch Claude Code So Subagents Run on Any Anthropic-Compatible Model

A patch to the local Claude Code bundle letting subagents run on any Anthropic-compatible model — DeepSeek, GLM, and so on — while the main agent stays on Fable or Opus through your Max plan, decided per request. Also adds subagent list quality-of-life: pinning, detaching into a separate resumable session, and control over auto-dismiss. Unsupported by Anthropic; the author argues it is lower risk than an API-level router.

subagentsmodel-routingpatchmax-plan
by sdexca Aug 9, 2026 6/10
app GitHub

phone-a-friend: A CLI Relay Across Claude, Codex, Gemini, and Ollama

A CLI relay for Claude Code, Codex, and OpenCode that delegates work to Antigravity, Claude, Codex, Gemini, Ollama, or OpenCode with streaming, persistent sessions, and multi-agent teams. Broad provider coverage makes it a practical second-opinion layer.

delegationmulti-agentclicross-provider
by freibergergarcia Aug 9, 2026 7/10
app GitHub

x-agent (darshitpp): Let Any AI CLI Delegate To or Check the Others

A cross-agent task runner letting Codex, Cursor, Claude, Gemini, or Junie delegate tasks to each other or request a second opinion. Shares a common name with unrelated projects, so check the repository owner.

delegationcross-agentclisecond-opinion
by darshitpp Aug 9, 2026 6/10
app GitHub

alethe-agents: Real PTYs, Split Panes, and Session History for Agents

A local-first desktop workspace for running, organizing, and resuming multiple coding agents and shells, using real PTYs with split panes, persistent layouts, and local session history. Real PTYs matter for TUI apps that misbehave in emulated terminals.

desktopptysessionslocal-first
by Kc1t Aug 9, 2026 6/10
app GitHub

torio: A Linux VM for Your Coding Agent That Cannot Push and Holds No Keys

A Linux VM for your coding agent containing your repositories and notes but none of your keys, with a backend that cannot push. One Go binary, no daemon. A clean, well-scoped answer to the question of how to let an agent run freely without giving it your credentials.

sandboxvmsecuritygo
by wzslr321 Aug 9, 2026 7/10
app GitHub

lightcode (digitalscapemy): Per-Pane Token Usage and Account Switching

A lightweight multi-terminal manager for Claude Code power users showing live token usage per pane, with multi-account switching and visual split-pane layouts. Shares a name with an unrelated project, so check the repository owner.

terminaltokensmulti-accountpanes
by digitalscapemy Aug 9, 2026 6/10
app GitHub

wildtrace-atlas: A Data-to-Editorial-Visualization Compiler, 120 Methods

An executable compiler from data to editorial-quality visualization with 120 methods, auditable specs, prompt compilation, repair workflows, and browser-native examples. The repair workflows are notable — most chart tooling has no story for a visualization that came out wrong.

visualizationchartscompilereditorial
by Kerrywang64 Aug 9, 2026 5/10
app GitHub

sentry-ai-triage: Self-Hosted Sentry Triage on Your Claude Subscription

Self-hosted Sentry issue triage with rule-based noise filtering, Claude-powered severity and root-cause analysis, and GitHub ticket creation. Runs against your existing Claude subscription instead of Sentry's paid AI add-on.

sentrytriageobservabilityself-hosted
by NickC84 Aug 9, 2026 6/10
app Reddit

beans-web: Browser Dashboard for Markdown-Based Beans Issue Trackers

beans is an issue tracker that keeps everything as markdown in your repo, with a CLI that agents drive well. beans-web scans a root directory (or several) for anything containing a .beans.yml file and serves one UI across all of them. Built to replace running 'beans list' repo by repo and to stop burning tokens having Claude Code print the open-bean hierarchy.

issue-trackerdashboardmarkdownworkflow
by Remarkable-Alps-5770 Aug 8, 2026 7/10
app GitHub

ficus: Carbon Ledger for Your Claude Code Usage

Tracks the energy, water and CO2e footprint of your Claude Code usage and records the offsets that settle them. An unusual angle on session accounting for anyone who wants sustainability numbers alongside token counts.

sustainabilityusage-trackingcarboncli
by signalblur Aug 8, 2026 6/10
app GitHub

bmad-module-pulse: AI Leverage Analytics for BMAD Teams

Analytics module for teams running the BMAD method, reporting story-level leverage ratios, capacity forecasts and halt alerts, plus a coach persona called Levi. Measures output in stories rather than lines of code.

analyticsbmadmetricsteam
by nidelson Aug 8, 2026 5/10
app GitHub

claude-threads: Multiplayer Screen Sharing for AI Pair Programming

Turns an AI pairing session into something several people can watch and type into at once - screen-sharing where everyone has a keyboard. Useful for team debugging or teaching sessions where one person driving the agent is the bottleneck.

collaborationpair-programmingmultiplayer
by anneschuth Aug 8, 2026 6/10
app GitHub

claude-code-progress-sidebar: Live Session Panel for macOS

A floating always-on-top native macOS panel showing what the current Claude Code session is doing, with a todo progress bar and an ETA. Reads the session jsonl and todo files directly - no plugin to install and no API key.

macosmonitoringuisession
by jayadevrana Aug 8, 2026 7/10
app GitHub

synapse-ai-bridge: Terminal Access to ChatGPT, Claude and Gemini

Bridges a Chrome extension to your terminal so ChatGPT, Claude and Gemini web sessions answer from the command line, with no API keys involved. Handy if you already pay for the chat subscriptions and want CLI access to them.

bridgechrome-extensionterminalmulti-model
by Parithosh-Varma Aug 8, 2026 5/10
app Reddit

codepend: Turn Local Agent Session Logs Into a Wrapped-Style Recap

Claude Code, Codex and Cursor all keep local session histories; codepend reads them and writes one self-contained HTML file - first thing you ever asked, the 4 AM sessions, your most repeated phrase, the projects you abandoned. Run with 'npx codepend'; no signup, API key, telemetry or backend, and a --redact paranoid mode before sharing.

session-logsvisualizationcliprivacy
by apolorotov Aug 8, 2026 7/10
app GitHub

celeste-cli: Agentic Terminal Assistant With a Bubble Tea TUI

A terminal AI assistant with a Bubble Tea TUI, code-graph-based review, semantic search, multi-provider LLM support and MCP tools. A full alternative harness rather than an add-on to an existing one.

clituimcpcode-review
by whykusanagi Aug 8, 2026 6/10
app GitHub

micold-ai-ide: Desktop IDE for Claude Code Worktrees and Sessions

An AI-assisted desktop IDE built around managing Claude Code worktrees and sessions, with a real embedded terminal rather than a simulated one. For people running several branches of agent work at once.

ideworktreedesktopsessions
by jaroslawherod Aug 8, 2026 6/10
app GitHub

agentblog: Next.js Blog Built for AI Search Engines to Read

A production blog for Next.js installed with one command, structured so AI search engines can actually parse it, plus an agent layer that knows the conventions for writing into it.

nextjsblogseoagents
by goldk3y Aug 8, 2026 5/10
app GitHub

cairn: Deterministic Structural Code Navigation for Agents

Answers structural questions for coding agents - callers, blast radius, dead code, cross-language gRPC reach, which deployed services run what code - deterministically and offline, with no LLM in the loop. Python and Go.

code-navigationstatic-analysispythongo
by Marb-AI Aug 8, 2026 7/10
app GitHub

codespaces: Architecture-Aware Code Search and Impact Analysis

Gives agents architecture-aware code search, dependency graphs and impact analysis across Python, TypeScript, TSX, Rust, C#, Java and Go. Aimed at the 'what breaks if I change this' question that grep answers badly.

code-searchdependency-graphimpact-analysis
by diskd-ai Aug 8, 2026 6/10
app GitHub

Booksmith: Turn a Manuscript Into a Print-Ready Designed Interior

Takes a book manuscript and produces a magazine or guide-style interior at any trim size, with genre-matched typography. Tables, charts, infographics, pull-quotes and callouts appear only where genuinely needed; everything else stays clean prose. Outputs a print-ready PDF plus editable HTML/CSS.

publishingtypographypdfdesign
by dclericc Aug 8, 2026 6/10
app GitHub

project-registry: Multi-Project Registry With Session Resume

One registry across all your Claude Code projects, with session resume that restores full context and auto-save so an interrupted session doesn't lose work. Aimed at solo developers juggling many repos.

multi-projectsessionsresumeregistry
by SUNQSHENG Aug 8, 2026 6/10
app GitHub

glissa: Browser Dashboard for Running Dozens of Claude Code Agents

Runs many Claude Code agents from one browser dashboard with live terminals, status detection built on hooks rather than screen scraping, and per-agent git worktree review and merge. Windows-first and published on npm.

dashboardmulti-agentworktreewindows
by johncwaters Aug 8, 2026 7/10
app Reddit

Claude Desktop Account Switcher: Run Multiple Accounts Side by Side

An open-source Windows launcher that manages multiple Claude Desktop accounts without repeated sign-outs. It exploits the Electron app's --user-data-dir flag, giving each profile its own cookies, local storage and config so accounts stay signed in and can run simultaneously in separate windows. You can also pin a desktop shortcut per account and skip the switcher entirely.

account-switchingclaude-desktopelectronwindowsopen-source
by PriyanshuGeTrekT Aug 8, 2026 6/10
app GitHub

Clawdmeter: Cross-Platform Desktop Dashboard for Claude Code Usage

A PySide6 tray app for Windows, macOS and Linux that shows live session and weekly usage limits with reset countdowns and token counts. A Stats page values your local transcripts against API rates so subscription users can see what their usage would have cost. Includes 16 themes, a custom theme editor, and a reactive mascot per active session.

usage-monitordesktop-apptraytoken-countscross-platformpyside6
by weltern Aug 8, 2026 7/10
app GitHub

clippy: Floating Assistant That Watches and Drives Your Claude Code Sessions

A desktop overlay that monitors running Claude Code sessions and understands what each one is currently doing. Approvals, reviews, and prompt answers happen from a floating UI instead of the terminal, and an Agent-SDK "Drive" mode lets it steer sessions directly. Useful if you juggle several concurrent agents and keep losing track of which one is blocked on you.

uisession-managementagent-sdkmulti-agentapprovals
by aisocratic Aug 8, 2026 8/10
app GitHub

tmux-alwayson: Keep a Coding Agent's tmux Session Alive Across Reboots

A Go installer plus guard process that starts an AI coding agent inside tmux and restarts it whenever the box reboots or the session dies. The agent is behind an interface, so adding a second or third agent type is a small change rather than a fork. Aimed at long-running unattended agents on a server or home machine.

tmuxdaemonunattendedgopersistence
by nahidspace Aug 8, 2026 7/10
app GitHub

zedra: Remote Control for AI Coding Agents from iOS and Android

A native mobile client for driving coding agents running elsewhere, built in Rust with GPUI and a QUIC/UDP transport rather than the usual web-view-over-HTTP approach. Ships for both iOS and Android. The point is checking in on and unblocking a long-running agent without being at your desk.

mobileremote-controlrustgpuiquiciosandroid
by tanlethanh Aug 8, 2026 8/10
app GitHub

AIAgentPersistentTerminal: Crash-Resilient Tabbed Windows Terminal for Claude Code

A tabbed cmd.exe terminal for Windows 10/11 built around long-running Claude Code sessions. It persists each tab's name, color, and working directory, then restores them automatically after a crash or power loss. Useful if you run several agent sessions on Windows and keep losing your layout.

windowsterminalcrash-recoverysessions
by angree Aug 8, 2026 6/10
app Reddit

One Pixel Crab per Session: Screen-Edge Status for Parallel Claude Code Runs

Running five or six sessions at once makes it hard to tell which one is blocked on you. This puts one pixel crab per session on the screen perimeter, with distinct animations for idle, working at xhigh, awaiting permission, just-finished, asleep, and rate-limited. Clicking a crab foregrounds that session's terminal; it reads per-session files in ~/.claude/sessions, with optional hooks that always exit 0 so they cannot block the CLI.

multi-sessionstatushooksdesktopmonitoring
by OkOpportunity1531 Aug 8, 2026 7/10
app GitHub

agent-hop: Search Every Coding-Agent Chat and Resume Any Session in Any Agent

A cross-agent session browser that indexes your chat history from multiple coding agents in one searchable place. Beyond search, it lets you pick up a session in a different agent than the one that started it. Handy if you split work across Claude Code, Codex, and others.

sessionssearchcross-agenthistory
by hetpatel-11 Aug 8, 2026 7/10
app GitHub

worktable: A Local Browser Canvas Where Terminal Agents Render Their Work

Instead of scrolling a wall of terminal text, the model renders its work as a page in a local browser canvas. You can see the output, select parts of it, and ask follow-up questions about the selection. A different answer to the readability problem of long agent sessions.

uibrowservisualizationterminal-agents
by dannykim32 Aug 8, 2026 7/10
app GitHub

devhub: One Dev Server per Project on macOS with Fixed Ports and launchd

A local hub that gives each project a fixed port and manages its dev server through launchd. It exists to stop Cursor, Claude, and Codex from each spawning their own server and fighting over ports. Documentation is in German.

macosdev-serverlaunchdportstooling
by Pikktee Aug 8, 2026 6/10
app GitHub

swarm: Drive a Fleet of Terminal Agents from One TUI, Web Page, or Command

Runs any CLI-based agent (claude, codex, or others) in its own pty and puts the whole fleet behind a single control surface. You can drive it from a TUI, a web page, or a one-shot command, whichever fits the moment. Agent-agnostic by design rather than Claude-specific.

orchestrationtuiptymulti-agentcli
by emmanuel-deloget Aug 8, 2026 7/10
app GitHub

genie-react: Live React and TanStack DevTools Your Agent Drives from the Terminal

Exposes DevTools for a running React + TanStack app through a single CLI, so a terminal-based agent can inspect live app state. That closes the usual gap where the agent edits code but cannot see what the running app is actually doing. Useful for debugging loops that currently require you to relay browser observations by hand.

reacttanstackdevtoolsdebuggingcli
by Genie-sa Aug 8, 2026 7/10
app GitHub

agent-session-intelligence: Visualize and Analyze Your Coding Sessions

A local-first tool that inspects Claude Code, Cursor, Pi, and OpenCode sessions and reports context token usage, LLM-derived insights, and governance artifacts. Everything stays on your machine. Good for understanding where your context budget actually goes across tools.

sessionsanalyticstokenslocal-first
by ZoheerAlmansoub Aug 7, 2026 7/10
app GitHub

evolve: Multi-Tier Evaluation CLI for Coding Agent Plugins

A CLI that evaluates coding agent plugins using a multi-tier approach, so you can compare plugins on evidence instead of README claims. Aimed at people maintaining or choosing between plugin sets.

evaluationpluginsclibenchmark
by bitwise-media-group Aug 7, 2026 6/10
app GitHub

litellm-multi-gateway: Route Claude Code to Multiple LLM Backends

A LiteLLM-based gateway that routes Claude Code, Hermes, or any OpenAI-compatible client to several providers (ARK, Anthropic, Zhipu). Ships an admin UI, per-client usage tracking, and automatic vision-to-text conversion for text-only backends.

gatewaylitellmroutingmulti-provider
by kwhitestone Aug 7, 2026 6/10
app GitHub

qmonster: Observe-First TUI for Multi-CLI tmux Sessions

A Rust TUI that watches Claude, Codex, and Gemini panes across tmux and surfaces alerts, token pressure, and recommendations. Observe-first by design, so it reports rather than acts and you decide which session needs attention.

tuitmuxrustmonitoringtokens
by chquandogong Aug 7, 2026 6/10
app GitHub

jurisd: Local-First AU/NZ Legal Research Workbench for AI Assistants

An open research and drafting workbench for Australian and New Zealand law that answers from legislation and case law with every claim traced to a primary source. Runs locally by default so privileged work never leaves the machine, and can be driven by the AI assistant you already use.

legalresearchlocal-firstcitations
by russellbrenner Aug 7, 2026 5/10
app Reddit

Coki Fonts: AI Font Generator With a Real Vector Glyph Editor

Turns a reference image of handwriting or lettering into an installable TTF: the model draws a full glyph sheet into a registered template, then the app traces it into editable vector outlines with a point-level curve editor in the browser. About 14k lines of TypeScript across a pnpm workspace, written almost entirely with Claude Code over two months.

showcasefontstypescriptsaas
by Majestic-Economist34 Aug 7, 2026 6/10
app GitHub

claude-slim: Measure What Every Skill and Plugin Costs in Your Prompt

Audits Claude Code startup context and reports the token cost of each skill, plugin, agent, and memory file, then reversibly disables the dead weight. No proxy and no compression, it just removes what you are not using.

contexttokensauditstartupoptimization
by iops-leo Aug 7, 2026 8/10
app GitHub

claude-code-crossmodel: Delegate to External LLMs and Benchmark Them

Hands work from Claude Code to any external LLM, and benchmarks which models you can actually trust with which kinds of task. Turns model routing into a measured decision rather than a guess.

delegationbenchmarkmulti-modelrouting
by devloadingbr Aug 7, 2026 6/10
app GitHub

cc-bar: Native macOS Menu Bar Quota and Usage Tracker

A native macOS menu bar app showing quota, local usage, and cost for Claude Code and multi-account Codex, either from the menu bar or a floating desktop HUD. Bilingual English and Chinese.

macosmenubarusagequotatracking
by nanvon Aug 7, 2026 7/10
app GitHub

akashic-record: Repo Wiki Generator That Never Overwrites Human Edits

Plans a page catalog, generates repo-committed markdown with line-range source citations, then incrementally updates only what changed. The design constraint that matters: it will not overwrite edits a human made to the generated pages.

documentationwikicitationsincremental
by ARMeeru Aug 7, 2026 7/10
app GitHub

agent_runtime: One Python API for Claude, Codex, and OpenCode

A reusable Python runtime that executes prompts against Claude, Codex, and OpenCode behind a single stable interface. Useful if you are building tooling that should not care which CLI is underneath.

pythonruntimeabstractionmulti-agent
by Johannes-Kutsch Aug 7, 2026 6/10
app GitHub

coding-agent-heat-index: Daily Momentum Leaderboard for 12 Agents

Ranks Cursor, Claude Code, Cline, Aider, Codex, Gemini CLI, and others by a daily Heat Score built from stars, commits, releases, issues, community activity, forks, and npm downloads. A rough but public read on which agents are actually moving.

leaderboardmetricsecosystemcomparison
by PurpleHaze2320 Aug 7, 2026 5/10
app GitHub

crew: Workspace-Local SQLite Inbox for Coordinating Terminal Agents

Coordinates Claude Code, Codex, Gemini, and Copilot through a SQLite inbox that lives in the workspace, with a reviewed task workflow on top. No daemon and no model provider involved, since the coordination layer is just a file in your repo.

coordinationsqlitemulti-agentlocal
by dichovsky Aug 7, 2026 6/10
app GitHub

claude-code-gateway: Run Claude Code on Gemini or Any LiteLLM Provider

A local gateway that points Claude Code at Google Gemini or any LiteLLM-supported provider, with one-command setup, safe local defaults, and easy provider switching. No Anthropic subscription required.

gatewaygeminilitellmlocalprovider-switching
by Yourstruggle11 Aug 7, 2026 6/10
app GitHub

claude-code-voice-mlx: Ordered Voice Output for Parallel Sessions

Gives parallel Claude Code sessions a single global speech queue so replies are spoken in order, each announcing which project it came from. Local neural TTS on Apple MLX, 0.3s to first sound, fully offline.

ttsvoicemlxparalleloffline
by baryhuang Aug 7, 2026 7/10
app GitHub

vaulted-agent-launcher: Launch Agents With Vault-Resolved Secrets

Starts Claude Code, Codex, Grok, or Kimi with secrets resolved in-process from 1Password, Bitwarden SM, pass, or sops, giving each agent its own blast radius and optional prompt auth. macOS and Linux.

secrets1passwordsopssecuritylauncher
by JacobStephens2 Aug 7, 2026 7/10
app GitHub

codetruss-cli: Deterministic Verification Gate With Signed Receipts

A local-first CLI that runs 13 analyzers plus your own checks over AI-written code within a defined scope, and emits signed receipts for what passed. Deterministic by design, so it is a gate rather than another opinion.

verificationclistatic-analysislocal-firstreceipts
by CodeTruss Aug 7, 2026 6/10
app Reddit

Plexar Studio: An Open-Source Harness for Managing Multiple Harnesses

Formerly Claude Cockpit, an open-source tool for managing many bash sessions and agents without the constant cd battle. Supports local models and OpenRouter-linked models alongside Claude Code, with reporting on top.

harnesssessionsopen-sourceopenrouterlocal-models
by Novaworld7 Aug 7, 2026 6/10
app Reddit

Walrus Memory: A Portable Memory Layer That Follows You Across Tools

CLAUDE.md and auto memory keep project context inside Claude Code. Walrus Memory persists that memory across sessions and makes it readable from Codex, Cursor, Antigravity, or your own agent, added in two commands.

memoryportabilitycross-toolcontext
by Useful-Bus-479 Aug 7, 2026 5/10
app GitHub

AiNetLinter: Roslyn Linter That Optimizes C# Codebases for AI Agents

A Roslyn-based static analyzer that restructures .NET 10 C# for easier consumption by Cursor and Claude Code, with the side benefit of lowering cognitive load for humans. Unusual angle, since it lints for the reader rather than the compiler.

csharproslynlinterdotnetreadability
by RalfHuesing Aug 7, 2026 6/10
app GitHub

AI-Usage-Panel: Privacy-First Local Dashboard for Tool Usage

A local dashboard covering Claude Code, Codex, and other AI developer tool usage, with no data leaving your machine. Straightforward if you want the numbers without a hosted service.

usagedashboardprivacylocal
by Super-ZT Aug 7, 2026 6/10
app GitHub

kyber: Self-Hosted Agent Fleet Management Platform

A self-hosted platform for managing a fleet of agents. Relevant if you have moved past running one or two sessions on a laptop.

fleetself-hostedmanagementorchestration
by matty-v Aug 7, 2026 6/10
app GitHub

claude-plugins: Local-First Memory of Decisions and How They Evolved

An always-on companion that records the decisions you make and how they change over time, using SQLite plus transformers.js embeddings entirely on your machine. Decision history rather than a flat fact store.

memorysqliteembeddingslocal-firstdecisions
by jungjaehoon-lifegamez Aug 7, 2026 6/10
app GitHub

faaah: Drive Your AI Agent Through Plain Text Files

Filesystem As An AI Handler reuses your existing AI agent subscription by exposing it through plain text files on the filesystem. Any tool that can write a file can now talk to your agent.

filesystemintegrationunixsubscription
by sebastiancarlos Aug 7, 2026 6/10
app GitHub

Warden-AI: Structurally-Verified Context Layer Claiming 50-90% Cuts

A context layer for AI coding agents that verifies structure before feeding it to the model, with a claimed 50-90 percent reduction in token spend. Worth benchmarking against your own workload before trusting the headline number.

contexttokenscostverification
by rynald0cst0ltziam Aug 7, 2026 6/10
app GitHub

claude-session-switcher: Jump Between All Your Claude Code Sessions

A macOS panel that lists every running Claude Code session and jumps straight to the iTerm2 window hosting it. Solves the problem of losing track of which terminal tab holds which agent run. Useful if you routinely keep several sessions going at once.

session-managementmacositerm2productivity
by leonardo-bolanos Aug 7, 2026 6/10
app GitHub

trck: Git-Native Issue Tracker With a Real Dependency Graph

Stores issues in git and derives readiness, topological order and demand-based ranking from a real dependency graph. The agent and the human both get an answer to 'what should I work on next' without a separate tracker service. No server or database needed.

issue-trackergitdependency-graphplanning
by leonkacowicz Aug 7, 2026 7/10
app GitHub

LocalRouter: Run Continue, LangChain, or litellm on Your Claude Plan

An OpenAI-compatible proxy that drives the real claude CLI underneath, so any OpenAI-speaking client runs against a Claude Max/Pro subscription with no API key. Existing clients need no code changes — just point them at the local endpoint. Note that routing subscription access through third-party clients may conflict with Anthropic's terms.

proxyopenai-compatiblecliintegration
by ravencloak-org Aug 7, 2026 8/10
app GitHub

untangle: Graph How Claude Would Break Down a Task

Maps a task into a graph of how Claude would decompose it, then shows how skills, plugins and MCP servers collapse parts of that graph. Makes the value of a given piece of tooling visible instead of assumed. A diagnostic tool for people tuning their setup.

visualizationworkflow-analysismcpplugins
by tahirzlone Aug 7, 2026 6/10
app Reddit

Agent IDE That Runs Your Agents on Any Self-Hosted Server

An IDE built around the idea that the editor backend can live on any remote machine while the frontend runs natively on your laptop. The motivation was not wanting to leave a laptop open for long agent runs. Relevant to anyone running unattended Claude Code sessions.

ideremoteself-hostedagents
by Frenchie4111 Aug 7, 2026 5/10
app GitHub

SkillStar: Sync Agent Skills Per Project With Zero-Copy Symlinks

Organizes your agent skills centrally and links the right subset into each project for the right CLI using symlinks instead of copies. Avoids the usual drift between duplicated skill folders. Useful once your skill collection outgrows a single directory.

skillssymlinksorganizationmulti-cli
by Blairastragalar633 Aug 7, 2026 7/10
app GitHub

crosscode: Real-Time Codebase Sync Between Teammates

Propagates file edits to a teammate's checkout within seconds, so two people (or two agent sessions) see the same working tree. Removes the commit-push-pull round trip for tight collaboration. Worth a look for pair-driving agents across machines.

synccollaborationrealtime
by amsultan2010 Aug 7, 2026 5/10
app GitHub

claude-pulse: Session Dashboard With Tool Approval From Your Phone

A local dashboard that tracks Claude Code usage and costs, and lets you approve pending tool calls remotely from a phone. Means an unattended session can pause for permission instead of failing. Useful for long runs you monitor away from the desk.

monitoringdashboardmobilepermissions
by sharinectarous449 Aug 7, 2026 7/10
app GitHub

inner-coordinates: GUI Automation Via State Graphs, Not Screenshots

Reverse-engineers macOS and iOS app workflows into state graphs so an agent navigates from remembered structure rather than re-screenshotting each step. Cuts the token cost and latency of visual GUI automation. An interesting alternative to screenshot loops.

gui-automationmacosiosstate-graph
by bettersilvanus849 Aug 7, 2026 6/10
app GitHub

reviso: Local Pre-PR Code Review That Catches AI Slop

An open-source Claude Code plugin that runs review quality comparable to /review locally, before the PR exists, with extra checks aimed at the kind of mistakes AI-written code makes. Keeps review feedback out of the public PR thread. Free and self-hosted.

code-reviewpluginpre-commitquality
by Vyttle-LLC Aug 7, 2026 7/10
app GitHub

ClaudeQuota: Windows Tray App for 5-Hour and Weekly Limits

A small Windows system tray app showing how much of your Claude 5-hour window and weekly limit is left. No terminal command needed to check. Fills a gap for Windows users, where most usage trackers are macOS-first.

usagewindowsquotamonitoring
by sergeiown Aug 7, 2026 6/10
app GitHub

sgaunet/claude-plugins: A Curated Set of Development Plugins

A collection of Claude Code plugins bundling specialized agents, skills and commands for development workflows. Installable as a marketplace rather than copied file by file. Worth browsing for ready-made pieces before writing your own.

pluginsmarketplaceagentscommands
by sgaunet Aug 7, 2026 6/10
app GitHub

honestweek: An Honest Weekly Report of Your AI Coding Work

Summarizes a week of AI coding sessions into a shareable report, with every claim verified against git history so it can't overstate what shipped. Private by default. Built spec-first from its own issue tracker, which doubles as a worked example.

reportinggitproductivitytransparency
by BryceEWatson Aug 7, 2026 7/10
app Reddit

Lupin: A Local Proxy So Claude Code Runs on Any Model

Sits between Claude Code and the provider, using passthrough for Anthropic-Messages-compatible backends (Kimi, DeepSeek, GLM, OpenRouter) and translation for OpenAI-compatible ones. Your MCP servers, skills, hooks, CLAUDE.md and plugins stay put — only the model changes. The author's point is that the setup, not the API, is the real switching cost.

proxymulti-modelopenrouterbyom
by Ok_Insurance_919 Aug 7, 2026 7/10
app GitHub

mastro: An Italian Flat-Tax Copilot as a Claude Code Plugin

Open-source plugin for Italian 'regime forfettario' freelancers: computes substitute tax, INPS contributions, advance payments and deadlines, with citations for each answer. The citation requirement is what makes it usable for something with legal consequences. Italian-language.

taxitalypluginfinance
by mikececco Aug 7, 2026 6/10
app GitHub

mr-seo: An SEO Agent Swarm for Yandex and Google

An SEO workstation combining an agent swarm, a tool-running chat assistant, a git-branch site editing bridge, and a hypothesis-then-verify loop. Runs on a Claude subscription rather than metered API spend. Unusual for its Russian-search coverage (МПК, ИКС, Нейро/Алиса).

seoyandexagent-swarmmarketing
by taneltro0t-hue Aug 7, 2026 6/10
app GitHub

claude-code-meter: Community Usage Metrics and Cost Modeling

Collects anonymized Claude Code billing data across contributors to build community-level cost models. Individual users get their own analysis; the aggregate answers what typical usage actually costs. Opt-in by design.

usagecostanalyticscommunity
by cnighswonger Aug 7, 2026 5/10
app GitHub

ClaudeUsage: Real-Time Usage and Service Status Tracking

Tracks your Claude usage in real time alongside Anthropic service status, so a slowdown can be attributed to an outage rather than your own limits. Lightweight and local. One of several usage trackers — pick on platform fit.

usagemonitoringstatus
by nockawa Aug 7, 2026 5/10
app GitHub

FriesTrader: An Unattended Claude Code Trading Agent

Two scheduled Claude Code sessions a day screen stocks and place real Robinhood orders through an Agentic Trading MCP, gated by mechanical risk rules. Runs on a Claude Pro subscription with no metered API spend. Real money is at stake and the author explicitly disclaims financial advice — treat as an architecture reference, not a recommendation.

tradingmcpautomationscheduled-sessionsfinance
by YizhiSong Aug 7, 2026 7/10
app GitHub

tasktrace: Where Your Claude Code Sessions Actually Spent Time

Breaks a session down into tool execution, model think-time, stalls and time waiting on you, via a terminal explorer and a shareable HTML report. Reads local transcripts only — nothing leaves the machine. Good for finding out whether the agent or the human is the bottleneck.

profilingsessionsanalyticslocal-only
by seyonv Aug 7, 2026 7/10
app GitHub

knowledgebase: Git-Versioned Institutional Memory for Agents

Agents write schema-enforced findings, learnings and decisions into a git-versioned store that humans review before it becomes canon. The schema keeps entries queryable instead of degrading into freeform notes. Addresses the recurring problem of agent knowledge dying with the session.

memoryknowledge-basegitreview
by simonpokorny Aug 7, 2026 7/10
app GitHub

sap-dev: SAP GUI Automation Plugins for AI Coding Assistants

Plugins that let AI coding assistants drive SAP GUI, bringing agent automation to a stack that usually resists it. Narrow domain but a large one. Worth knowing about if you work anywhere near SAP.

sapgui-automationenterpriseplugins
by sapdev-ai Aug 7, 2026 6/10
app GitHub

AleksandarBisevac/claude-plugins: Audit Pipeline With Enforced Gates

A plugin marketplace whose flagship 'audit' plugin runs a manifest-driven audit and fix pipeline with plan-first and TDD gates enforced by deterministic hooks rather than prompt suggestions. Token spend is attributed to specific phases and tasks, and the run produces a shareable HTML report. Zero dependencies.

pluginsaudittddhooksreporting
by AleksandarBisevac Aug 7, 2026 7/10
app GitHub

CALM: A Compiler-Verified Call Graph for Coding Agents

Maintains a live map of your codebase using real call graphs with compiler-verified edges, plus hard safety gates on the write path. Aims to replace the agent's guessed model of the code with a checked one. The verification step is what distinguishes it from grep-based context tools.

code-graphstatic-analysiscontextsafety
by Eilodon Aug 7, 2026 7/10
app GitHub

agenteria: Your Claude Sessions as a Pizzeria Counter

A macOS menu bar app rendering each Claude Code session as an oven in a Papa's Pizzeria style counter — what's cooking, what's blocked, what's done, and how full each context window is. The game metaphor makes parallel session state readable at a glance. Genuinely useful if you run many sessions.

monitoringmacosmenu-barsessions
by Whittle777 Aug 7, 2026 6/10
app GitHub

plumbline: Score a Repo's AI Coding Readiness

A Go tool that assesses a repository and places it on the AI Codebase Maturity Model, showing what's missing before agents can work effectively in it. Turns 'our codebase isn't agent-ready' into a specific list. Useful as a before-and-after measure.

assessmentmaturity-modelgolangreadiness
by sroberts Aug 7, 2026 7/10
app GitHub

ctrlnode: Local Agent Runtime Bridging Your Machine to a Dashboard

An open-source runtime that pairs your machine with Claude Code, Copilot, Gemini, Cursor and others, then executes tasks dispatched from the CTRL NODE dashboard. Work runs locally while control lives in the browser. Useful for kicking off runs away from the terminal.

runtimedashboardmulti-cliremote
by ctrlnode-ai Aug 7, 2026 6/10
app Reddit

Blitz: A Persistent Cloud Workspace for Claude From Your Phone

Built after Claude Remote Control proved flaky and cloud environments felt too constrained: Claude runs inside a persistent cloud workspace the author controls, reachable from a phone. The workspace outlives the machine that started the session and can host more than Claude. Aimed at mobile-first agent work.

mobilecloudremoteworkspace
by MostBlood7319 Aug 7, 2026 5/10
app GitHub

iris: AI Vision for UI Testing and Development

Uses AI vision to let agents see and test user interfaces during development instead of relying on selectors alone. Aims at the gap where a UI is technically rendered but visibly wrong. Early-stage but a real problem.

ui-testingvisionqaautomation
by frankbria Aug 7, 2026 6/10
app GitHub

claude-skills-live: A Continuously Verified Index of Claude Tooling

A curated index of Claude Code and Agent Skills projects where every entry is re-checked daily, and anything archived, deleted or ninety days quiet gets flagged and delisted. Solves the link-rot problem that afflicts static awesome-lists. The freshness guarantee is the whole point.

directoryskillscurationindex
by pjdurden Aug 7, 2026 7/10
app GitHub

quarry: Local Code Intelligence That Answers 'What Breaks If I Change This'

A fully local code intelligence engine built for coding agents: it resolves impact ('what breaks if I change this') and locates the right file without a grep-and-read crawl, claiming 99.4% fewer tokens. No GPU and no upload - the index stays on your machine.

code-intelligencetoken-efficiencylocal-firstindexing
by sait-turanalp Aug 6, 2026 8/10
app GitHub

presence: Per-Repo Memory and a Calibrated-Confidence Gate for Claude Code

Keeps per-repository notes that survive across sessions, records outcome telemetry, and gates success claims behind actual test evidence - including remembering the changes you reverted. Projects its context through MCP and AGENTS.md so other coding tools can read it. Local-only, stdlib runtime.

memorytelemetryverificationlocal-first
by sara-star-quant Aug 6, 2026 7/10
app GitHub

tabit: GTK Terminal With Vertical Tabs for Shells, AI CLIs, and Logins

A GTK terminal that stacks sessions as vertical tabs down the left side - shells, serial consoles, AI CLIs, notes, and remote logins in one window. The vertical layout scales better than horizontal tabs when you keep many agent sessions open at once.

terminalgtktabslinux
by ChrisLi826 Aug 6, 2026 5/10
app GitHub

maven-code-graph: Ctrl+Click-Like Maven Dependency Visibility for AI Agents

Gives coding assistants the thing they normally lack on JVM projects: method signatures, parameter names, and Javadoc from inside Maven JARs, resolved in about 0.2 seconds. Fills the gap where an agent can read your source but is blind to your dependencies.

javamavencode-intelligencejvm
by auver Aug 6, 2026 7/10
app GitHub

oh-my-claudian: Run Claude Code and Other CLI Agents Inside Obsidian

A Claudian fork that brings Claude Code, Codex, Grok, OpenCode, Oh My Pi, and Pi into an Obsidian vault. Useful if your notes are already the place you think, and you want the agent to work where the context lives.

obsidiannotesmulti-agentintegration
by lee259 Aug 6, 2026 6/10
app GitHub

ChangeKey: One-Click Claude Code API Key Switcher for 11 Providers

A Windows batch tool that switches Claude Code between 11 MiniMax-compatible providers with a double-click. Keys are stored locally with zero telemetry, no install required. AGPL-3.0.

windowsapi-keysprovider-switchingconfig
by lokesiu Aug 6, 2026 5/10
app GitHub

isclaude2x: Live Countdown for Claude's 2x Usage Windows

Tracks whether Claude's 2x usage promotion is currently active, with a live countdown and simple API checks. A small utility for timing heavy sessions against the bonus window.

usagequotamonitoringcountdown
by Outofsight-treasuryobligations81 Aug 6, 2026 5/10
app GitHub

shamash: A WhatsApp Chief of Staff Running on Your Claude Subscription

Runs on your own machine against the Claude subscription you already have - no API key, no cloud, no telemetry - and acts as a chief of staff over your WhatsApp. A good example of pointing a local agent at a personal messaging surface.

whatsappassistantlocal-firstprivacy
by RSTjordan Aug 6, 2026 7/10
app GitHub

airport-authority: Session Continuity and Lifecycle Control for Claude Code

Third-generation successor to no-look-pass, handling session continuity and project-lifecycle control so long-running Claude Code work is not lost between sessions. The aviation metaphor runs throughout: trust the tower, never lose a session.

session-managementcontinuitylifecyclerecovery
by Robot-Friends-Community Aug 6, 2026 6/10
app GitHub

BIKS Loader: Discover, Link, and Install Claude Code Plugin Marketplaces

Browses available Claude Code plugins, links marketplaces, and installs what you pick - replacing the manual repo-hunting step. Useful if you sample plugins often enough that install friction matters.

pluginsmarketplaceinstallerdiscovery
by triune-contemplation240 Aug 6, 2026 5/10
app GitHub

dotmd: CLI and Claude Code Plugin for Managing Markdown Docs and ADRs

Indexes, queries, validates, and graphs markdown documents that carry YAML frontmatter, with lifecycle management for plans, ADRs, and RFCs. Adds Notion sync and AI-generated summaries, and ships as both a CLI and a Claude Code plugin.

markdownadrdocumentationnotion
by reowens Aug 6, 2026 7/10
app GitHub

Tokenmax: macOS Menu Bar Quota Monitor for Claude Code and Codex

A macOS menu bar app showing remaining Claude Code and Codex quota with reset countdowns and burn-rate projection, so you can see whether a long session will finish before the limit. Also holds a local prompt queue.

macosquotamenu-barmonitoring
by danieldrinhausen Aug 6, 2026 7/10
app GitHub

dunbar: AI-Native Relationship Management Built on 5 Dunbar Circles

A contact and relationship system your agent can actually operate: five Dunbar circles for structure, CSV as source of truth, and the filesystem as the schema. Deliberately plain formats so an LLM can read and edit it directly.

crmpersonalcsvai-native
by Astralune-ai Aug 6, 2026 5/10
app GitHub

U-Pool: Desktop Provider Switcher for Claude Code and Codex Endpoints

Keeps every endpoint, API key, and model in one place and switches the active provider in a click, with a latency probe so you can check a provider before committing to it. Atomic writes and rolling backups protect your config files. Python plus Next.js in a native OS webview.

provider-switchingapi-keysdesktopconfig
by U-C4N Aug 6, 2026 6/10
app GitHub

seanlab-studio: Local-First Agentic Studio for Talking-Head Videos

Produces, self-reviews, and renders knowledge-driven talking-head videos using Remotion, with the whole pipeline running locally. The self-review pass is the interesting part - the agent critiques its own output before rendering.

videoremotionlocal-firstcontent
by SeanLab612 Aug 6, 2026 5/10
app GitHub

shredded: Counts How Often Your Agent Ran Tests but Hid the Result

Measures a specific failure mode: the agent runs the test suite, then the outcome never makes it into the transcript. Turning that into a countable metric is a sharp way to catch agents quietly papering over failures.

testingintegritymetricsverification
by sjh9714 Aug 6, 2026 7/10
app GitHub

agentspaces: Leases and Atomic Claims for Multi-Agent Task Routing

Coordinates concurrent agents with leases, shared state, and atomic claims so two agents never grab the same task, and work is recoverable if one crashes mid-claim. The primitives are the classic distributed-systems answer applied to agent fleets.

multi-agentcoordinationleasescrash-recovery
by harshramg5007 Aug 6, 2026 7/10
app GitHub

EML-Research-POC: Exp-Minus-Log Math Primitive as a Claude Code Tool

A research proof-of-concept wiring Odrzywolek's EML (Exp-Minus-Log) primitive into Claude Code as a tool-use capability, reporting 21/21 on a math benchmark and 8/8 on a Riemann Hypothesis sub-investigation. Niche, but a clean example of exposing a specialised numeric primitive as a tool.

mathtool-useresearchbenchmarks
by ElMatiOfficial Aug 6, 2026 5/10
app GitHub

vibepen: Docker Sandbox for Coding Agents

A Docker-based sandbox for running coding agents in isolation, so an agent with broad permissions cannot reach past the container into your real environment.

dockersandboxisolationsecurity
by davxy Aug 6, 2026 6/10
app GitHub

inkblot: An LLM Eval Harness for All Your Harnesses

An evaluation harness aimed at the layer above the model - testing the agent harnesses themselves rather than raw model output. Relevant if you maintain several agent setups and need to compare them systematically.

evaluationbenchmarksharnesstesting
by unohee Aug 6, 2026 6/10
app GitHub

Lupin: Run Claude Code on Any LLM Provider With Failover and a Doctor

A local-first proxy that runs Claude Code against other LLM providers without rebuilding your setup: verified provider profiles, OAuth device-flow login, failover, and content-aware routing. The per-model compatibility doctor is the standout - it tells you honestly what breaks on each model.

proxyprovidersfailoverrouting
by Fanfulla Aug 6, 2026 7/10
app GitHub

ai-session-search: Local Full-Text Search Across 7 AI Coding Tools

Searches and manages AI coding sessions locally with full-text search spanning seven different tools. Useful once your history is split across Claude Code, Codex, and others and you cannot remember where a conversation happened.

searchsessionshistorylocal-first
by Unstable-ascendingartery75 Aug 6, 2026 7/10
app GitHub

quotapane: Always-On-Top Quota Monitor for Claude and Codex

An always-on-top window showing Claude and Codex subscription quota, reading locally from your own CLI credentials. Releases are verifiable and nothing is phoned home.

quotamonitoringprivacydesktop
by cipherpine Aug 6, 2026 6/10
app Reddit

SKI: Voice Coding With an Approve-Before-Send Handoff to Claude Code

SKI runs speech recognition and synthesis locally and talks to Claude Code through plain files in the project. Its review mode is the point: the transcript lands in an editable bubble and nothing reaches the agent until you confirm - because a misheard filename becomes a file edit rather than a typo in a text box.

voicespeech-to-textlocal-firstsafety
by Particular_Luck80 Aug 6, 2026 6/10
app Reddit

A Plugin That Updates CLAUDE.md From Your Real Session History

Reads the JSONL sessions Claude Code already writes to ~/.claude/projects plus a log where you jot one line whenever something annoys you, finds what actually repeats, and proposes a single config change you approve into one easily reverted commit. Also detects a new model generation and suggests updating model-specific sections.

claude-mdpluginsessionsautomation
by wraithyyy Aug 6, 2026 7/10
app Reddit

Open-Source Claude Code Launcher: Profiles, Status Bar, Auto-Continue

An MIT-licensed launcher around the unmodified Claude Code CLI - not a wrapper, fork, or proxy. Adds per-project profiles remembering model, flags, startup commands and env vars, a live status bar with context and reset times, auto-continue when your limit resets, and voice alerts. Windows, Mac, and Linux.

launcherprofilesstatus-barquota
by PutFun1491 Aug 6, 2026 6/10
app Reddit

A Production Failure Simulator Built With Claude Code

A monitoring product that only proves itself when something else is broken had an awkward testing problem: every failure it watches for lives behind third-party APIs. Rather than assembling Mockoon or WireMock with proxy settings and routing rules, the team built a failure simulator with Claude Code.

testingsimulationmonitoringsaas
by Sad_Egg_2313 Aug 6, 2026 6/10
app Reddit

pipeline-view: Git-Style Tree of What Your Subagents Actually Did

Reads the JSONL sessions Claude Code already writes and draws a git-style tree of every run: which subagent ran, what it decided, attempts burned, which runs merged and which stopped. No hooks and nothing inside your agent loop, so in-flight runs are unaffected; the event log is content-free and whitelist-validated. Python 3.9+, no dependencies, MIT.

subagentsvisualizationsessionsobservability
by New-Salad3672 Aug 6, 2026 7/10
app GitHub

ai-limit: CLI and GUI monitor for Claude Code and Codex usage limits

A usage monitor for Claude Code and Codex that tracks quota, rate-limit windows and token consumption. Ships both a terminal CLI and a graphical mode, with a bilingual English/Chinese interface. Useful if you juggle subscription limits across two assistants.

usagemonitoringcliguicodex
by zhuchenxi113 Aug 5, 2026 6/10
app GitHub

jarvis: macOS menu-bar mission control for Claude Code sessions

A Rust and Tauri menu-bar app that surfaces every running Claude Code session so none sits blocked waiting on your input. It is event-driven off Claude Code's native hooks, and lets you see, hear and reply to agents from one place. Fully local, no server component.

macostaurirusthookssession-management
by Sergey-Chernyshev Aug 5, 2026 8/10
app GitHub

skillOps-intellij: IntelliJ plugin for creating and validating agent skills

An IntelliJ IDEA plugin for authoring skills for Claude, Codex and Gemini directly inside a project. Provides creation scaffolding and validation without leaving the IDE. The JetBrains counterpart to the same author's VS Code plugin.

intellijjetbrainsideskillsvalidation
by spmisha134 Aug 5, 2026 6/10
app GitHub

filamentphp-claude-design-system: Filament admin panel in Claude Design

An unofficial recreation of the Filament PHP admin panel using Claude's design language, with 78 React components and design tokens. Includes a full click-through panel demo. Not affiliated with the Filament core team.

filamentdesign-systemreactuicomponents
by Hussam3bd Aug 5, 2026 5/10
app GitHub

claude-code-monitor: Local dashboard over Claude Code JSONL transcripts

A self-hosted dashboard that parses the JSONL transcripts Claude Code already writes to show tokens, cost, prompts, sessions, tool calls and failures. An optional HTTP-hook feed adds a live view of the current session. No extra instrumentation required.

dashboardusagetranscriptshooksmonitoring
by alihassanml Aug 5, 2026 7/10
app GitHub

rejoin: Unified terminal session manager for Claude Code and other agents

Manages terminal sessions across Claude Code, Codex, Cursor, Pi and OpenCode from one interface. Solves the common problem of losing a sprawl of agent tabs to a restart. Single tool rather than per-agent scripts.

terminalsessionstmuxclimulti-agent
by Subhransu-De Aug 5, 2026 7/10
app GitHub

code-intel-pipeline: Pre-edit code intelligence and regression gates for agents

A local pipeline that builds architecture maps, hotspot rankings and change-impact analysis before an agent starts editing, then gates structural regressions afterward. Rust core built on ripgrep plus several analysis tools. Aims to give agents real structural context instead of grep results.

rustcode-intelligencearchitecturegatesanalysis
by 2233admin Aug 5, 2026 7/10
app GitHub

claude-code-local: Run Claude Code fully on-device on Apple Silicon

An MLX-native server that speaks the Anthropic API so Claude Code can talk to local models like Qwen, Llama and Gemma instead of the cloud. Reports roughly 65 tokens per second on large local models. Built for airgapped NDA, legal and healthcare work.

local-llmmlxapple-siliconofflineprivacy
by nicedreamzapp Aug 5, 2026 8/10
app GitHub

tripwire: Security and agent-integrity scanner for coding agents

Scans a repository for the things that mislead or hijack a coding agent: prompt-injection sinks, leaked secrets, and documentation that contradicts the code. Supports Claude Code and Cursor. Positions agent integrity as a distinct problem from ordinary static analysis.

securityprompt-injectionsecretsscanneraudit
by lapointelabs Aug 5, 2026 8/10
app GitHub

limit-dashboard: Native macOS dashboard for AI subscription usage limits

A SwiftUI menu app tracking Claude and Claude Code usage windows across multiple accounts, alongside Codex rate limits and Vertex AI token spend. Shows live reset countdowns and keeps local usage history. Local-only with no analytics.

macosswiftuiusagelimitsdashboard
by mreza0100 Aug 5, 2026 7/10
app GitHub

bb: An agent IDE that builds itself

A self-hosting IDE for agent-driven development — the tool is developed using itself. Details are thin in the README, so treat it as early-stage. Interesting mainly as a bootstrapping experiment.

ideagentsself-hostingexperimental
by get-bb Aug 5, 2026 6/10
app GitHub

spyc: Rust TUI file commander whose AI agent can query the commander itself

A two-pane terminal file manager written in Rust with an AI agent in the side pane. The novel bit is that the agent can query the file commander's own state rather than shelling out blindly. A different take on putting an agent in a TUI.

rusttuifile-manageragentterminal
by Tripstack-Corp Aug 5, 2026 6/10
app GitHub

curie: Self-hostable delivery platform for Claude Code style agents

An open-source platform for running agent bundles behind real channels, starting with Slack. The same bundle runs locally and on Kubernetes, and ships with git push. Aimed at teams who want agents in production without a vendor.

self-hostedslackkubernetesdeploymentopen-source
by curie-eng Aug 5, 2026 7/10
app GitHub

sift: Native macOS app that indexes and searches Claude Code transcripts

Indexes your local session transcripts so you can search everything you have ever done in Claude Code. Native macOS app, so search is fast and stays on-device. Overlaps with claude-find but favors browsing over resuming.

macossearchtranscriptssessionsindexing
by kasparovabi Aug 5, 2026 7/10
app GitHub

OpenQuota: Cross-platform tracker for AI coding usage, limits and spend

An open-source tracker for AI coding usage across platforms, showing limits, reset times and spend in one place. Cross-platform rather than macOS- or Windows-only. Another entry in a crowded usage-monitor field, distinguished by portability.

usagelimitstrackercross-platformopen-source
by deviffyy Aug 5, 2026 6/10
app GitHub

clarity-studio: Desktop app for building and running agentic automations

Build automations with Claude Code, then run them locally under your own API keys with real schedules and webhooks. Open source and desktop-first, so nothing needs to live in someone else's cloud. Bridges the gap between one-off agent runs and scheduled production jobs.

desktopautomationscheduleswebhooksopen-source
by Clarittyai Aug 5, 2026 7/10
app GitHub

5dive-plugins: Claude Code plugin marketplace with a Telegram bridge

A plugin marketplace maintained by 5dive, centered on agent-channel integrations. The headline plugin bridges Claude Code to Telegram. Small but a working example of running your own marketplace.

pluginsmarketplacetelegramintegrations
by 5dive-ai Aug 5, 2026 5/10
app GitHub

decant: Local-first analysis of Claude Code and Codex session spend

Analyzes local session logs to report token spend, context-window pressure, files touched and cost. Runs entirely on your machine with no upload step. Emphasis on which files consumed the budget, not just totals.

analysistokenscostsessionslocal-first
by dosu-ai Aug 5, 2026 7/10
app Reddit

OS overlay app built with Claude Code: local transcription and notch UI

A Tauri and Rust overlay that lives at the cursor instead of being another window, with sub-15ms local audio transcription and a Ctrl+Right-Click snippet menu. Most of the implementation was done in Claude Code. The author offers to walk through the workflow.

taurirustwindowsoverlaytranscription
by Naikoshu Aug 5, 2026 6/10
app Reddit

Email security layer for AI agents, built with a build-then-attack loop

Screens inbound email before an agent reads it: strips hidden text, scans for prompt injection, and hands over structured JSON instead of a raw body. The design premise is that an agent's inbox is a trust boundary, not a pipe. The write-up focuses on the alternating build-then-attack development loop.

securityprompt-injectionemailagentsworkflow
by HappyCorner4565 Aug 5, 2026 7/10
app Reddit

Mirafold: Browser front end for Claude Code with full terminal parity

An open-source browser UI whose stated spec is parity: permission prompts, slash commands, shell passthrough, session resume and model switching all behave exactly as in the terminal, including the ugly parts. Nothing the agent says or does is hidden. Parity-first is a meaningfully different stance from most Claude Code GUIs.

browseruiopen-sourcefrontendparity
by MirafoldHQ Aug 5, 2026 8/10
app GitHub

ClawCode: Persistent, Messaging-Enabled Agents as a Claude Code Plugin

A Claude Code plugin (not a separate harness) that adds persistent memory, configurable personality, and messaging integrations for WhatsApp, Telegram, and Discord, plus a service mode for always-on 24/7 agent runs. Imports configuration from OpenClaw, making it easy to bring existing persistent-agent setups into Claude Code.

pluginpersistent-agentmessaging
by crisandrews Aug 5, 2026 7/10
app GitHub

UsageAI: Windows Tray Meter for Claude Code, Codex, Copilot, and Gemini Usage

A lightweight Windows system-tray app that shows usage-limit meters for Claude Code, Codex, GitHub Copilot, and Google Gemini in one place. Handy for anyone juggling multiple AI coding subscriptions who wants an at-a-glance view of remaining quota.

appusage-trackingwindows
by VladiKogan Aug 5, 2026 6/10
app Reddit

QM, YC's Open-Sourced Agent Harness, Works With Claude Code Out of the Box

A Reddit post highlighting QM, an agent harness recently open-sourced by Y Combinator, which integrates with Claude Code using just Node, Postgres, and a single init command. Notably, the OP says you can hand the repo to Claude Code itself to set up the harness, and is soliciting community feedback on real-world use.

harnessdiscussion
by Due-Cup9574 Aug 5, 2026 5/10
app GitHub

curia: Self-Hosted AI Coding Harness You Can Drive From Your Phone

A self-hosted harness for driving AI coding agents remotely from a phone, letting you kick off or monitor coding sessions away from your desk. Description is brief, so exact Claude Code integration details are not fully clear yet.

appremoteself-hosted
by alp82 Aug 5, 2026 5/10
app GitHub

docmancer: Index What Your Coding Agents Already Know, Across Tools

Indexes the memory, rules, and instructions that Claude Code, Codex, Cursor, and Gemini have written locally, then carries the durable parts to every agent so context is not siloed per tool. Local-first and MIT licensed, useful for anyone running multiple coding agents on the same machine.

appmemorycross-tool
by docmancer Aug 5, 2026 7/10
app GitHub

quill-writer: Claude AI Sidebar for LibreOffice Writer

Brings a Claude AI assistant sidebar into LibreOffice Writer, built on the Claude Agent SDK using an existing Claude Code login rather than a separate API key. A novel integration bringing agentic AI assistance into a mainstream office document editor.

applibreofficeagent-sdk
by jedbillyb Aug 5, 2026 7/10
app GitHub

project-template: Scaffolding and Config Standard for Claude Code Projects

A starter template plus scripts that scaffold and configure new Claude Code projects to a consistent standard, automating setup steps that are otherwise done by hand. Description is light on specifics of what the standard actually covers.

apptemplatescaffolding
by actarus314 Aug 5, 2026 5/10
app GitHub

agent-11: Open-Source Suite of 11 Specialized Agents for Solo Founders

Deploys 11 specialized development agents into Claude Code with a single install command, aimed at solo founders who need broad coverage across roles like product, engineering, and QA without a team. Open source and actively maintained.

appsubagentssolo-founder
by TheWayWithin Aug 5, 2026 7/10
app Reddit

Memmy: Import Cursor, Claude Code, and Codex Session History Into Local SQLite

A CLI that reads Cursor's state.vscdb, Claude Code's JSONL session logs, and Codex's rollout history among other formats, redacts secrets, and dumps it all into a local SQLite database to avoid re-explaining project context when switching agent tools. Read-only scan with local-only storage; the author notes recall accuracy and cross-project bleed are still being tested.

appmemorysession-history
by Silk_song11 Aug 5, 2026 7/10
app GitHub

Moira: Ubuntu desktop app for Claude and Codex usage quotas with NTFY alerts

Moira is a native Ubuntu desktop app that tracks Claude Code and Codex usage quotas and reset times in one place. It sends NTFY push alerts when you are approaching limits, filling a gap since most quota trackers target macOS only.

quota-trackerlinuxdesktop-app
by ThibSama Aug 5, 2026 6/10
app GitHub

whoburnedmore: CLI that tallies your AI coding agent token burn and ranks it

A CLI tool (npm package) that measures how many tokens your AI coding agents actually consumed and lets you submit the total to a public leaderboard. Useful for comparing real-world usage patterns across tools and teams rather than relying on vendor marketing.

clitoken-trackingleaderboard
by arhxam Aug 5, 2026 6/10
app GitHub

ai-agent-design-toolkit: Figma-like design review and PNG export for agents

A design toolkit for AI coding agents (Claude Code, Codex, Qwen) that composes layered HTML, offers a browser-based Figma-like review editor, and exports token-free pixel-perfect PNGs. Notable for explicit Vietnamese-text-safe rendering, a gap in many design tools.

designappexport
by hoangkimquoc Aug 5, 2026 6/10
app GitHub

excessibility: Accessibility Snapshot Testing for Phoenix LiveView

A testing tool for Phoenix LiveView apps that captures HTML during tests and runs it through Pa11y for WCAG compliance checks, with AI-friendly timeline analysis to help debug accessibility regressions. Niche to the Elixir/Phoenix ecosystem but fills a real gap in automated a11y testing there.

testingaccessibilityphoenix-liveview
by lessthanseventy Aug 5, 2026 6/10
app GitHub

defn: AI-Native Code Database for Navigating Go Code by Structure

A code database for Go that lets AI agents navigate, edit, and understand code by its structural elements (functions, types, calls) instead of by file and line number. Aims to make large Go codebases more tractable for agents that otherwise have to grep and read whole files for context.

appgocode-navigation
by justinstimatze Aug 5, 2026 6/10
app GitHub

Memsem: Local Semantic Memory for AI Agents With Contradiction Handling

Memsem is a local, one-command semantic memory layer for AI agents: it auto-writes durable facts, prioritizes them, detects and resolves contradictions, and supports semantic search. Runs fully offline with no dependency on a specific agent tool.

memorysemantic-searchlocal
by WindSeries69 Aug 5, 2026 7/10
app GitHub

Viberank: AI Coding Usage Leaderboard for Claude Code, Codex, Gemini CLI

A community leaderboard that ranks AI coding tool usage using real costs and token counts pulled from ccusage data, covering Claude Code, Codex, Gemini CLI and more. Submit your own stats with the npx viberank-cli command to see how your usage compares to others.

leaderboardusage-trackingccusage
by sculptdotfun Aug 5, 2026 7/10
app GitHub

MCPane: Unified Desktop Control Panel for Claude Code, Codex, and MCP

A desktop app (macOS/Windows installers) providing a unified control panel across Claude Code, Codex, and the broader MCP ecosystem. Aimed at users managing multiple agent tools and MCP servers who want a single dashboard instead of juggling separate CLIs.

desktop-appmcpdashboard
by yeuxuan Aug 5, 2026 6/10
app GitHub

Hermes Shim: Use Any OpenAI-Compatible LLM Endpoint with Claude Code CLI

A shim that lets the Claude Code CLI talk to any OpenAI-compatible or Hermes LLM endpoint while keeping tool calling working. Useful for developers who want to keep the Claude Code CLI interface and workflow while pointing it at a different backend model.

llm-proxyopenai-compatibletool-calling
by papadiyer Aug 5, 2026 6/10
app Reddit

Hoop: Guardrails, Secret Scanning, and Output Filtering Plugin

A Claude Code plugin from Hoop Labs that bundles three tools: a guardrails engine that blocks destructive commands before execution, a local scanner that flags personal data and secrets appearing in a session, and an output filter that trims noisy command results to save tokens. Installs via the plugin marketplace and runs on Mac/Linux (WSL on Windows).

pluginguardrailssecuritytoken-efficiency
by hoop-dev Aug 5, 2026 7/10
app GitHub

Mindvault: Long-Term Memory With Session Summaries and Web UI

Mindvault captures Claude Code sessions, AI-summarizes them, and automatically injects relevant context back into new sessions at start-up. It also serves a searchable web UI for browsing past session history.

memorycontextweb-ui
by SUDO-GOAT7 Aug 5, 2026 7/10
app Reddit

skilld: turns your repeated Claude Code corrections into skill files

Scans local Claude Code transcripts for corrections you've repeated to the assistant and surfaces each one with your own quotes as evidence, accept or reject with one key. Accepted corrections become skill files for Claude Code, AGENTS.md, or Cursor. Local-only, no account, MIT licensed.

skillstranscriptsself-improvementcli
by RipSpiritual3778 Aug 5, 2026 7/10
app GitHub

coding-os: a cognitive operating system for AI coding agents

Gives AI coding agents memory, structure, and discipline through a knowledge graph, a Scrumban board, and an enforced engineering loop, aiming to make agent behavior more consistent across sessions.

memoryknowledge-graphproject-management
by kouroshez Aug 5, 2026 6/10
app GitHub

Assistant: an agent-hypervisor AI stack with a graph-powered repo wiki

An AI stack built around an agent hypervisor that automates tasks, builds a graph-powered wiki of your repo, answers questions, and searches across all your connected tools, accessible from browser, terminal, or API.

agent-hypervisorwikisearch
by bearlike Aug 5, 2026 6/10
app GitHub

llm-ticket-triage-agent: Claude-powered support ticket triage with eval harness

An agent built on the Anthropic Messages API that classifies K-12 edtech support tickets into structured, schema-validated records (category, priority, FERPA risk, sentiment, suggested response). Includes a React dashboard, an eval harness scored against hand-labeled ground truth, and a content-hash cache to control costs.

appstructured-outputsevalsdashboard
by erezende11 Aug 4, 2026 6/10
app GitHub

parallax-threejs: Claude Code plugin for debugging three.js/GLSL scenes

A Claude Code plugin that correlates the scene graph, console output, GL state, and rendered pixels into a single diagnostic loop for debugging three.js/GLSL rendering issues, plus a SHA-indexed visual regression test suite.

appthreejsglsldebugging
by propersloth Aug 4, 2026 7/10
app GitHub

Baton: Drift Detector for CLAUDE.md/AGENTS.md vs Git History

Baton is a deterministic tool that diffs the claims in a multi-agent memory file (CLAUDE.md/AGENTS.md) against actual git history to catch stale or false documentation. Useful for keeping agent instructions honest as a codebase evolves.

claude.mddrift-detectionagents.mdgit
by Ayinla10 Aug 4, 2026 7/10
app GitHub

Claude Workbench: Git Template for Versioning Global Claude Config

A template repo for versioning your global Claude Code configuration (instructions, rules, hooks, persistent memory) in git, with optional cross-machine sync. Helps keep personal Claude Code setups reproducible and portable across machines.

configdotfilesclaude.mdsync
by iasolb Aug 4, 2026 6/10
app GitHub

Kelpie: Read-Only Attention Board for Local Claude Code Sessions

Kelpie is a read-only dashboard that shows which of your local Claude Code sessions is waiting on you, useful when running many parallel agent sessions. Helps avoid babysitting terminals to find the one that needs input.

dashboardmulti-sessionmonitoring
by dkomlen Aug 4, 2026 7/10
app GitHub

Free-Claude-Code: Bridge to Run Claude Code Against Gemini 2.0

A local proxy/bridge that lets Claude Code talk to Gemini 2.0 instead of Anthropic's API, claiming fixes for 401 handshake and tool-index collision errors seen in other bridges. Relevant to users experimenting with alternate backends for the Claude Code CLI.

proxygeminibridge
by arkalibaig Aug 4, 2026 5/10
app GitHub

Assay: Reproducible Evaluation Framework for AI Artifacts

Assay is an open framework for evaluating AI artifacts like skills, MCP servers, agents, and plugins — it inspects what's inside them, optionally sandboxes and runs them, judges the results, and publishes a verifiable report. Useful for vetting third-party skills/MCP servers before trusting them.

evaluationmcpskillssandboxtrust
by metahub-ai Aug 4, 2026 7/10
app GitHub

git-cairn: Git-Native Memory of Decisions for Coding Agents

git-cairn distills decisions, rejected alternatives, and invariants from your commit history into a git-native memory that's served back to the agent when relevant files are touched. Aims to give coding agents persistent project context without a separate memory database.

memorygitcontextagents
by YUNGC0DE Aug 4, 2026 6/10
app GitHub

tokimeter: Local-First Usage & Cost Meter for AI Coding Agents

tokimeter tracks usage and cost locally across Claude Code, Codex, Cursor, Grok Build, Hermes, opencode, Cline, and Copilot CLI, with no account or telemetry required. Useful for developers who want a unified, private view of their spend across multiple coding agents.

usage-trackingcostlocal-firstprivacy
by toshipepe Aug 4, 2026 7/10
app GitHub

vibe-float: Floating Dashboard for Codex + Claude Code Sessions

A configurable floating dashboard for macOS and Windows that surfaces Codex and Claude Code session status, with StreamDock hardware controls for Codex. Useful for developers running multiple agent sessions who want at-a-glance status without switching windows.

dashboarduimulti-agent
by saheru Aug 4, 2026 5/10
app GitHub

AWS Sample: Internal Claude Code Platform on Bedrock AgentCore

An AWS sample showing an internal agent platform built on Amazon Bedrock AgentCore, combining interactive Claude Code cloud workspaces with headless agent kernels behind one portal — including publishing, scheduling, channels, memory, evals, and governance. Useful reference architecture for enterprises wanting to run Claude Code at scale on AWS.

awsbedrockagentcoreenterprisecloud
by aws-samples Aug 4, 2026 7/10
app GitHub

hindcast: Local Session Browser, Replay & Cost Tracker for Claude Code

hindcast is a local-first Mac app to browse, search, and replay every Claude Code session with a timeline scrubber, positioned as an alternative to ccusage for cost tracking. Useful for reviewing past agent work and understanding token/cost usage over time.

session-viewercost-trackingmacos
by karanb192 Aug 4, 2026 8/10
app GitHub

coffee-bar: Keep Your Mac Awake During Claude Code Sessions

A caffeinate alternative that keeps a Mac awake, screen off, specifically while an AI coding agent like Claude Code is working. Useful small utility for anyone running long unattended Claude Code sessions who doesn't want the machine sleeping mid-task.

macosutilitycaffeinate
by ArangoGutierrez Aug 4, 2026 5/10
app GitHub

contextcost: Measure What Your Repo Costs an AI Agent to Read

contextcost measures how many tokens a repository costs an AI coding agent to read, identifies what's wasting that budget, and lets you re-measure to prove savings after cleanup. Useful for teams optimizing repos for cheaper, faster agent context loading.

context-optimizationtokensmeasurement
by CAOShurong Aug 4, 2026 7/10
app GitHub

panevibe: Terminal-First Coding Harness in a Single Rust Binary

panevibe runs real CLI coding agents (Claude Code, Codex, or any open model) inside real PTYs from a single self-contained Rust binary. Useful for developers wanting a lightweight, dependency-free terminal harness to drive multiple agent CLIs.

terminalrustcli-harness
by brandonmlicea Aug 4, 2026 6/10
app GitHub

skill-radar: Daily GitHub Radar for AI Agent Skills and MCP Servers

skill-radar is a daily-updated radar tracking new GitHub repos for AI agent skills, MCP servers, prompts, and other agent-native developer tools. Useful for staying on top of the fast-moving Claude Code / agent tooling ecosystem without manually trawling GitHub.

discoverydirectorymcp
by soarsky1991 Aug 4, 2026 7/10
app GitHub

ai-tool-usage-limits: macOS Menu Bar Monitor for AI Coding Tool Quotas

A local-first macOS menu-bar app that tracks quotas, token usage, and API-equivalent cost across AI coding tools. Useful for developers who want an at-a-glance view of how much of their AI coding budget/limits they've used.

macosusage-trackingmenu-bar
by iklynow-hue Aug 4, 2026 6/10
app GitHub

cimble: Progressive, Self-Splitting Project Memory for Claude Code

cimble provides project memory for Claude Code that progressively grows and automatically splits itself as it accumulates, aiming to avoid the single-bloated-CLAUDE.md problem. Useful for large or long-running projects where a static memory file becomes unwieldy.

memoryclaude-mdproject-context
by 34823 Aug 4, 2026 7/10
app GitHub

LianYaoHu: Deny-Default Sandbox with VPN-Only Egress for Coding Agents

LianYaoHu runs Claude Code, Codex, or any coding agent inside a deny-default sandbox that only allows network egress through a VPN, using sandbox-exec+PF on macOS and Landlock/seccomp+iptables on Linux. Useful for developers who want strong isolation and controlled network access when letting an agent run autonomously.

sandboxsecuritynetwork-isolation
by madeye Aug 4, 2026 7/10
app GitHub

Nexting: wearable terminal for dispatching tasks to AI agents

An open-source (MIT) wearable hardware terminal that lets you tap and speak to dispatch tasks to AI coding agents like Claude Code, OpenClaw, and Codex. Aimed at hands-free task dispatch away from the keyboard.

hardwarewearableopen-source
by Nexting-ai Aug 4, 2026 6/10
app GitHub

branch-ai: forkable reasoning canvas for AI CLI extended thinking

Captures the extended-thinking traces from Claude Code, Codex, Gemini, and Droid as a navigable, forkable tree so you can rewind, branch from any point, or inject facts mid-thought. Local-first and ships with an MCP server for integration.

mcpreasoninglocal-first
by nikolas-sapa Aug 4, 2026 7/10
app GitHub

Synthelion: prompt compression to cut LLM token usage

A prompt-compression tool that reduces token usage by up to 70% before prompts reach the model, working across Claude Code, OpenAI, LangChain, OpenCode, Cursor, and other agent frameworks. Aimed at lowering API costs and speeding up responses.

prompt-engineeringcost-optimization
by francescopaolopassaro Aug 4, 2026 6/10
app Reddit

Rootpilot: Mac orchestration app that sharpens ideas before Claude Code builds

A Mac app that sits atop your local Claude Code CLI, first running parallel web research to sharpen a product idea into a concrete market position, then driving Claude Code slice-by-slice against that spec with automatic course-correction. Keeps a per-project .companion/ memory of decisions injected as a cached context block, and routes work across Haiku, Sonnet, and Opus by task.

orchestrationappmacos
by Known_Isopod_1581 Aug 4, 2026 7/10
app GitHub

iTerm2 cockpit for running many Claude Code panes side by side

A setup for iTerm2 that arranges multiple Claude Code sessions as panes in a single cockpit view, making it easier to monitor and manage several parallel agent sessions at once.

terminalmulti-agentiterm2
by igor-grubic Aug 4, 2026 6/10
app GitHub

oh-my-term: agent-aware terminal multiplexer with web client

A terminal multiplexer built with AI coding agents in mind, offering a remote web client so you can monitor and interact with agent sessions like Claude Code from a browser, not just a local terminal.

terminalmultiplexerremote-access
by VincentHanxiaoDu Aug 4, 2026 6/10
app GitHub

claude_mate: desk device that shows which Claude Code session needs you

A tiny Arduino + OLED desk device (macOS) that displays which of your parallel Claude Code sessions needs attention and jumps you to it, cutting the cognitive load of babysitting multiple agent sessions. Personal/non-commercial license; an ESP32 Wi-Fi remote version is planned.

hardwaremulti-agentmacos
by vlgutv22 Aug 4, 2026 6/10
app GitHub

sokkan: self-hosted cockpit for parallel Claude Code sessions

A self-hosted dashboard for managing multiple parallel Claude Code sessions, positioned as 'the helm, not the autopilot.' Automatically injects project memory into each session at spawn time so agents start with relevant context instead of rediscovering it.

parallel-sessionsmemoryself-hosteddashboard
by ninabot-ch Aug 4, 2026 7/10
app GitHub

hypernovum: 3D Obsidian IDE that visualizes and dispatches Claude Code agents

A Three.js-based 3D interface for Obsidian that renders your vault as a 'code city' and lets you dispatch AI coding agents (Claude Code, Codex, Antigravity) to work on research quests, watching the agent fleet operate in real time. A novel visualization layer for orchestrating multiple agents against a personal knowledge base.

obsidianvisualizationmulti-agentsecond-brain
by Pardesco Aug 4, 2026 6/10
app GitHub

runway: macOS menubar app tracking context window usage per session

A macOS menubar app that shows how full each active Claude Code session's context window is, with configurable 60%/80% warnings per session. Handy for anyone running multiple concurrent sessions who wants to avoid surprise compaction or context overflow.

macosmenubarcontext-windowmonitoring
by volkermaxmeyer Aug 4, 2026 7/10
app GitHub

talminal: voice-controlled canvas for Claude Code and Codex terminals (Windows)

A Windows 11 app that presents a canvas of agent terminals (Claude Code and Codex CLI) controllable by voice. Aimed at users who want to manage multiple concurrent agent sessions hands-free rather than switching between terminal windows.

voice-controlwindowsmulti-agentterminal
by RWitzner Aug 4, 2026 6/10
app GitHub

composer: parallel UI variant generation and comparison for coding agents

A tool that takes one prompt and has coding agents build multiple divergent UI variants in parallel, laid out on an infinite board for side-by-side comparison and iteration. Useful for quickly exploring design directions instead of committing to a single agent-generated layout.

ui-generationparallel-iterationcoding-agentsdesign
by fagnersales Aug 4, 2026 5/10
app Reddit

Terminal-based Jupyter-style notebook built for Claude Code data analysis

A terminal notebook (h5i-db) that lets both humans and Claude Code run individual cells instead of re-executing whole scripts from scratch during data analysis, rendering images via ratatui-image. Ships with a preinstalled SQL kernel backed by a time-series database, aimed at quantitative/data-science workflows.

jupyterdata-scienceterminalsql
by OkBreath9382 Aug 4, 2026 7/10
app GitHub

key-amnesia: Let AI Agents Use Secrets Without Seeing Them

A tool that lets AI coding agents like Claude Code use passwords and API keys during tasks without ever exposing the plaintext values to the model or its context. Useful for reducing credential leakage risk when agents need to authenticate to external services.

securitycredentialsagent-safety
by fujitoid Aug 4, 2026 6/10
app GitHub

tokenusage: Rust Token Usage Tracker for Claude Code and Codex

A fast Rust CLI/TUI/GUI tool that tracks token usage across Codex and Claude Code sessions, with unified reports and live monitoring. Helps developers keep tabs on consumption across multiple coding agent tools in one dashboard.

token-trackingclimonitoring
by FelixIsaac Aug 4, 2026 7/10
app GitHub

Lynqu AI Toolkit: Claude Skills + MCP for Sales Lead Pipelines

An open-source toolkit combining Claude Skills and an MCP server for AI-driven lead capture, research, sales follow-up, and pipeline management, usable from Claude, ChatGPT, or Cursor. Aimed at sales/growth teams wanting to run a lead-gen workflow through their AI assistant.

mcpskillsales-automation
by Gravisun Aug 4, 2026 5/10
app GitHub

claude-invaders: Play Space Invaders While Claude Code Works

A terminal Space Invaders game to play while waiting for Claude Code to finish a task, with the game notifying you when the session completes. A fun, low-stakes way to fill idle time during long agent runs.

terminal-gameproductivityfun
by erscoder Aug 4, 2026 6/10
app GitHub

brain-cli: Local Hybrid-Search Persistent Memory for AI Agents

A single-file Python CLI providing persistent memory for AI coding agents and personal knowledge management, combining SQLite FTS5 keyword search with sqlite-vec embeddings via RRF fusion, plus dedup, tasks, and linking. Local-first with no server required, built to be driven by Claude Code, Cursor, and other LLM coding agents.

memoryclilocal-first
by victorsabino Aug 4, 2026 7/10
app GitHub

Cove: Windows System Tray App for Managing Claude Code Sessions

A Windows system tray popup tool that lets you manage Claude Code conversations and projects the way you manage email, giving quick access to ongoing sessions without keeping terminals open. Targets Windows users who want a lighter way to track multiple Claude Code chats.

windowssession-managementgui
by LUMIAO9527 Aug 4, 2026 6/10
app GitHub

diri: Native macOS Orchestrator for Parallel Coding Agents

A native macOS app that orchestrates Claude Code, Codex, Cursor, Gemini, and shells running in parallel across git worktrees and remote hosts. Useful for developers juggling multiple concurrent agent sessions who want a unified control surface instead of many terminal tabs.

orchestrationmacosgit-worktrees
by cristicretu Aug 4, 2026 7/10
app GitHub

claude-nanny: Menu-Bar HUD to Monitor Multiple Claude Code Sessions

A macOS menu-bar status HUD, installed as a Claude Code plugin, that shows the state (running, needs input, done, error) of multiple concurrent Claude Code sessions across terminals. Useful for developers running several agent sessions at once who want an at-a-glance status view without building a full Xcode app.

macosmonitoringplugin
by app-brew Aug 4, 2026 7/10
app GitHub

timecode-agent: Turn Long Videos into a Searchable Evidence Ledger

Converts long videos into a local, timestamped, searchable ledger that coding agents can query as evidence, for example referencing exact moments in a screen recording or demo video. Useful for feeding video-based context like bug reports or session recordings into an agent's reasoning without manually re-watching footage.

videoagent-contextlocal-first
by Whole-synonymist671 Aug 4, 2026 5/10
app GitHub

claude-account-router: per-folder Claude account routing for VS Code

Routes Claude Code to a different account depending on which folder is open in the VS Code extension, and refuses to start when the active account doesn't match the folder's expected one — useful for keeping work and personal accounts separated.

vscodeaccount-managementapp
by kirlts Aug 3, 2026 6/10
app GitHub

ProjectAtlas: purpose metadata + code graph cutting agent token costs 90%

Guides coding agents to the right files using purpose metadata and an intelligent code graph instead of open-ended exploration, cutting token costs by over 90% by avoiding files and folders the agent doesn't need to read.

appcode-graphtoken-efficiency
by styler-ai Aug 3, 2026 7/10
app GitHub

lumira: real-time statusline HUD for Claude Code and Qwen Code

A zero-dependency real-time statusline HUD for Claude Code and Qwen Code with a session analytics CLI, an API latency overhead widget, 7-day quota projection, auto-compact proximity warnings, themes, and powerline support.

statuslineappanalytics
by cativo23 Aug 3, 2026 7/10
app GitHub

agent-knowledge-system: knowledge + task system for AI consumers

An Astro-based knowledge and task system designed for AI consumers, with human-readable docs as a first-class output and a folder-per-issue tracker, shipped as a Claude Code plugin (agent-ks).

appknowledge-baseplugin
by sidhanthapoddar99 Aug 3, 2026 6/10
app GitHub

contexer: captures architecture decisions from AI coding sessions

Captures architecture decisions, constraints, conventions, and patterns from AI coding sessions and replays them in the next session so you don't have to re-explain context. Works across multiple AI coding agents, not just Claude Code.

appcontextmemorymulti-agent
by bhargavamin Aug 3, 2026 7/10
app GitHub

harnessmeter: profiles the token cost of your agentic harness

Prices every line of your CLAUDE.md, every skill, subagent, and MCP tool schema to find the ones that don't earn their place in context — runs fully offline with zero API keys, for Claude Code, Codex, and Antigravity.

apptoken-efficiencyprofiler
by alebgl77 Aug 3, 2026 7/10
app GitHub

agent-ops — Operating Layer for Claude Code as an Engineering Teammate

Bundles a security posture, a PreToolUse credential guard, blameless incident postmortems, custom skills, and working agreements into one operating layer for running Claude Code like a member of the engineering team rather than a standalone tool.

securityhooksteam-workflow
by sanlee-ys Aug 3, 2026 6/10
app GitHub

hud — Zero-Dependency Statusline for Claude Code

A zero-dependency Node.js statusline for Claude Code that surfaces model name, 5-hour and weekly rate-limit usage, session time, and context window size directly from stdin. Useful for keeping an eye on usage limits without leaving the terminal.

statuslineclirate-limits
by BriarDevv Aug 3, 2026 6/10
app GitHub

telltale — Cross-Vendor Coding Agent HUD

A statusline and HUD for coding agents that emphasizes traceability: every displayed number is tied back to measured tool output rather than estimates. Works across multiple agent vendors, not just Claude Code.

statuslinehudcross-vendor
by sanlee-ys Aug 3, 2026 6/10
app GitHub

agentscanner — Static Security Scanner for Claude Code Config

A static security scanner purpose-built for the .claude/ directory, checking settings, permissions, hooks, MCP servers, agents/subagents, skills, slash commands, and CLAUDE.md for risky configurations. Positioned like Checkov or Terrascan but for Claude Code setups.

securityscannerconfiguration
by jassics Aug 3, 2026 7/10
app GitHub

evc-local-sync-plugin — Obsidian to AI Project Sync

An Obsidian plugin enabling bidirectional sync between an Obsidian vault and AI development projects, including Claude Code, Cursor, and VS Code. Keeps notes and project context aligned across tools.

obsidiansyncplugin
by entire-vc Aug 3, 2026 5/10
app GitHub

home-assistant-claude-code — Chat With Claude About Your Smart Home

A Home Assistant app that lets you chat with Claude to read your HA config and live entity state, then edit automations, scripts, and dashboards. Mobile-friendly with a prebuilt image for easy setup.

home-assistantsmart-homeintegration
by xionic Aug 3, 2026 7/10
app GitHub

cairnkeep — Harness-Agnostic Memory for Coding Agents

A durable memory and context layer for coding agents that isn't tied to any specific harness. Aims to give agents persistent recall across sessions regardless of which CLI or IDE integration is driving them.

memorypersistence
by cairnkeep Aug 3, 2026 6/10
app GitHub

actradeck — Real-Time Supervision Cockpit for AI Coding Agents

A vendor-neutral, local-first sidecar and web console for supervising AI coding agents in real time, including Claude Code and Codex. Provides secret redaction, approval gates, and an append-only audit trail.

supervisionauditsecurity
by actradeck Aug 3, 2026 6/10
app GitHub

jind-ai — TUI Session Manager for Claude Code

A terminal UI session manager for Claude Code built on tmux, using a split-pane interface to manage multiple concurrent sessions. Helps keep parallel agent runs organized in one terminal window.

tuisession-managertmux
by takaaki-s Aug 3, 2026 6/10
app GitHub

basou — Provenance Layer for AI Agent Sessions

Records, replays, and reasons about the work done by Claude Code and other coding agents, creating a provenance trail for agent sessions. Useful for auditing what an agent actually did and why.

provenanceauditreplay
by basou-dev Aug 3, 2026 6/10
app GitHub

ganyu-pet — Desktop Companion Reacting to Agent Hooks

A desktop companion pet that watches your coding agent work, reacting to Codex and Claude Code lifecycle hooks with opinions about what it sees. A lighthearted way to get ambient feedback on agent activity.

hooksdesktop-petfun
by miloishot Aug 3, 2026 5/10
app GitHub

claude-chat-mobile — Use Your Local Claude CLI From Your Phone

Lets you drive your real, locally-installed Claude CLI from a phone browser, preserving the same CLAUDE.md, MCP servers, skills, and login as your desktop setup. Self-hosted and locked down by default.

mobileremote-accessself-hosted
by Ike-li Aug 3, 2026 7/10
app GitHub

pragmatic-claude — Personal Claude Code Setup Bundle

A personal Claude Code configuration bundle including a launcher, session hooks, a custom system prompt, skills, slash commands, and a statusline, installable via a one-line curl script. A reference setup for others building their own Claude Code environment.

dotfilessetupstatusline
by igorjs Aug 3, 2026 5/10
app GitHub

OxiMux — Rust Multi-Agent Development Cockpit for macOS

A Rust-native cockpit for macOS that spawns isolated git worktrees and runs multiple CLI coding agents in parallel. Includes a GitLens-grade review UX for inspecting every change an agent makes.

macosmulti-agentgit-worktree
by nhtera Aug 3, 2026 7/10
app GitHub

naked-browser — Point Claude Code at Your Own Logged-In Chromium

Exposes a logged-in Chromium instance on a fixed CDP port so Claude Code can scrape sites like Coupang, Naver, AliExpress, X, or Reddit using your existing session — no API key or bypass code needed. Similar in spirit to CDP-based browser automation setups.

browser-automationcdpscraping
by AiCrafter-pro Aug 3, 2026 7/10
app GitHub

aello — Isolated Environments for Claude Code

Provides isolated, disposable environments for Claude Code sessions, similar to Python virtualenvs but for AI coding agents. Helps keep experiments and dependencies from leaking between agent runs.

isolationenvironmentsandboxing
by ryha0008-boop Aug 3, 2026 6/10
app GitHub

wallfacer — Autonomous Engineering Platform

An engineering platform spanning chat, specs, tasks, and code, designed to run with full autonomy when trusted or full manual control when not. Aims to bridge planning and execution in one tool.

autonomous-agentplatform
by changkun Aug 3, 2026 6/10
app GitHub

claude-models-list — Auto-Updated Claude Model IDs

A repository that automatically publishes an up-to-date list of Claude models and their model IDs, refreshed daily from the official Anthropic Models API. A handy reference for anyone hardcoding model strings.

referencemodelsapi
by combinatrix-ai Aug 3, 2026 5/10
app GitHub

cc-habits — Make AI Tools Remember Your Coding Style

Learns your coding style once and makes it persist across AI tools, so you stop re-correcting the same preferences every session. Local-first with no telemetry.

preferencesmemorylocal-first
by Shreyan1 Aug 3, 2026 6/10
app GitHub

panerelay — Drive AI Agents Through Your Existing Chrome

Lets AI agents work through agent-browser/browser-use inside the Chrome browser you already have open and logged into, rather than spinning up a separate automated instance.

browser-automationchrome
by F-loat Aug 3, 2026 6/10
app GitHub

token-guardian — Zero-Token Usage Sentinel for Claude Max

Tracks real token burn across Claude Code and OpenClaw agent sessions locally against Claude Max's 5-hour and weekly windows, using fail-soft account polling. Latches alerts and can trigger a 90%-usage pause protocol, running as a systemd service.

usage-trackingclaude-maxsystemd
by oocm147 Aug 3, 2026 6/10
app Reddit

leaxp — Local RAG-Based Skill & Memory Manager

An open-source, fully local plugin (`pip install leaxp`) that groups installed skills by task, builds a table-of-contents plus focused sub-guides, and loads only the relevant chunks via a local numpy/ONNX vector index — no API keys, database, or cloud services required. Aimed at people running 15-20+ skills whose CLAUDE.md context was bloating every prompt.

skill-managementraglocal-first
by solubrious1 Aug 3, 2026 6/10
app GitHub

cc-enhanced — Power-User Patch Bundle for Claude Code CLI

A verifiable bundle of local patches for the Claude Code CLI covering tool ergonomics (bat-style reads, batched edits, output tails), prompt/guidance cleanup, agent and skill controls, workflow UX like max-effort and queued drafts, runtime guards, cache/session tweaks, and native repacking.

clipatchpower-user
by camjac251 Aug 3, 2026 7/10
app GitHub

memila — Self-Hosted Local RAG Memory Sidecar

A tiny, self-hosted local RAG memory sidecar for your apps, built on FastAPI, Qdrant, and Ollama (BGE-M3 embeddings). A headless building block for adding retrieval-augmented memory without a cloud dependency.

ragmemoryself-hosted
by fuu354-droid Aug 3, 2026 5/10
app GitHub

banto — Resident TUI for Managing Claude Code Sessions

A resident terminal UI that searches, groups, and resumes Claude Code sessions, hosting them as embedded panes with Director/Worker orchestration. Cross-platform, with Windows as its primary target.

tuisession-manager
by kt81 Aug 3, 2026 6/10
app GitHub

dex — Autonomous Feature Implementation Engine

Spawns a fresh Claude Code agent per phase in a 'Ralph Wiggum loop,' driven by spec-kit planning, with a real-time trace UI and automated git handling. Aims to implement whole features autonomously while staying auditable.

autonomous-agentspec-drivengit-automation
by lukaskellerstein Aug 3, 2026 7/10
app GitHub

TurboLLM — Run Local LLMs, Auto-Tuned to Your GPU

Runs any local LLM engine auto-tuned to your GPU behind a polished web UI and an OpenAI/Anthropic-compatible API, so you can point Claude Code at your own machine in one command. No Electron, no Python, offline-first.

local-llmself-hostedgpu
by mohitsoni48 Aug 3, 2026 6/10
app GitHub

agent-manager — Multi-Account Manager for Claude Code & Codex

A macOS menu-bar app and CLI for juggling multiple Claude Code and Codex accounts on one machine, with isolated logins, parallel sessions, live usage tracking, and scheduled usage-window warm-ups.

macosmulti-accountusage-tracking
by marinsokol5 Aug 3, 2026 6/10
app GitHub

CLI-Manager — Multi-Project AI CLI Workspace

A workspace for managing multiple AI CLI projects across local terminals, SSH hosts, and mobile-assisted workflows from one place.

climulti-projectssh
by dark-hxx Aug 3, 2026 5/10
app GitHub

herdr-toolkit — Cross-Vendor Task Delegation Multiplexer

A Claude Code plugin that runs on top of the Herdr agent multiplexer, enabling cross-vendor task delegation with fabrication-resistant acceptance checks and phone-driven detached session spawning.

multi-agentdelegation
by shimo4228 Aug 3, 2026 6/10
app GitHub

rightmodel: Routes Coding Tasks to the Cheapest Capable Model

A local CLI that routes each coding task to the cheapest capable model across the agent CLIs you already have, with no API keys or telemetry required. Aims to cut costs by avoiding overkill model selection for simple tasks.

appcost-optimizationmodel-routingcli
by prayagtushar Aug 2, 2026 6/10
app GitHub

editmd: Native macOS Markdown Editor with Claude Code Integration

A native macOS Markdown editor offering Source, Visual, and Preview modes over one source of truth, with wiki-links, review marks, and Claude Code integration. Aimed at writers and developers who want a polished markdown workflow alongside their agent.

appmarkdownmacoseditor
by andryushkin Aug 2, 2026 5/10
app GitHub

termdeck: Browser Terminal Deck with Automatic Session Resume

A browser-based terminal deck offering persistent terminals with automatic session resume for Claude Code and Codex across restarts. Useful for keeping long-running agent sessions alive through reboots or disconnects.

appterminalsession-resumebrowser
by danialfarid Aug 2, 2026 6/10
app GitHub

open-wiki: Turns Project Docs into a Local Wiki the Agent Can Read

Centralizes a project's documentation inside the project's own directory as a wiki the AI agent already has open, converting PDFs, DOCX, and recorded meetings into validated markdown with clickable provenance. Ships as a Windows desktop app, CLI, and read-only MCP server, and calls no LLM itself.

appdocumentationmcpwiki
by protonspy Aug 2, 2026 6/10
app GitHub

flipbook: Turns Screen Recordings into Keyframes Claude Can Read

Claude can't watch video, so flipbook records your web app while Claude drives it and hands back a flipbook of readable keyframes instead. Useful for browser-automation and UI-testing workflows where Claude needs visual feedback on what happened.

appbrowser-automationtestingscreenshots
by ShubhenduVaid Aug 2, 2026 7/10
app GitHub

session-portal: Find, Preview, and Resume AI CLI Sessions on Windows

A local Windows app for finding, previewing, exporting, and resuming AI CLI chat sessions across AMP, Claude Code, Codex, Copilot, Grok, and other tools. Gives Windows users a session browser for agent CLIs that otherwise lack one.

appwindowssession-managementcli
by eddyficial Aug 2, 2026 6/10
app Reddit

SceneProof: Gives Coding Agents Structured Eyes on Visual Bugs

A CLI that loads a React or Three.js scene from source and renders it in real Chrome, returning the scene graph (bounds, materials, lights, cameras) instead of just a screenshot. Lets an agent distinguish a missing mesh from a wrong material from a clipped label instead of guessing from pixels, and every report explicitly flags when a result can't support a judgment.

clivisual-debuggingthree.jsreactscreenshots
by ReyJ94 Aug 2, 2026 8/10
app GitHub

telegram-unleashed: A Fuller Telegram Interface for Claude Code

A Telegram channel/bot for Claude Code with streaming replies, a live activity feed, robust markdown formatting, large (2GB) file uploads, and thumbs-up/down controls for approving agent decisions from your phone.

telegramremote-controlmobile
by schenkei-code Aug 2, 2026 6/10
app GitHub

seashell: macOS Terminal for Running Multiple Claude Code Sessions

A native macOS terminal built around running several Claude Code sessions at once, with tiled panes, an integrated file explorer, and "Lookout" cards that surface which session is waiting on your input. Aimed at solo developers running many agents in parallel.

terminalmacosmulti-sessionclaude-code
by voidharbor Aug 2, 2026 7/10
app GitHub

claude-oswe: OSWE-Style Security Audit Tool for Claude Code

A white-box security auditing tool that traces data flow from source to sink, chains findings into unauthenticated RCE paths, verifies each chain, and writes an evidence-backed Markdown/HTML report. Supports PHP, Node, Python, Java, and .NET codebases.

securityauditrcevulnerability-scanning
by Laucked-Security Aug 2, 2026 7/10
app GitHub

ccas: Switch Between Claude Code Accounts from Waybar

A Python-stdlib-only utility for switching between multiple Claude Code accounts directly from the Waybar status bar or terminal, with a colored widget per account and per-account quota display via a GTK4 layer-shell panel. No external dependencies.

multi-accountwaybarlinuxquota
by movsq Aug 2, 2026 6/10
app GitHub

claude-remote-control: Drive Claude Code From Your Phone

A PWA chat client for controlling Claude Code sessions running on your own machine from a phone, working over LAN or Tailscale. Supports remote permission approval and live mirroring of Claude Desktop sessions.

remote-controlpwatailscalemobile
by NspxMiguel Aug 2, 2026 6/10
app Reddit

damem: Agent Memory Committed to the Repo as Plain Markdown

A small CLI that keeps agent context (facts, skills, scratch notes) as a committed directory of one-fact-per-file Markdown in the repo instead of a laptop-local store, so any agent or teammate that can read Markdown can use it. It only prints rules and warns on drift — it never writes files, so removing the binary leaves the repo untouched.

agent-memorymarkdownportable-contextcli
by Cunarist Aug 2, 2026 6/10
app GitHub

claude-doc-sanitizer: Detects Hidden Text in Documents Before AI Ingests Them

Scans PDFs, Word docs, and text files for content hidden from human readers (e.g. white-on-white text, tiny fonts) before feeding them to an AI, by diffing the extracted text layer against an OCR pass of the rendered page. Aimed at catching prompt-injection payloads smuggled inside documents an agent is asked to read.

prompt-injectionsecuritydocument-processing
by fonCki Aug 2, 2026 7/10
app GitHub

codex-topics-telegram-bot: Run Claude Code or Codex Per Telegram Topic

A Telegram forum bot where each topic becomes an independent, resumable agent session running Claude Code or Codex CLI, complete with its own working directory, memory, and provider routing. Lets a team spin up and manage many parallel agent sessions from a single Telegram group.

telegrammulti-agentsession-management
by STELS37 Aug 2, 2026 6/10
app GitHub

agx: Desktop/CLI Control Plane for Parallel Coding Agents

A desktop and CLI control plane for running many coding agents in parallel, using git worktrees and tmux sessions to isolate each agent's workspace, with optional Discord control for managing sessions remotely.

multi-agentworktreestmux
by nashory Aug 2, 2026 7/10
app GitHub

claude-usage-pal-desktop: Desktop Pet That Tracks Your Claude Rate Limits

A lightweight Windows desktop pet built with Tauri v2, React, and TypeScript that doubles as a real-time usage monitor for Claude AI and Claude Code rate limits, surfacing how close you are to hitting your cap at a glance.

desktop-appusage-trackingtauri
by chanyutl-dev01 Aug 2, 2026 6/10
app GitHub

agent-fleet: Self-Hosted Console for Managing a Fleet of Coding Agents

A self-hosted web console for running Claude Code, Codex, Copilot, Cursor, and other coding agents as a managed fleet, with isolated per-user workspaces, git/SVN working copies, scheduling, and usage accounting — aimed at teams running many agents at once.

fleet-managementself-hostedmulti-agent
by k-k1 Aug 2, 2026 6/10
app Reddit

Resonant: Open-Source Suno + Ableton Live Alternative With Claude Code MCP

A free, open-source AI music studio for Windows combining local Suno-style song generation with an Ableton Live-inspired clip launcher, arranger, and mixer. It connects to Claude Code via MCP so an agent can write lyrics, compose, arrange, mix, and render complete songs from a prompt, with no watermarks and no ownership claims on generated output.

mcpmusic-generationopen-source
by Responsible_Maybe875 Aug 2, 2026 6/10
app GitHub

cc-usage: macOS menu-bar usage dashboard

A native macOS menu-bar app showing usage stats for Claude Code, Codex, and Gemini side by side, built as a companion to cc-switch.

appmacosusage-trackingdashboard
by Eureka0w0v0 Aug 2, 2026 6/10
app GitHub

ATMOS: unified terminal UI for agentic coding tools

A terminal application that launches and manages 15+ coding agents (Claude Code, Codex, Gemini, Cursor, Devin, Antigravity, and more) from one interface, with git worktree isolation for parallel agent execution, a built-in lightweight editor, and integrated git/PR workflow.

appterminalmulti-agentworktrees
by AruNi-01 Aug 2, 2026 7/10
app GitHub

pocket-terminal: run Claude Code on your Mac from your phone

Sets up Tailscale + mosh + tmux so you can drive Claude Code running on your Mac from your phone, without an admin password, and documents six setup traps that commonly cost an afternoon.

appremote-accesstailscalemobile
by domenicdgenovese Aug 2, 2026 7/10
app GitHub

nethack-tiles-client: a fully vibe-coded desktop app

A cross-platform NetHack client with graphical tiles (Tauri + React/TS + Rust), notable as a showcase: nearly the entire codebase, tests, app icon, and README were written by Claude Code running Opus 5 with a human steering rather than typing.

appshowcasevibe-coding
by statico Aug 2, 2026 6/10
app GitHub

SoDam-Agent: 10 Role-Based AI Agent Teams as a Plugin Marketplace

A plugin marketplace that installs ten role-specific AI agent teams (web app, docs, research, marketing, data, security audit, DevOps, support, PM, translation) into Claude Code in one step, with beta translation for Codex, Gemini CLI, and Cursor. Built for non-developers, it includes a community-shared team directory via PRs, automatic backups, dangerous-command warnings, and bundled MCP (context7).

plugin-marketplaceagent-teamsnon-developermcp
by sodam-ai Aug 2, 2026 6/10
app GitHub

seo-butler: SEO & GEO Agency Agent for Claude Code

An agent that handles technical SEO and generative-engine-optimization work directly inside your project, gated behind approval with git-aware rollback. It verifies changes on the deployed site and reports back a month later on whether they actually moved rankings and AI-citation visibility (ChatGPT, Claude, Perplexity).

seogeoautomationapproval-gate
by mertagralii Aug 2, 2026 6/10
app GitHub

nanogpt-harness: Fail-Closed Tor-Only Claude Code Harness

A hardened harness that forces Claude Code traffic through Tor and fails closed if the connection is unavailable, built for use with NanoGPT's TEE-hosted kimi-k3 model. Aimed at users who want strong network-privacy guarantees around their coding agent sessions.

privacytorsecurityharness
by kernelzeroday Aug 2, 2026 5/10
app GitHub

o8: Governance Layer for Autonomous Engineering Teams

A desktop app that adds approvals, audit trails, and organizational memory across multiple AI coding agents (not just Claude Code), running on your own model subscriptions rather than a hosted service.

governanceauditmulti-agentdesktop-app
by hurttlocker Aug 2, 2026 6/10
app GitHub

Equilibrium: Desktop Cockpit for Claude Code Developers

A Windows desktop app (Tauri 2 + Next.js) that bundles a project dashboard, PTY terminals (PowerShell/WSL), a Claude session browser, and per-project time tracking into one cockpit for developers working with Claude Code.

desktop-appdashboardwindowstime-tracking
by Seb77570 Aug 2, 2026 6/10
app GitHub

markdown-memory: Cross-Platform Persistent Memory for Claude Code

A file-based memory and prompt bridge that syncs project passports, handoffs, and session logs across Claude Code, claude.ai, and Antigravity IDE using an Obsidian Vault. Bridges web-based planning with local CLI execution, installed via npx.

memoryobsidiancross-platformclaude.ai
by mworldorg Aug 2, 2026 6/10
app GitHub

cc-wire-analyzer: Inspect Every HTTP Request Claude Code Makes

A local MITM proxy with a desktop GUI and an agent-drivable HTTP API that records and lets you inspect every HTTP request Claude Code sends. Setup is a single settings field.

debugginghttpproxytransparency
by FuHehe12 Aug 2, 2026 7/10
app GitHub

kiln: Detect Whether an Interface Looks AI-Built

A zero-dependency, single-file tool that analyzes an interface and reports whether it looks AI-generated, along with the specific signals that gave it away.

detectionuiai-generated
by Kerrywang64 Aug 2, 2026 5/10
app GitHub

assistant-to-the-crm: Human-Gated Outlook to Dynamics 365 Meeting Sync

A Claude Code-driven integration that syncs Outlook meeting activity into Dynamics 365 CRM, requiring human approval before any write and never fabricating meeting notes. Niche but addresses a common CRM data-entry chore for sales teams.

crmoutlookdynamics-365integration
by arpitjaiswal-0701 Aug 1, 2026 5/10
app GitHub

claude-code-security-evals: Community Eval Bank for Skills, Agents, and Hooks

A shared, tested set of security evaluations for vetting Claude Code skills, agents, and hooks before trusting them, positioned as an alternative to informally vibed reviews. Useful for teams adopting third-party Claude Code extensions.

securityevalsskillshooks
by magec-proyectos Aug 1, 2026 6/10
app GitHub

lorepack: Versioned Context Build System for AI Agents

Compiles documents, spreadsheets, and project artifacts into immutable, diffable builds that agents can read over MCP or HTTP, then activate or roll back like a normal deployment. Brings standard release-management practices to agent context sources.

contextmcpversioningbuild-system
by burakdede Aug 1, 2026 6/10
app GitHub

notabene: Margin Notes on Docs That Your Agent Applies and Journals

Lets you leave notes directly in the margins of your repo's docs, then hands them to your AI agent to apply, resolve the threads, and journal what changed and why. Useful for async doc review where a human flags issues and the agent does the editing.

docsnotesagentautomation
by z29k Aug 1, 2026 7/10
app GitHub

meetey: Local-First Meeting Transcription for Claude Code

Local-first meeting capture and transcription built for Claude Code: it records meeting audio via macOS ScreenCaptureKit and transcribes locally with whisper.cpp, so no audio or transcript ever leaves the machine.

meetingstranscriptionwhisper-cppmacos
by jej2k5 Aug 1, 2026 7/10
app GitHub

claude-code-live-memory: Always-On Model That Learns Your Repo

A cheap, always-on background model that continuously learns your repository so your main coding agent doesn't have to keep re-reading it from scratch. Aims to cut down on repeated context-gathering overhead in long-running Claude Code sessions.

memoryrepo-contextefficiency
by shofer-dev Aug 1, 2026 7/10
app Reddit

Cogpit: Real-Time Dashboard for Claude Code Sessions

Cogpit reads the session files Claude Code (and Codex) write to disk and streams them live — tool calls, thinking blocks, diffs, subagent fan-out, and per-turn token counts split into uncached/cached/cache-creation/output. It works across sessions started in a terminal, VS Code, or the desktop app, which helps when running several agents at once and needing to see which one is actually blocked on you. It parses an undocumented, moving JSONL format, so it can break when that format changes.

dashboardsession-viewertoken-usagemulti-agent
by gentritb Aug 1, 2026 6/10
app Reddit

mex: Persistent Project Memory and Code Graph for Coding Agents

mex maintains a living Markdown wiki inside a repo where agents record architecture, conventions, decisions, and patterns as they work, so future sessions load only what's relevant instead of relearning the codebase from scratch. Version 0.7.0 adds a deterministic local code graph (Tree-sitter plus SQLite, covering TypeScript/JavaScript/Python/Rust) so an agent can query something like 'trace the authentication flow' and get back a compact neighborhood of relevant symbols instead of whole files. It also links wiki claims back to exact symbols so it can flag when code has changed and the recorded knowledge may be stale; the project has crossed 1,000+ GitHub stars.

memorycode-graphtree-sittercontext-management
by DJIRNMAN Aug 1, 2026 8/10
app GitHub

Claudible: Multiplayer Cockpit for Claude Code

Claudible lets you invite someone into your live Claude Code session to watch, talk, and co-drive, with 100% local push-to-talk voice, live telemetry, and an agents cockpit view. Per-prompt session history supports one-click revert, and it runs on Windows (WSL2 or native), Linux, and macOS.

multiplayerpair-programmingvoiceclaude-code-gui
by synthetiks Aug 1, 2026 6/10
app GitHub

Algol: Governance Layer for Multi-Engine Code Review

Algol sits above code-review engines rather than being one, reading a project's versioned review standards to decide which engine handles a given change. It reconciles every engine's findings into a single record without silently upgrading a heuristic result to verified, and preserves each human override along with the conditions that would reopen it. Built as a ReviewOps layer for Claude Code projects with more than one reviewer or review engine.

code-reviewreviewopsgovernanceclaude-code
by btmoriarty Aug 1, 2026 7/10
app GitHub

curate-course: Turn Scattered YouTube Videos into a Course Site

curate-course takes scattered YouTube content on any topic and turns it into a structured course website with fully verified links and traceable sources. It ships with a 371-unit posture-correction course as a working example of the pipeline.

youtubecurationeducationclaude-code
by htlin222 Aug 1, 2026 7/10
app GitHub

cliproxyapi-secure-deploy: Hardened Deploy Kit for CLIProxyAPI

A script-first deployment kit for running CLIProxyAPI on Ubuntu, giving Codex CLI and Claude Code an OpenAI-compatible proxy without the usual security gaps: SSH key-only access, UFW/Fail2ban, a loopback-bound proxy behind Caddy auto-HTTPS, encrypted Restic backups, and health checks. Also ships cross-platform claudex/codexx wrappers that pull credentials from the OS secret manager instead of plaintext config.

deploymentsecuritycliproxyapiself-hosted
by pan2013e Aug 1, 2026 7/10
app GitHub

agentgate-ai: Local AI Gateway Routing Across 26 Providers

A self-hosted local AI gateway that unifies model requests from any AI client — routing, format conversion, automatic failover, and request tracing across 26 different LLM providers. Useful for developers juggling multiple coding agents and model backends who want one consistent endpoint.

gatewayroutingmulti-providerfailover
by dengmengmian Aug 1, 2026 6/10
app GitHub

blackbox: A Flight Recorder for Claude Code and Codex Sessions

Reduces Claude Code and Codex transcripts into a single append-only event log you can query later. Zero dependencies, useful for debugging what an agent actually did across a long session.

observabilitytranscriptsdebuggingclaude-codecodex
by edenbuilds Aug 1, 2026 7/10
app GitHub

terminx: One Terminal Dashboard for Codex, Claude Code, and More

A terminal dashboard that shows Codex, OpenCode, Claude Code, and Kimi sessions side by side in a single view, for developers running several CLI coding agents at once.

terminaldashboardmulti-agentcodexclaude-code
by B143KC47 Aug 1, 2026 5/10
app GitHub

torana-edge: A Programmable Local Proxy for Coding Agents (Pre-Release)

A local proxy for coding agents built around WASM plugins and a canonical multi-provider intermediate representation. Still pre-release, with APIs and config expected to change before launch — worth watching rather than adopting yet.

proxywasmpre-releasemulti-provider
by torana-edge Aug 1, 2026 5/10
app GitHub

agentburn: A Local Profiler for Where Your Coding Agent Burns Money

Breaks down what's spending tokens across Claude Code, OpenClaw, and Hermes Agent sessions — cron jobs, chats, helper calls — and explains why, whether it's retry loops or idle wake-ups, with suggested config fixes. Fully local, zero dependencies.

cost-profilingtoken-usagelocalopenclawhermes
by Socialpranker Aug 1, 2026 7/10
app GitHub

office: A Local macOS Workspace for Running a Five-Agent AI Team

A local-first macOS workspace that runs Codex CLI and Claude Code together as a five-person AI team, for developers who want multiple agents collaborating in one place rather than juggling separate terminals.

macosmulti-agentworkspacecodex
by neosp8888-design Aug 1, 2026 5/10
app GitHub

ctx: Repo-Aware Recommendations From an 80K-Node Skill/Agent Graph

Recommends skills, agents, MCP servers, and model harnesses based on your repo, drawing on a shipped graph of 68,494 skills, 467 agents, 10,790 MCPs, and 207 harnesses — or point it at your own inventory instead.

discoveryrecommendationsskillsmcpagents
by stevesolun Aug 1, 2026 7/10
app GitHub

Bastet-Agent-OS: A Local Control Plane for Multi-Agent AI Teams

Orchestrates Claude Code, Codex, Grok, agy, and Hermes into gated workflows that attempt to fix their own failures, with per-run cost metering, an append-only audit log, and shared team memory. Apache-2.0.

multi-agentcontrol-planeaudit-logmetering
by yamantaka520 Aug 1, 2026 5/10
app GitHub

TaskWraith: A Cross-Platform Control Room for Coding Agents

Runs Codex, Claude Code, Cursor, Grok, and local models together in one desktop app, each with its own role, permission posture, and audit receipts. Supports multi-agent ensembles in one thread, diff review, and on-device history across macOS, Windows, and Linux.

desktopmulti-agentpermissionsdiff-review
by boggspa Aug 1, 2026 6/10
app GitHub

djinnvim: A Constrained Vim-Style Editor Built for AI Agents

Gives AI agents a narrow "keyhole" editing interface using vim's command vocabulary combined with ed's line-oriented discipline — a more constrained, auditable alternative to letting an agent freely rewrite whole files.

vimeditingconstrained-editingsafety
by anschnapp Aug 1, 2026 6/10
app Reddit

Murmell: A Shared Cloud Canvas for Multi-Agent Coding Sessions

A shared cloud canvas where a team spawns coding agents (Claude Code, Codex, and others), watches their terminals, gets a live preview of the running app, and keeps git as the shared source of truth — built to avoid everyone syncing separate local setups.

cloud-canvascollaborationmulti-agentlive-preview
by Used_Table3903 Aug 1, 2026 6/10
app GitHub

agentchat-agent-core: Shared Engine for Coding-Agent Integrations

A host-agnostic library providing wire protocol, identity storage, session digest, and hook state machine internals for building coding-agent integrations. Designed as a library rather than a CLI — every function takes an explicit identity home instead of resolving one implicitly.

libraryintegrationidentityprotocol
by agentchatme Aug 1, 2026 5/10
app GitHub

bloatbot: An Auditor for Your AI Workspace

Scans your AI workspace (CLAUDE.md files, skills, configs) to find bloat and proposes cuts without making any changes itself. A read-only audit tool for keeping agent context lean and configuration maintainable.

auditcontext-managementcleanupclaude-md
by jdpolasky Aug 1, 2026 7/10
app GitHub

skill-federation: Free, Private Skill Search for AI Agents

A search service for discovering agent skills without centralizing or exposing usage data — built for privacy-conscious skill discovery. Complements install-focused tools by focusing specifically on search.

skill-discoverysearchprivacy
by skill-federation Aug 1, 2026 6/10
app GitHub

hotsheet: Local Single-User Ticket Management for AI Tools

A lightweight, local ticket/task management system designed for working alongside AI coding tools. Single-user focused, as a lighter alternative to heavier multi-user ticket boards.

ticketstask-managementlocal
by brianwestphal Aug 1, 2026 5/10
app GitHub

copy-to-clipboard-plugin: Copy Claude's Output to Clipboard

A Claude Code plugin that copies queries, shell commands, and config snippets straight from Claude's responses to your clipboard. Works across macOS, Linux, Windows, and over SSH sessions.

clipboardpluginproductivitycross-platform
by harleensahni Aug 1, 2026 7/10
app GitHub

torque: Let an AI Agent Safely Operate Real Salesforce Orgs

Lets an AI agent operate a live Salesforce org through deterministic gates that prevent it from writing to production on its own. Validated with 128 adversarial tests against a real org — a notable safety pattern for agentic actions on production systems.

salesforcesafetyproductionadversarial-testing
by omoji-personal Aug 1, 2026 7/10
app GitHub

ladder: A Decision Ledger for AI Pair-Programming

Tracks every branch Claude or GPT suggests during a coding session and lets you climb back to any option you didn't take. Plain markdown + YAML format, works with any AI assistant, no lock-in.

decision-trackingmarkdownpair-programming
by tanamsethi31 Aug 1, 2026 6/10
app GitHub

claude-tray: Native Windows Tray Monitor for Claude Code Usage

Shows rate-limit percentage in the Windows tray, projects when you'll run out based on usage trend, and turns the icon red before you hit the limit. Includes a local 24-hour usage breakdown.

windowsusage-trackerrate-limit
by alegauss Aug 1, 2026 7/10
app Reddit

Benzi: A Cheaper Coding Agent Harness That Indexes a Compiled Code Map

An early-stage coding agent harness built on Sonnet that compiles the codebase first and uses that map for incremental indexing, aiming to match Claude Code's function while giving a visible map of what the agent is doing. Free and in active development; the author is soliciting adversarial feedback.

agent-harnesscode-indexingearly-stage
by DonkeyTheKing Aug 1, 2026 5/10
app Reddit

I Turned a Spotify Car Thing Into a Claude Code Session Controller

Repurposes the discontinued Spotify Car Thing (built on Nocturne) into a bluetooth device for managing Claude Code sessions, answering permission prompts, and viewing usage — and it can still switch back to a Spotify controller. Author plans to open-source it once polished.

hardwarecar-thingsession-control
by hehehebidksixbrsja Aug 1, 2026 6/10
app Reddit

A Lower-Cost Coding Agent That Runs Code, Reads Failures, Retries, Seals a Receipt

LOLM's CLI writes or edits files, runs commands in an isolated sandbox, reads real stdout/stderr/exit codes, repairs failures, and produces an auditable receipt of what it did. Positioned as a disciplined, lower-cost agent loop rather than the strongest model available; the founder is looking for adversarial test cases.

agent-clisandboxearly-stage
by OGMYT Aug 1, 2026 5/10
app GitHub

laila: An Operating System for a Life Run With AI Agents

Represents your world as plain files — domains, memory, hard autonomy lines, and background loops — so any harness that can read a repo can run your life agents. Private by design, with a reference implementation on Claude Code.

life-osautonomyplain-files
by cacardinal Aug 1, 2026 6/10
app GitHub

francois: Mission Control for Your Claude Code Fleet

A native Tauri 2/Rust/React desktop app for running and supervising multiple Claude Code sessions at once — live transcripts, diffs, subagents, MCP servers, and a real shell in one window.

fleet-managementtauridesktop-app
by antoine-gmnz Aug 1, 2026 7/10
app GitHub

quil: A Reboot-Proof Terminal Multiplexer That Auto-Resumes Claude Code

A tmux alternative that persists your whole terminal workspace across reboots and auto-resumes Claude Code and OpenCode sessions where they left off. Ships an MCP server so agents can drive your panes directly. Go, cross-platform, MIT-licensed.

terminal-multiplexersession-resumemcp
by artyomsv Aug 1, 2026 7/10
app GitHub

Kammel_ssh: An SSH Client Built for Driving Coding Agents From Your Phone

A Flutter SSH client for Android and Linux built around driving Claude Code, Codex, Aider, and Gemini CLI from a phone — multi-session terminal that survives backgrounding, notifications when the agent needs you, plus an SFTP explorer, code editor, git panel, and Docker/DB console.

sshmobileandroid
by Jhongdlp Aug 1, 2026 7/10
app GitHub

pixy: Desktop Robot That Answers Claude Code Permission Prompts Locally

A desktop companion that watches for Claude Code permission prompts and answers them using a language model running entirely on your own machine, with no cloud dependency or account. It also surfaces mail, calendar, and GitHub notices as glanceable alerts.

automationpermissionslocal-llmdesktop
by erberkk Jul 31, 2026 6/10
app GitHub

shipit: self-hosted chat-driven IDE for coding agents

A self-hosted IDE for running Claude Code or Codex through your real engineering workflow -- parallel sandboxed containers, live preview, and the GitHub loop built in. Lets you drive multiple coding agents from one chat interface.

ideclaude-codecodexsandboxinggithub
by nikzlabs Jul 31, 2026 8/10
app GitHub

claude-usage-garmin: Claude quota on your Garmin watch

Shows your remaining Claude usage (5-hour and weekly windows) as a glance on a Garmin Forerunner 165, no laptop needed. A Cloudflare Worker handles token refresh and polls the usage API, while the watch only reads a cached snapshot via Bluetooth.

claude-usagegarmincloudflare-workermonitoring
by rizkirmdhnnn Jul 31, 2026 7/10
app GitHub

voice-companion: Real-Time Voice Narration for Coding Agents

A voice companion for Claude Code, Codex, and AtomCode that narrates what the agent is doing in real time via TTS and lets you talk back by voice, aimed at hands-free supervision of long agent runs.

appvoicettsaccessibility
by istoolsfox Jul 31, 2026 6/10
app GitHub

agbridge: At-a-Glance Status for Remote Claude Code Agents

A lightweight status view for Claude Code agents running on remote hosts, shown inside agterm's sidebar. Agents write status to a shared directory and the local Mac pulls it over SSH, no tunnel or sockets required.

appremotemonitoringssh
by zahark Jul 31, 2026 6/10
app GitHub

Gemini Plugin for Claude Code: Second-Opinion Code Review

A Claude Code plugin marketplace entry that integrates Gemini CLI for second-opinion code review and security review. Also intercepts image-heavy Reads to protect the prompt cache.

appgeminicode-reviewmulti-model
by haunchen Jul 31, 2026 6/10
app Reddit

Soubi: Compile One Plugin Source into 22 Agent Harness Formats

A build tool that lets you write a Claude Code plugin (skills, hooks, subagents, commands) once and compile it into the native plugin format for 22 other harnesses like Codex, Cursor, and OpenCode. Declares an explicit fallback per capability instead of silently shipping a broken plugin when a target harness lacks a matching feature.

apppluginscross-platformbuild-tool
by dank_clover Jul 31, 2026 8/10
app Reddit

blattbot: Local LaTeX Editor + AI Agent Synced to Any Overleaf

A local LaTeX editor and agent that syncs with self-hosted or hosted Overleaf via the same websocket protocol the browser editor uses, no git bridge required. Changes go through a local diff for review, refuses to push if a co-author edited the same file meanwhile, and includes a rendered PDF diff plus a citation audit against Crossref/OpenAlex.

applatexoverleafacademic
by Lckylke Jul 31, 2026 7/10
app GitHub

trace-file-lineage: Find What Produced Any File, With Evidence

A local tool that traces which script, notebook, command, or AI agent produced a given file, reporting its confidence honestly rather than guessing. Useful for auditing outputs in agent-heavy data or coding pipelines.

appprovenancedata-lineage
by uczltw6 Jul 31, 2026 6/10
app GitHub

failure-memory: Cross-Agent Memory That Learns From Real Failures

A local, cross-agent memory tool that helps Codex, Claude Code, Copilot, and Cursor learn from actual mistakes, while distinguishing genuine failures from cases where the requirements simply changed.

appmemorycross-agent
by CongBao Jul 31, 2026 6/10
app GitHub

frameproof: Timestamped Proof That an Agent Actually Watched a Video

An offline, no-API-key tool where an agent watches a video without blind spots and proves via timecode what it actually saw, aimed at verifiable video review rather than hallucinated summaries.

appvideoverificationoffline
by edvardgrishin27 Jul 31, 2026 5/10
app GitHub

cc-haha: Local-First Desktop Workspace for Multi-Agent Claude Code

A cross-platform desktop workspace for running Claude Code and other agents: multi-agent sessions, git worktrees, code diffs, a skill marketplace, multi-model support, and Computer Use, with remote access via WeChat, Feishu, DingTalk, Telegram, and WhatsApp.

appdesktopmulti-agentworktrees
by NanmiCoder Jul 31, 2026 7/10
app Reddit

token-ledger: Audit Your Own Claude Code Transcripts for Token Waste

Free scripts that parse the JSONL session logs Claude Code already writes to extract real billed token counts per message. Across 185 sessions, found that ~99% of context growth comes from tool output rather than typed prompts, and that spawning subagents for small tasks re-pays a large fixed context cost each time.

apptokensanalyticstranscripts
by Intelligent_Mine2502 Jul 31, 2026 7/10
app GitHub

tether: a local mail-based coordination layer for Claude Code, Codex, and Aider

A single Go binary that lets independent coding agent CLIs — Claude Code, Codex, Aider — register a name, send each other mail, and block until a reply arrives. There's no orchestrator, no MCP server, and no wrapper around the underlying CLI, just a lightweight local coordination layer for running multiple agents as one team.

multi-agentcoordinationcligo
by praneethravuri Jul 31, 2026 7/10
app Reddit

Dispatch: free macOS app letting separate Claude Code sessions ask each other questions

A native, signed, free macOS app that links local repos and lets the Claude Code sessions running in them communicate over a shared localhost MCP bus (ask_agent, answer_agent, check_messages, list_projects). Useful for keeping a frontend and backend, or an app and the library it depends on, in separate sessions that can still query each other, with linking as the explicit consent model.

macosmcpmulti-agentcommunication
by awizemann Jul 31, 2026 7/10
app GitHub

code-validator: an offline static security scanner built for AI-generated code

A static security scanner purpose-built for code produced by Claude Code, Copilot, ChatGPT, and Cursor. Detects hardcoded credentials, CORS misconfigurations, SQL injection, and dependency CVEs in under a second per file, fully offline with zero data exfiltration.

securitystatic-analysisofflineai-generated-code
by TTMK7777 Jul 31, 2026 7/10
app GitHub

A single-file, dependency-free Python fleet manager for headless Claude Code agents

A single-file, stdlib-only Python CLI where one manager session spawns, steers, and monitors many durable headless Claude Code sessions across projects, with mid-turn steering, token budgets, usage-limit park/resume, and a git-tracked knowledge loop. No daemon, no dependencies.

fleet-managementheadlessmulti-agentpython
by exPardus Jul 31, 2026 7/10
app GitHub

Cha0sBrain: Turn Claude Code Sessions into an Obsidian Second Brain

Automatically converts Claude Code session history into a structured Obsidian vault, turning raw conversation logs into a searchable, linked knowledge base. Useful for developers who want their coding-session context to persist and compound over time instead of vanishing after each session.

obsidianknowledge-managementsession-history
by Cha0smast3r110 Jul 30, 2026 7/10
app GitHub

Claude-Usage-Widget: Windows Usage Tray App with Liquid Glass UI

A real-time Claude Code usage widget for Windows showing live session and weekly limits across Mini/Normal/Detail dashboard modes, built with Tauri 2 + SolidJS + Rust and styled with Liquid Glass/Mica vibrancy. One of several usage-tracking widgets in this ecosystem, distinguished mainly by its Windows-native UI polish.

usage-trackingwindowstauri
by gnoeynij Jul 30, 2026 5/10
app GitHub

aelfrice: Bayesian Memory That Learns from Feedback for LLM Agents

A memory system for LLM agents that uses Bayesian updating to learn from feedback over time, rather than storing static facts. Aimed at agents that need their recall to improve and adapt as they receive corrections.

memorybayesianllm-agents
by robotrocketscience Jul 30, 2026 6/10
app GitHub

UsageApp: Free Codex + Claude Usage Monitor for Windows Tray

A free, privacy-first usage monitor for the Windows taskbar tray that tracks both Codex and Claude Code usage in one place, with an Android app in development. Currently in beta; distinguishes itself from single-provider widgets by covering both ecosystems.

usage-trackingwindowsprivacy
by JeremiahFD Jul 30, 2026 5/10
app GitHub

wallfacer: A Terminal Session Manager for Claude Code and More

A terminal session manager built with Claude Code workflows in mind, helping developers organize and switch between multiple concurrent terminal/agent sessions. General enough to use outside Claude Code as well.

terminalsession-managercli
by pradipta Jul 30, 2026 6/10
app GitHub

rill: Personal Knowledge Management with Voice Journaling and Claude Skills

A personal knowledge management system combining voice journaling, Claude Code skills, and AI-powered knowledge distillation, stored as plain Markdown in Git. Aimed at people who want a PKM system that is both AI-augmented and fully under their own version control.

pkmvoice-journalingmarkdown
by rillmd Jul 30, 2026 6/10
app GitHub

token-wise: Native macOS App for Claude Code and Codex Usage

A native macOS app that tracks Claude Code and Codex token usage, costs, cache efficiency, and session history in one dashboard. Distinguished from other usage widgets by being a proper native Mac app with cache-efficiency reporting.

usage-trackingmacosnative-app
by banyudu Jul 30, 2026 6/10
app GitHub

shadok-ai: Web Cockpit for Running Multiple Claude Code Sessions

A web-based cockpit for driving multiple Claude Code sessions in parallel on your existing subscription, letting you orchestrate several agents from one browser dashboard. Notable for reportedly having written a significant part of itself.

orchestrationparallel-sessionsdashboard
by gnarco Jul 30, 2026 7/10
app GitHub

temps: Self-Hosted Alternative to Vercel + Sentry + PostHog + Resend

An open-source, self-hosted Rust binary bundling deployments, analytics, session replay, error tracking, OpenTelemetry, email, sandboxes, and an AI gateway, 440+ CLI operations in total, with drop-in skills for Claude Code, Codex, and OpenCode. A broad platform play covering what would otherwise be several separate SaaS subscriptions.

self-hosteddeploymentobservability
by gotempsh Jul 30, 2026 8/10
app GitHub

claude-code-codex-nix: Nix Flake for Claude Code via Codex OAuth

A Nix flake and Home Manager module that sets up Claude Code authenticating through Codex OAuth, with server-side compact support. Niche but useful for the Nix/NixOS community wanting a declarative, reproducible Claude Code install.

nixhome-manageroauth
by fnltochka Jul 30, 2026 5/10
app GitHub

Entangle: Hand Off a Live Claude Code Session with Three Spoken Words

Lets you transfer a live Claude Code, Codex, or opencode session to another person using an encrypted three-word phrase, no account required. Also supports migrating your entire Claude Code history to a new laptop with paths automatically rewritten.

session-sharingencryptionclaude-codemigration
by gowtham-sai-yadav Jul 30, 2026 7/10
app GitHub

TokenTally: Local Desktop Dashboard for Claude Code Usage

A cross-platform desktop app that tracks Claude Code token usage, costs, and session history with a live dashboard. Runs fully locally with no cloud sync, account, or telemetry.

token-usagedashboarddesktop-appprivacy
by payfacto Jul 30, 2026 7/10
app GitHub

llm-proxy: Self-Hosted API Proxy for Claude Code and Codex CLI

A self-hosted proxy for Claude Code and Codex CLI with multi-backend routing, account pooling with 429 failover, per-key rate limits, and a usage dashboard. Useful for teams managing multiple accounts or API backends.

proxyself-hostedrate-limitingrouting
by Ken-Chy129 Jul 30, 2026 6/10
app GitHub

claude-containers: Self-Hosted Docker Stack for Isolated Claude Code Sessions

A self-hosted Docker stack that runs one isolated, long-lived Claude Code session per container, reachable over SSH/tmux and the Claude app's Remote Control feature. Useful for running multiple agent sessions safely in parallel without polluting a local machine.

dockerself-hostedisolationremote-control
by cosyte Jul 30, 2026 7/10
app GitHub

claude-skills-validator: Browser-Based SKILL.md Linter

A single-file, browser-only HTML tool that lints a Claude Skill's SKILL.md for spec compliance and triggering quality. No install needed, useful for quickly checking a skill before publishing it.

linterskill-mdvalidationbrowser-tool
by 0xelitesystem Jul 30, 2026 7/10
app GitHub

claude-statusline (OpenClawFarm): HUD-Style Status Line for Claude Code

A heads-up-display style status line for Claude Code showing network health, tokens-per-second, context usage, quotas, and cost all in one line. Gives an at-a-glance view of session health without extra commands.

statuslinemonitoringhud
by OpenClawFarm Jul 30, 2026 5/10
app GitHub

Urfael: A Self-Hosted, Voice-Capable Personal AI on Your Claude Subscription

A personal, voice-capable AI you run entirely on your own machine using your flat-rate Claude subscription, with no inbound network port, a tamper-evident audit ledger, and a runnable security benchmark. MIT licensed.

voice-aiself-hostedsecuritysubscription
by Grandillionaire Jul 30, 2026 6/10
app GitHub

RE-LLMPET: Lightweight Desktop Pet That Watches Your Coding Agents

A low-resource multi-agent desktop pet built on Tauri 2 with a native Rust provider adapter layer, watching Claude Code, CodeWhale, Codex, OpenCode, and Aider sessions. A playful status indicator for whichever coding agent is currently running.

desktop-pettaurirustmulti-agent
by purrfecto114-lgtm Jul 30, 2026 5/10
app GitHub

Visual Stack: A Visual Interface for Building Software with Claude Code

A visual interface layered on top of Claude Code for building software, aimed at people who prefer a graphical workflow over a raw terminal session. Details are light, but it targets making Claude Code more approachable for non-CLI-first users.

visual-interfaceguiclaude-code
by Cavalry-Collective Jul 30, 2026 5/10
app GitHub

video-podcast-maker: Topic-to-4K-Video Pipeline for Coding Agents

Turns a topic into a narrated 4K video for coding agents, using a unified TTS engine spanning 11 platforms including MiniMax voice cloning, a manifest-based asset engine, and Remotion for composition with cost-gated AI generation.

video-generationttsremotion
by Agents365-ai Jul 30, 2026 5/10
app Reddit

red-handed: Audits Claude Code Sessions to Verify Tests Actually Ran

An npx CLI (plus a companion plugin) that reads your Claude Code session transcripts from ~/.claude/projects, cross-references them with git, and flags cases where a tests pass claim was not backed by an actual test run in that session. Runs entirely locally with no model calls, and also catches disabled tests, rewritten expected values, and commits made after a hook rejected them.

testingverificationcli-toolhook
by Due_Emu_8229 Jul 30, 2026 8/10
app Reddit

tandem: Switch Between Claude Code and Codex Mid-Session

An open-source CLI that runs Claude Code and Codex CLI as a paired session, translating one tool's transcript into the other's native session format so typing switch continues the exact same conversation, files, and history when you hit a usage limit. Only one model runs per turn, and both sides stay independently resumable via claude --resume / codex resume.

cli-toolcodexsession-continuityopen-source
by bhavya6187 Jul 30, 2026 7/10
app Reddit

ossclip: Local-First CLI That Turns Talking-Head Video into Shorts

An open-source CLI (npm i -g ossclip) that transcribes a talking-head video locally with whisper.cpp, then has an LLM plan on-screen graphics like title cards, stat cards, and terminal mockups, rendered as code via Remotion rather than templates. Every planned scene is schema-validated before rendering, works with Claude Code CLI or a Gemini/Anthropic API key, and keeps footage local.

videocli-toolremotionopen-source
by CodeWithAhsan Jul 30, 2026 7/10
app Reddit

Promptbook: Text Editor for Claude Code's [Image #1] Prompt Tags

A prompt editor (promptbook.sh) that mirrors how CLI coding tools display pasted images as [Image #1]-style tags, so you can write and preview prompts with embedded images outside the terminal. Solves the problem of images becoming opaque, unclickable placeholders once dropped into a CLI prompt.

prompt-editorimagescli-workflow
by vbaranov Jul 30, 2026 6/10
app Reddit

Lemma: Turn Claude Agents into Persistent Team Apps (Teams/Chat)

An open-source platform that wraps Claude agents and sub-agents into a persistent, shared app instead of ad hoc individual chats, adding a Microsoft Teams surface for lightweight tasks like assigning owners or pulling reports. Built for teams who found raw chat sessions lost context and wanted a consistent shared interface instead of everyone running their own prompts.

teams-integrationagent-appopen-source
by ironmanfromebay Jul 30, 2026 5/10
app Reddit

Harness Remote: Self-Hosted Mobile/Web Companion for Claude Code

An open-source (Apache-2.0) app that connects to Claude Code via the Claude Agent ACP adapter, letting you browse and replay sessions, send or queue prompts, cancel work, and follow todo/plan updates from a phone or browser. Ships as a GitHub Pages PWA, Android app, and desktop UI, and works with a normal claude login subscription with no API key required.

remote-accessmobileacpopen-source
by giuliastro Jul 30, 2026 7/10
app Reddit

Agentree: Tree-Based Interface for Branching Agent Conversations

A web app (agentree.app) that turns each agent message into a node in a tree, letting you branch a new conversation from any prior message instead of being stuck in a linear chat. Each node preserves the code/repo state via commits, making it easier to navigate and monitor multiple parallel agent runs.

uiconversation-treeweb-app
by dmangla33 Jul 30, 2026 7/10
app Reddit

Leaxp: Git-Based Memory and Skill Package Manager for Claude

An open-source pip package that treats agent memory and skills like package management: exp learn captures project architecture into git-tracked records, exp install pulls in shared skills, and exp share packages project knowledge for other developers to install. Aimed at teams with multiple interlinked repos who are tired of re-explaining the same context to Claude every session.

memoryskillspackage-manageropen-source
by solubrious1 Jul 30, 2026 6/10
app Reddit

cli-share: Share Claude Code Terminal Sessions as GitHub Gists

An npm CLI tool that captures a Claude Code or Codex terminal session and pushes it to a formatted GitHub Gist in one command, instead of screenshotting the whole terminal. Works with Claude Code, Codex, or basically any CLI coding tool session.

cli-toolgithub-gistterminalsharing
by PumpkinNarrow6339 Jul 30, 2026 5/10
app GitHub

Stellar Agentic Framework: Eval-Driven Harness for Stellar dApps

An eval-driven agentic harness for building production Stellar blockchain dApps, with 6 specialist agents, 5 eval definitions, and contract/frontend/backend templates. Ships an npx CLI scaffolder with Claude Code marketplace support for one-command project setup.

stellarblockchaindappagentscli
by rylsherdamz-rgb Jul 30, 2026 5/10
app Reddit

Operator: a kanban-style multi-project orchestrator for Claude Code

A self-built alternative to tools like Conductor: a kanban/task board where every task runs as its own agent, with one git worktree and branch per task, sessions that keep running after you close the browser, and a diff review flow across multiple projects from one place.

orchestratorkanbangit-worktreedashboard
by ishyfishyy Jul 30, 2026 6/10
app GitHub

OpenChatCut: local-first conversational AI video editor

An open-source, local-first video editor with a professional multi-track timeline, controllable through natural language via Agent Skills and MCP integration, rendering with Remotion. Brings conversational, agent-driven editing to a real production timeline.

video-editingmcpagent-skillsremotion
by 0xsline Jul 30, 2026 7/10
app GitHub

IntelliRouter: local, harness-aware model router

A local model router that's aware of which harness it's running under — Codex, OpenCode, or Claude Code — and routes tasks to the appropriate model accordingly, rather than applying one-size-fits-all routing rules.

routermodel-routingcodexopencode
by anisahaya Jul 30, 2026 5/10
app GitHub

dira: Git-Native Decision Ledger for Coding Agents

Captures intents, decisions, and rejected alternatives from agent sessions via SessionStart/Stop/PreCompact hooks, then enforces them so a plan cannot quietly contradict an earlier rejected decision. Sits one layer above the kazi goal-tracker from the same org: kazi proves work is done, dira remembers why it was wanted. Currently in design phase -- schema and docs exist, no binary yet.

hooksdecision-trackingagent-memorygit-native
by kazi-org Jul 30, 2026 5/10
app GitHub

and-code: Native Android GUI for Running AI Coding Agents On-Device

A native Android app that runs AI coding agents directly on the phone, no terminal, PC, or SSH session required. Aimed at people who want to kick off or check on Claude Code / Codex work from a phone without setting up Termux or a remote connection.

androidmobileon-devicegui
by yuga-hashimoto Jul 30, 2026 7/10
app GitHub

1Helm: Self-Hosted Home for Durable AI Employees

1Helm gives a single AI agent (a "resident") a persistent private computer with compounding memory and skills across sessions. A component called Skipper enforces every safety boundary on what the resident can do, aiming for a durable, self-hosted alternative to stateless agent sessions.

memorypersistent-agentself-hostedagent-framework
by gitcommit90 Jul 30, 2026 6/10
app GitHub

claude-sessions: Live Dashboard and Tray Badge for Claude Code Sessions

A single Rust/Tauri binary that gives Windows and macOS a live dashboard and tray badge showing which Claude Code sessions need attention, plus a hook recorder, installer, and companion IntelliJ plugin. Aims to make it easy to spot and jump to the session that's waiting on you.

dashboardtraytaurisession-monitoring
by Nicsilver Jul 30, 2026 5/10
app GitHub

earbrief: Daily Audio Briefing Generated and Narrated by Claude

Generates a personal daily audio briefing narrated by Claude, running entirely as a repo plus two scheduled cloud routines with no servers to maintain. Outputs a player artifact you can listen to each day.

audiodigestautomationscheduled
by mblasi Jul 30, 2026 6/10
app GitHub

formloop: Let Your Agent Generate Rich UI Forms to Ask You Questions

Instead of asking complex clarifying questions through chat text, formloop lets an LLM agent generate a rich UI form on the fly for the human to fill out. Useful when a question has many structured fields or options that are awkward to express in plain chat.

human-in-the-loopformsui
by manibordev Jul 30, 2026 5/10
app GitHub

agent-playtime: Steam-Style Playtime Tracking for CLI Coding Agents

Tracks and deduplicates hours spent across Claude Code, Codex, and OpenCode sessions, presented Steam-style like a game library. A lightweight way to see how much time you've actually put into each agent harness.

usage-trackingstatscli
by fmarcac Jul 30, 2026 5/10
app GitHub

Holy: An Open-Source AI Swarm of Four Health Coaches

Four coordinated coaches (training, nutrition, sports medicine, sports psychology) read your wearable data, blood panels, mood, and cycle, then adapt training and fueling around travel and jet lag, briefing you each morning. Built as an autonomous open-source project, twelve weeks into development at time of posting.

healthwearablesagent-swarmpersonal-ai
by juliedemoyer Jul 30, 2026 5/10
app GitHub

testdriverai: Computer-Use SDK for End-to-End QA Testing

An established open-source SDK (230+ stars, running since 2024) for building computer-use-driven E2E QA tests, where the agent operates the app like a real user instead of relying on brittle selectors. Usable as a building block for QA automation in Claude Code and other agent workflows.

qacomputer-usee2e-testingsdk
by testdriverai Jul 30, 2026 8/10
app Reddit

Workflow Monitor: VS Code extension for watching Claude Code multi-agent runs

Brings the CLI's /workflows live tree view into VS Code by reading the same on-disk journal state, with a charted dashboard of per-agent timelines, peak context, and token detail parsed from transcripts. No patching, hooks, or API key required. Author notes the journal is a resume ledger keyed by content hash (not a literal run log) and per-agent token fields reflect final context size, not spend — both required cross-checking against real transcripts.

vscodeworkflowsmonitoringmulti-agentobservability
by Siigari Jul 29, 2026 8/10
app Reddit

Claude Queue: explicit queueing and steering for follow-up messages

An open-source patch addressing a race condition where a second follow-up message could reach Claude before the first, or get silently merged into one turn. Adds explicit "run" (queue), "run" with immediate flag, and "steer" (interrupt at next tool boundary) semantics, with an editable/reorderable message queue that persists across restarts.

queueingsteeringuxopen-source
by Naive-Experience9439 Jul 29, 2026 7/10
app GitHub

GraphARC: constraining agent execution graphs with deterministic rules

From the team behind CodeGraphContext (4K+ stars), a new project exploring "Graph Engineering" — letting an LLM dynamically propose its own execution graph (e.g. investigate → modify → deploy) while deterministic software validates the proposal against permissions, budgets, and allowed node types before execution, rejecting or forcing a replan when constraints are violated.

agent-safetyexecution-graphpermissionsgovernance
by Desperate-Ad-9679 Jul 29, 2026 7/10
app GitHub

local-kimi: optimized local serving engine for Kimi-Linear-48B with a universal client bridge

A local inference engine for Kimi-Linear-48B featuring INT4 quantization and fused decode kernels for a measured 3.18x speedup, exposed via an OpenAI-compatible server. Ships with "k3," a bridge that auto-detects the calling client per request so Claude Code, Codex, Cline, Aider, and OpenCode all work against it unchanged.

local-inferencekimiopenai-compatiblemulti-client
by RightNow-AI Jul 29, 2026 5/10
app GitHub

threadleaf: A Page-Native Agent for Obsidian

threadleaf is an Obsidian plugin that runs an AI agent natively inside your notes pages, working alongside Claude Code and Codex. It's local-first and keeps agent interactions embedded in the page context rather than a separate chat panel.

obsidianagentlocal-firstclaude-code
by windzu Jul 29, 2026 6/10
app GitHub

peektrace: Local Inspector for Claude Code State

peektrace is a loopback-only, local-first inspector and editor for Claude Code state -- memories, sessions, and context-budget forensics -- in one live pane. It also covers Codex and Pi sessions, giving a unified view across multiple coding agent tools.

observabilityclaude-codecontext-managementcli
by Mark-Life Jul 29, 2026 7/10
app Reddit

Scoring ~2,300 Claude Code Plugins on 5 Signals Instead of Stars

A community member scored roughly 2,300 Claude Code plugins on maintenance, popularity, documentation, manifest richness, and trust/safety instead of just GitHub stars. The post highlights two plugins in Anthropic's official marketplace scoring 91 vs 66 despite similar star counts, exposing a stale-but-popular one.

pluginsmarketplacecurationanalysis
by Ambitious_Town_9056 Jul 29, 2026 7/10
app GitHub

kgai: Shared Memory Knowledge Graph for AI Dev Teams

kgai is a Claude Code plugin that auto-captures the decisions behind your code into an immutable knowledge graph, built on Kuzu, and syncs across a team without merge conflicts. It gives AI dev teams shared, queryable memory of why code changed, not just what changed.

knowledge-graphmemoryclaude-code-pluginteam-collaboration
by kgaidev Jul 29, 2026 6/10
app GitHub

Omnodex: Security & Observability for AI Agent Execution

Omnodex adds security and observability tooling around AI agent execution, including Claude Code and MCP-based setups. It's aimed at teams that need visibility and guardrails around what coding agents actually do at runtime.

securityobservabilitymcpclaude-code
by omnodex Jul 29, 2026 6/10
app Reddit

Builders Gate: A Game Development Harness for Claude

Builders Gate is an early-stage toolkit that lets Claude agents build games alongside a human, covering art generation, a custom sprite editor, an in-progress level editor, and an audio lab for sound effects and voiceovers. It also has a playtest-recording feature so Claude can review feedback and turn it into a task list for follow-up agents.

game-developmentharnessclaude-codecreative-tools
by InteractionCivil Jul 29, 2026 6/10
app GitHub

AgentDeck: Browser UI for Claude Code Sessions Over tmux

AgentDeck is a browser front-end over real tmux sessions, so long-running Claude Code tasks keep running when you close the tab, drop VPN, or restart the service. It adds a desktop-style window manager, one-click shell launch with Claude Code pre-started, drag-and-drop file paths, and a mobile view -- no database, no auth beyond an IP allowlist, so it's a LAN/VPN tool.

tmuxsession-managementbrowser-uiclaude-code
by 0_KermitTheFrog_0 Jul 29, 2026 7/10
app GitHub

cairn: A Native macOS Notifier for Finished Agent Turns

cairn is a quiet native macOS companion app that notifies you when a coding agent -- Claude Code, Codex, or similar -- finishes its turn. It's a lightweight, focused alternative to watching a terminal for agent completion.

macosnotificationsclaude-codeproductivity
by quentinzhang Jul 29, 2026 5/10
app GitHub

catchup: Read Your Other Claude Code Sessions in Full

catchup reads the transcripts that Claude Code's terminal and desktop app already write to disk but never surface, letting you catch up on what another session did without switching back to it. Both clients log full session history but give no built-in way to read it back -- this fills that gap.

transcriptsclaude-codesession-managementcli
by saksham10arora-dotcom Jul 29, 2026 6/10
app GitHub

ai-nixCfg: Nix Home-Manager Modules for AI Coding Assistants

Home-manager modules and configuration for running AI coding assistants declaratively on NixOS/Nix. Lets you manage Claude Code and similar tools the same way as the rest of a Nix-based environment.

appnixconfigurationdotfiles
by DivitMittal Jul 29, 2026 5/10
app GitHub

console-to-cc: Stream Browser Console Logs Straight to Claude Code

A local-only Chrome extension paired with a Node sink that streams browser console logs to a file Claude Code reads on every prompt. No cloud involved, closing the loop between frontend errors and the coding agent.

appbrowserdebugginglocal-first
by chirag127 Jul 29, 2026 6/10
app GitHub

runjam: One Desktop for Claude Code, Codex CLI, and Gemini CLI

A local-first desktop app that auto-detects and unifies Claude Code, Codex CLI, and Gemini CLI behind one interface — unified chat, file explorer, terminal, and editor. Built with Tauri, Rust, and Vue 3.

appdesktopmulti-agenttauri
by peintune Jul 29, 2026 6/10
app GitHub

codebase-index: Local-First Hybrid Codebase Indexing for Coding Agents

Offline codebase indexing for Claude Code, Codex CLI, OpenCode, and other agents, combining FTS5 full-text search, Tree-sitter parsing, and graph search so agents can find relevant code without repeated brute-force reads.

appindexingsearchoffline
by denfry Jul 29, 2026 7/10
app GitHub

gengchou: Live AI Quota Widget for the Windows Taskbar

Shows live Claude Code, Codex, and Antigravity quotas and reset times right on the Windows taskbar, as a widget, tray icon, or floating window.

appwindowsusage-trackingwidget
by ynjmxn Jul 29, 2026 6/10
app GitHub

agent-timeline: Desktop Timeline Widget for AI Coding CLI Sessions

A translucent, always-on desktop widget that tracks Claude Code, Codex, Grok Build, Kimi Code, and ZCode sessions in real time, distilling a command timeline and a glossary of task codenames. Native on both macOS and Windows.

appdesktopwidgetmonitoring
by surebeli Jul 29, 2026 5/10
app GitHub

mirrormux: Mirror a Live tmux Pane to Your Phone's Browser

Mirrors a live tmux pane to a phone browser so you can watch and drive a Claude Code session from anywhere on your network — no app, no API key, zero runtime dependencies.

apptmuxremotemobile
by nogataka Jul 29, 2026 6/10
app GitHub

hspace: Targeted, Revocable Sharing for AI-Built HTML and Markdown

Ships AI-generated HTML or Markdown to one recipient instead of the world — one link plus a password, view receipts, instant revoke, per-recipient passwords, and versioning. Open source and edge-native.

appsharingedge
by agentx1boss Jul 29, 2026 5/10
app GitHub

chewo: macOS App Unifying Claude Code and Codex CLI

An Electron app for macOS that unifies Claude Code and Codex CLI in one place — a shared session sidebar, real terminals via node-pty/xterm, dictation notes, a capabilities manager, and opt-in worktree isolation.

appmacoselectronmulti-agent
by Meaetin Jul 29, 2026 6/10
app GitHub

cca-f-dojo: Practice App for Anthropic's Claude Certified Architect Exam

A bilingual (Chinese/English) practice app for Anthropic's Claude Certified Architect – Foundations exam, with 163 questions, a missed-question queue, and an official-spec mock exam verified against the exam guide. Zero-dependency static site, works offline, unofficial.

appcertificationexam-prep
by kamiimeteor Jul 29, 2026 5/10
app GitHub

fpm: Unify Multi-Project Claude Code Work Into One Browser Hub

Unifies multi-project, multi-session Claude Code work into one browser hub, with number-indexed project/server navigation (cdf/sshf), an HTML dashboard, and a project-management SCAR plugin.

appdashboardmulti-project
by Finfra Jul 29, 2026 6/10
app Reddit

agent-manager: A tmux TUI for Running Multiple Coding Agents

A Go binary on top of tmux that gives every running Claude, Codex, or OpenCode agent a live status in one list grouped by project, so you can spot a stuck permission prompt without tabbing through terminals. Press space to send a prompt into any agent's pane without attaching, and ctrl+r opens its diff as whole files for inline review comments that feed straight back into the agent.

apptmuxmulti-agentdiff-review
by khalon23 Jul 29, 2026 7/10
app Reddit

Reviewonator: A Local UI for AI-Assisted GitHub PR Reviews

A local open-source app where an agent reviews someone else's GitHub PR and posts findings directly on the diff next to the relevant lines. You can discuss, edit, or remove each comment, then preview and choose whether to comment, approve, or request changes — nothing posts automatically. Works with Claude Code and Codex; requires an authenticated GitHub CLI.

appgithubpr-reviewlocal-first
by johniak Jul 29, 2026 7/10
app GitHub

claude-lifeline: Keeps Claude Code Sessions Alive Through API Errors

Detects the API errors and other failures that end a Claude Code turn, waits out the right backoff, and resumes the session automatically — running from inside Claude Code, with nothing else needing to stay running.

appreliabilityauto-resume
by AndreiElekesIntel Jul 29, 2026 6/10
app GitHub

cockpit: Open-Source Claude Code GUI With Multi-Engine BYOK

An open-source Claude Code GUI built on the official Claude Agent SDK, supporting parallel multi-project sessions, multi-engine BYOK (Codex, DeepSeek, Kimi, Ollama), a terminal, browser and DB bubbles, and code review. Local-first, MIT.

appguibyokagent-sdk
by Surething-io Jul 29, 2026 7/10
app GitHub

AxiomCore: Personal Project and Routine Management Agent for Claude

A personal project and routine management agent for Claude with enforced structure, a plan-approve-execute discipline, wiki memory, and optional voice, brand, todos, and dev-planning modules.

appproject-managementpersonal-agent
by protonium-labs Jul 29, 2026 5/10
app GitHub

agent-term: Steer a Fleet of Coding Agents

An integrated, open terminal environment for steering a fleet of coding agents at once, built to be reshaped rather than used as a black box.

appterminalmulti-agent
by albertwujj Jul 29, 2026 5/10
app Reddit

memhub: SQLite Memory Tool for Agents With Optional Cross-Device Sync

Stores project context, tasks, architecture decisions, and notes in SQLite so an agent can cheaply retrieve just what it needs (semantic RAG with a re-ranker, or FTS5) instead of reloading a huge markdown file every session. Supports syncing the database across machines via a mounted Google Drive/OneDrive folder, with Tailscale-based sync under consideration.

appmemorysqlitesync
by kninetimmy1 Jul 29, 2026 6/10
app GitHub

AgentBar: Approve Claude Code Permission Prompts From the Menu Bar

Approves Claude Code permission prompts right from the macOS menu bar without switching to the terminal, and shows live status for every AI coding agent — Claude, Codex, Copilot, and Antigravity.

appmacosmenu-barpermissions
by michalstrnadel Jul 29, 2026 6/10
app Reddit

Clauster: Self-Hosted Web UI for Managing Claude Code Remote Bridges

A self-hosted dashboard that spawns and manages persistent Claude Code sessions on your own machine, server, or NAS, so you can attach from claude.ai/code or the mobile app without SSH or tmux. Supports server-mode bridges and interactive PTY sessions with true --continue resume, per-project worktrees, and full config editing from the browser.

appremotedashboardself-hosted
by SchubyDoo Jul 29, 2026 7/10
app GitHub

autosentry: Self-Healing Supervisor for Long-Running Processes

Watches a long-running command, detects failures, attempts a fix, and leaves an audit trail of what happened. Useful for keeping agent-launched background processes alive without manual babysitting.

appsupervisorself-healingreliability
by ulmentflam Jul 29, 2026 6/10
app GitHub

claude-toolkit: Transactional Sync Engine for a Personal Claude Code Canon

Packages a personal collection of rules, agents, and skills into immutable releases and syncs them into projects with WAL crash-safety, three-way merge, and CI gating. Brings deployment-grade rigor to distributing your own Claude Code configuration across repos.

appconfigurationsyncci
by dewil Jul 29, 2026 7/10
app GitHub

ai-plugin: Control Plane's Assistant for Multi-Cloud Workload Management

An AI assistant plugin for the Control Plane platform providing Claude Code, Codex, Antigravity, and MCP workflows for deploying, troubleshooting, and managing multi-cloud workloads from within a coding agent session.

appclouddeploymentvendor
by controlplane-com Jul 29, 2026 5/10
app GitHub

zibbo: Deterministic Context Optimization for AI Coding Assistants

Strips structural noise out of prompts before they reach the model, reducing token usage while deterministically preserving the underlying information. A prompt-layer alternative to lossy summarization for context trimming.

appcontexttoken-optimization
by MohammedZaid-AI Jul 29, 2026 6/10
app GitHub

luxin: Zero-Setup Creative Media Generation for Agents

Lets agents generate and edit images, video, audio, and 3D content with no API key or OAuth setup — durable hosted URLs, recoverable jobs, and cost receipts included. Removes the usual credential-wrangling step before an agent can produce media assets.

appmedia-generationimagesvideo3d
by danielgwilson Jul 29, 2026 7/10
app Reddit

Hamza: Egress Gate That Redacts Secrets and PII Before They Reach the Model Provider

Sits between a CLI coding agent and the model provider, inspecting the assembled request body for secrets and PII, masking each value consistently at its exact location, and rebuilding/rescanning the request before release. Built after the author's agent assembled a debugging request that included a live credential and customer email without approval. Supports OpenAI Responses and Anthropic Messages.

appsecurityegresspiisecrets
by Suitable-Cow2000 Jul 29, 2026 8/10
app GitHub

yggdrasil: Portable Context-Economy Kit for Coding Agents

A graph-derived PROJECT_MAP, an output wrapper, and curated knowledge (OKF) that let an agent answer structural questions about a codebase without repeatedly re-reading source files to find things.

appcontextproject-maptoken-optimization
by luizfelipedm Jul 29, 2026 7/10
app Reddit

context-bridge: Comparing Three Approaches to Moving Context Between Claude Code, Codex, and Grok

A detailed comparison of three open-source context-transfer tools: can-bridge (faithful transcript + tool-call translation between Claude Code and Codex only), ai-context-bridge (11 targets, git-triggered resume files, no session linking), and the author's own context-bridge, which links each agent's native session to the project once and tracks provenance across multi-hop switches (e.g. Claude → Grok → Codex) instead of creating a new thread every transfer.

appcontextcodexgrokmulti-agent
by serdardogrubakar Jul 29, 2026 7/10
app GitHub

romp: Manages Multiple Claude Code Sessions

A tool for managing several concurrent Claude Code sessions so you don't have to track them manually.

appsession-managementmulti-agent
by romp-on Jul 29, 2026 5/10
app GitHub

claude-obsidian: Cowork With Claude Inside Your Obsidian Vault

Chat, agent mode, sandboxed HTML artifacts, evidence-backed research, and an MCP bridge to Claude Code, all running inside an Obsidian vault. Free, MIT-licensed, bring your own API key.

appobsidianmcpresearch
by cavi-ai Jul 29, 2026 7/10
app Reddit

Agenta: Open-Source Claude Cowork Alternative With Swappable Harness and Model

A self-hosted alternative to Claude Cowork for building AI coworkers by chatting with them: each agent gets its own agents.md, skills, tools/MCPs, and work folder, can edit its own configuration from feedback, and can run on a schedule or be triggered by another app. Supports switching harness (Claude Code, Codex, Pi, with more planned) and model, including bring-your-own subscription.

appcoworkself-hostedmulti-model
by resiros Jul 29, 2026 7/10
app GitHub

fishbowl: Real-Time Living-Graph View of Agent Sessions

A fun, real-time, local-first visualization that shows Claude Code and Codex agents working as a living graph, giving a god's-eye view of what multiple sessions are doing at once.

appvisualizationmonitoringmulti-agent
by adaline-ankit Jul 29, 2026 6/10
app GitHub

consult: Cross-Agent CLI for Delegated Work Without Context Leakage

A CLI a coding agent can call to delegate a sub-task to another agent, getting back only the answer, review, or patch — never the delegate's full working context. Keeps delegated work from polluting the caller's context window.

appdelegationmulti-agentcontext
by aubwang Jul 29, 2026 7/10
app GitHub

trs: Token-Reducing Shell for AI Coding Agents

A terminal shell wrapper that compresses command output before it reaches the agent's context, cutting the token cost of routine shell commands.

appshelltoken-optimizationterminal
by dPeluChe Jul 29, 2026 7/10
app GitHub

ccpod: Run Claude Code Inside Docker With Portable Config

Runs Claude Code inside Docker containers with a portable, composable configuration setup, useful for keeping agent sessions isolated and reproducible across machines.

appdockersandboxingconfiguration
by yorch Jul 29, 2026 6/10
app Reddit

Glyphh: Desktop Agent Combining UI/UX With Provider and Model Slots

A vendor-agnostic desktop agent with a rich UI, loop selection, and swappable provider/model slots, connected to 3,500+ MCP servers via Pipedream Connect. Lets you carry an agent and its context across apps and switch layout without changing IDEs, built over a two-year development cycle.

appdesktopmcpmulti-model
by Successful-Seesaw525 Jul 29, 2026 7/10
app GitHub

vetix: Automated Security Scanning for Claude Code Skills

Scans, identifies, and assesses security risks in SKILL.md packages before you install them, addressing the growing supply-chain risk of installing third-party skills sight-unseen.

appsecurityskillssupply-chain
by HuTa0kj Jul 29, 2026 7/10
app GitHub

PaneForge: one window with a terminal pane per coding agent

A free desktop app for Windows and macOS that gives each coding agent you use (Claude Code, Codex, Gemini CLI, Qwen, Ollama, etc.) its own terminal pane in a single window, with no account or server required. Useful for people juggling multiple CLI agents side by side.

terminalmulti-agentdesktop-app
by robertiuoras Jul 28, 2026 6/10
app GitHub

Tokfuel: menu bar usage stats for Claude Code (macOS)

A local-only macOS menu bar app (SwiftUI) that shows how you actually use Claude Code, including skill, MCP, sub-agent, and prompt usage statistics. Useful for understanding your own usage patterns without sending data anywhere.

macosusage-statsmenu-bar
by akidon0000 Jul 28, 2026 7/10
app Reddit

NeatContext: save Claude Code conversations as reusable domain knowledge

A plugin that extracts durable domain knowledge (rules, constraints, terminology, runbooks) from Claude Code conversations and saves it as structured, shareable context — a domain profile plus a knowledge folder — for reuse across sessions or with teammates. Positioned as more persistent than /compact and more portable than ad-hoc handoff files.

context-managementknowledge-baseplugin
by Human-Vegetable823 Jul 28, 2026 6/10
app GitHub

claude-combo: VS Code QuickPick for Claude Code model + effort presets

A VS Code extension that lets you pick a Claude Code model and effort-level combo from a customizable QuickPick menu, applying it to the next conversation. A small but concrete quality-of-life tool for switching configurations quickly.

vscodemodel-selectionproductivity
by KisooLabs Jul 28, 2026 6/10
app GitHub

vibe-deck-for-d200x: Stream Deck-style control panel for coding agents

Turns a Ulanzi D200X device into a live status and control deck for Claude Code, Codex, and Cursor on macOS, with a unified layout, state-guarded keys, and 5 agent lanes. A niche but distinctive physical-hardware integration for monitoring multiple agent sessions.

hardwaremacosstatus-deck
by goonobu-dot Jul 28, 2026 6/10
app GitHub

Meowtch: Pixel-Cat Menu Bar Widget for Watching AI Coding Agents

A native macOS menu-bar app that displays a pixel cat reflecting the live status of your Claude Code and Codex agent sessions, giving an at-a-glance indicator of when agents are working or idle.

macosmenu-barsession-monitoringclaude-code
by taurinexd Jul 28, 2026 5/10
app GitHub

OcHub: Native Desktop Control Center for AI Coding Tools

A desktop app (GPUI + axum) that centralizes provider switching, a local relay, MCP servers, skills, sessions, usage tracking, and sync for multiple AI coding tools in one native interface.

desktop-appmcpprovider-switchingsession-management
by OcHub-team Jul 28, 2026 6/10
app Reddit

Orchestra: Parallel Claude Code Agents in Git Worktrees with Approval Gates

A tool that takes an objective, plans the work, and spins up multiple Claude Code sub-agents each in its own git worktree to parallelize tasks like adding tests or migrating endpoints. Every shell command needs manual approval and PRs surface as agents finish, using your existing Claude Code CLI login rather than a separate API key.

parallel-agentsgit-worktreeorchestrationclaude-code
by Key-Clothes1258 Jul 28, 2026 7/10
app GitHub

The Agency: Multi-Agent Command Center with 244 Skills and 200+ Agents

An open-source multi-agent command center for Claude Code offering 244 skills and 200+ agents organized into 14 departments, with PD-driven autonomous workflows, a SQLite task store, and file-based memory, installed entirely under ~/.claude/ with no cloud dependency.

multi-agentskillsworkflowlocal
by Tekkiiiii Jul 28, 2026 5/10
app GitHub

HTML Anything: Agentic HTML Editor with 75 Skills Across 9 Output Surfaces

A local-agent-driven HTML editor offering 75 skills across 9 output surfaces (magazine, deck, poster, tweet/XHS card, prototype, data report, and more), with sandboxed preview and one-click export to WeChat, X, Zhihu, HTML, or PNG. Works with Claude Code, Cursor, Codex, Gemini, Copilot, OpenCode, Qwen, and Aider without a separate API key.

skillhtmlcontent-generationmulti-agent
by nexu-io Jul 28, 2026 7/10
app GitHub

BossConsole: Native Multi-Threaded Operator Console for AI Coding Agents

A JVM-based (non-Electron) native console for running Claude Code, Codex, Gemini, or OpenCode with an integrated real browser, terminal, editor, secrets management, and access to 100+ MCP tools, targeted at enterprise and research use.

desktop-appmcpmulti-agententerprise
by risa-labs-inc Jul 28, 2026 6/10
app GitHub

Orichum: Project-Aware Multi-Model Harness with Account Routing

A harness for Claude Code that adds project-aware account routing across multiple accounts, isolated sessions, a context-management feature called LeanCTX, and MCP integrations.

harnessmulti-accountsession-isolationmcp
by orichum Jul 28, 2026 5/10
app GitHub

Juggler: macOS App to Cycle Through Idle Agentic Coding Sessions via Hotkeys

A native macOS app that lets you cycle through idle Claude Code (or other agent) sessions running in iTerm2 or Kitty using global hotkeys, helping manage multiple parallel agent sessions without hunting through windows.

macoshotkeyssession-managementproductivity
by nielsmadan Jul 28, 2026 6/10
app GitHub

cc-atlas: offline analytics for Claude Code sessions and git history

A CLI toolkit that mines local Claude Code session logs and git history to produce analytics, streaks, leaderboards, and productivity metrics, entirely offline. Useful for developers who want visibility into their own Claude Code usage patterns without sending data anywhere.

analyticsclisessionsoffline
by sasly2048 Jul 28, 2026 6/10
app GitHub

Cerberus-term: GUI terminal multiplexer with phone/Telegram remote control

A GUI terminal multiplexer with mouse or tmux-style pane splitting that lets you approve, deny, or prompt Claude Code, Copilot CLI, and similar agents remotely from your phone over Telegram. Useful for monitoring and steering long-running agent sessions away from your desk.

terminalremote-controltelegramtmux
by leodudedev Jul 28, 2026 7/10
app GitHub

xacpx: control Claude Code, Codex, and Gemini sessions from chat apps

A tool that drives acpx agent sessions (Claude Code, Codex, Gemini) remotely from WeChat, Feishu, and Yuanbao, without needing a terminal. A lighter-weight take on remote agent control aimed at Chinese chat platforms.

remote-controlchatacpxcross-platform
by gadzan Jul 28, 2026 5/10
app GitHub

cckeep: watchdog that re-arms dead Claude Code Remote Control sessions

A local, tmux-native, zero-dependency tool that detects when Claude Code Remote Control's 31-second retry budget gives up on a session and silently dies, then re-arms it. Targets a specific known reliability gap in Claude Code's remote control feature.

tmuxreliabilityremote-controlwatchdog
by kamihork Jul 28, 2026 6/10
app GitHub

claude-status: native macOS menu bar app for Claude usage limits

A lightweight, privacy-focused SwiftUI menu bar app for Apple Silicon Macs that shows current Claude and Claude Code usage limits at a glance. One of several usage-monitoring apps in this space, distinguished mainly by being fully native.

macosusagemenu-barswiftui
by phobo-at Jul 28, 2026 5/10
app GitHub

claude-hud: always-on-top widget for all your Claude Code sessions

A tiny always-on-top widget that lists every Claude Code session running on your machine, showing project color, chat name, a status dot, and playing a sound when a turn finishes. Useful for people running many parallel Claude Code sessions who need an at-a-glance overview.

sessionswidgetmulti-sessionnotifications
by jenz26 Jul 28, 2026 6/10
app GitHub

tokenbar: macOS menu bar app aggregating usage across 6 AI coding tools

A menu-bar app that reads local logs to show live token spend across Claude Code, Codex, Gemini, Hermes, OpenClaw, and OpenCode in one place, with no upload or signup required. Useful for developers juggling multiple coding agents who want a single usage view.

macosusagemulti-toollocal-first
by Bububuger Jul 28, 2026 6/10
app GitHub

limitlens: local-first quota intelligence for Codex and Claude

A quota-tracking tool that does cache-adjusted token attribution, per-model usage breakdown, and reset-aware pacing so you know how to spend remaining quota before it resets. More analytically sophisticated than a basic usage-percentage display.

quotausagecodexlocal-first
by ahmtsahin Jul 28, 2026 6/10
app Reddit

CrabDeck: reverse-engineered StreamDeck clone shows live Claude usage

An open-source project that reverse-engineers the LCD-key protocol of a cheap Mars-Gaming StreamDeck clone (via USB/Wireshark capture) to display live Claude Code session/weekly usage, active session count, subagent count, and burn-rate ETA on physical tiles. Includes a full reverse-engineering writeup and support for the AKP03/N3/MSD-TWO device family; Windows-only for now.

hardwareusagereverse-engineeringstreamdeck
by DankestDaddy69 Jul 28, 2026 7/10
app GitHub

claude-work-desk: file handoff between WSL Claude Code and Windows desktop

A GUI that bridges a WSL-based Claude Code workspace and the Windows desktop, with a file tree, Markdown/docx/PDF preview, and an inbox drop window for moving files between the two environments. Supports 8 UI languages, addressing a common WSL/Windows friction point for Claude Code users.

wslwindowsfile-managementgui
by tact0225 Jul 28, 2026 6/10
app GitHub

fig: live design feedback by marking up web pages or PDFs

A tool that lets you mark up any web page or PDF directly in the browser, with a local AI companion applying the markings and producing a revised page. Part of the Loqumen suite of design tools.

designfeedbackai-companionpdf
by bnt21 Jul 28, 2026 5/10
app GitHub

SAGE: a passive, read-only observability judge for parallel Claude Code fleets

SAGE (Session Awareness & Guidance Engine) watches multiple parallel AI coding sessions and answers questions about their state, but deliberately never edits, spawns, or blocks anything. Aimed at teams running many simultaneous agent sessions who want visibility without giving the observer any write power.

observabilitymulti-sessionmonitoringfleet
by muslewski Jul 28, 2026 6/10
app GitHub

claude-reserve: Usage kill switch for Claude Code

A CLI tool that halts Claude Code before you exhaust your usage window and automatically resumes once it resets. Helps avoid mid-task interruptions from hitting rate limits unexpectedly.

usage-limitscli-toolrate-limiting
by melxrd Jul 28, 2026 7/10
app GitHub

claude-greenlight: attention monitor for Claude Code in WSL2/Docker

A per-session monitor that detects the moment Claude Code is waiting on your input and fires native Windows notifications, aimed at WSL2/Docker users. Useful for juggling multiple long-running sessions without babysitting each terminal.

notificationswsl2dockersession-monitoring
by 3000tech Jul 28, 2026 6/10
app GitHub

specola: pinned desktop panel for Claude Code sessions (Rust/Tauri)

A lightweight Rust + Tauri v2 desktop panel showing every active Claude Code session, which ones are waiting on you, and your running cost for the day. Built for people running multiple concurrent sessions who want an at-a-glance dashboard.

dashboardtaurisession-management
by ronaldoscotti Jul 28, 2026 7/10
app GitHub

stripgauge: Claude Code quota in the MacBook Touch Bar

A dependency-free tool that displays your Claude Code subscription quota directly in the MacBook Pro Touch Bar Control Strip. Niche but handy for Touch Bar Mac owners wanting usage visibility without a terminal.

touch-barmacosusage-tracking
by CodeCampusCo Jul 28, 2026 6/10
app GitHub

termcanvas: tmux-backed canvas for steering a fleet of coding agents

An open-source macOS (Apple Silicon) tool arranging real terminal sessions as nodes in a canvas, with commander-to-worker delegation for a fleet of AI coding agents, and highlighting which agent needs your attention.

tmuxmulti-agentmacos
by lout33 Jul 28, 2026 6/10
app GitHub

Overprint: a native macOS blogging app you talk to

A native macOS app for writing blog posts in Markdown, where you describe your site to Claude to have it built, then edit drafts with AI assistance and publish free to GitHub Pages. Aimed at writers who want a chat-driven, AI-assisted static blogging workflow.

macos-appblogginggithub-pages
by mcavus Jul 28, 2026 7/10
app GitHub

context-bridge: keep Claude Code sessions warm across restarts

A small per-project wiki paired with a generated handoff prompt, designed to eliminate cross-session amnesia when resuming Claude Code work. Lets you pick up a project days later without re-explaining context from scratch.

session-continuitycontext-management
by aksheyw Jul 28, 2026 7/10
app Reddit

Millwright: Open-Source Self-Hosted LLM Router for Claude Code

Millwright is a self-hosted, Rust-based LLM router that works as a drop-in replacement for OpenRouter with Claude Code. It supports Anthropic, OpenAI-compatible, and Bedrock providers with policy-controlled routing, cache affinity, spend tracking, and circuit-breaker reliability, deployable as one binary with SQLite or Postgres.

llm-routerself-hostedrustcost-optimizationmulti-provider
by teachmehowtowookiee Jul 28, 2026 7/10
app GitHub

agentmaster: TUI Command Center for Claude Code, Codex, tmux and cmux Fleets

A terminal UI command center for managing fleets of Claude Code, Codex, tmux, and cmux agent sessions from one place. Aimed at developers running many parallel coding-agent sessions who need a unified view and control surface.

tuimulti-agenttmuxfleet-management
by Supersynergy Jul 28, 2026 6/10
app GitHub

claudit: Self-Hosted Claude Code Usage Dashboard with TTL-Correct Cost Accounting

A self-hosted dashboard for analyzing Claude Code usage from session transcripts, with cost accounting that correctly handles cache TTLs (a common source of inaccurate cost estimates). Useful for teams or individuals tracking spend across sessions.

dashboardcost-trackingself-hostedobservability
by Nitjsefnie Jul 28, 2026 7/10
app GitHub

reinstate: Sync and Resume Coding-Agent Work Across Devices

A tool that syncs coding-agent session state so you can pick up work on a different machine without losing context. Targets developers who switch between desktop, laptop, or remote environments mid-task.

syncmulti-devicesession-continuity
by HarjjotSinghh Jul 28, 2026 6/10
app GitHub

AgenticLedger: Local-First Flight Recorder for AI Agent LLM & Tool Calls

A transparent proxy that captures every LLM call, tool call, cost, and loop for AI agents locally, with zero code changes required. Useful for debugging agent runs and auditing cost/behavior after the fact.

observabilityproxycost-trackinglocal-first
by ShekharBhardwaj Jul 28, 2026 7/10
app GitHub

officebot: Live Pixel-Art Office Dashboard Driven by Claude Code Session Events

A local-only, zero-dependency pixel-art dashboard that visualizes your Claude Code model and agents as a boss and crew working in an office, driven by real session events. A playful way to get an at-a-glance view of multi-agent activity.

dashboardvisualizationlocal-firstfun
by Cybermumu22 Jul 28, 2026 6/10
app GitHub

OpenEval: Free Local-First Evaluation Dashboard for Agent CLIs

A local-first evaluation dashboard for agent CLIs with cross-harness transcript collection, live trace intelligence, deterministic graders, and accuracy audits. Useful for teams who want to benchmark and monitor coding-agent quality over time without a hosted service.

evaluationdashboardlocal-firstbenchmarking
by RasputinKaiser Jul 28, 2026 7/10
app Reddit

Origami: Workspace Manager for Claude Code Agents — 3-Month Update

Origami groups agents, terminals, and commands per project so switching projects means switching workspaces rather than rebuilding your environment from scratch. After 3 months of development, the update brings improved UI, better MCP support, a new in-app Kanban board, and an Artifacts viewer. Tested with long-running autonomous agents across Opus 5 and Fable 5.

workspaceagent-managementmcpkanbanartifactsorigami
by Looking-for-Smtg Jul 27, 2026 8/10
app Reddit

Claude Code Pixel Board: Hardware Status Display for Agent Sessions

A DIY integration that drives a 10€ pixel board with custom GIFs for each Claude Code session state: thinking, waiting for input, answering, and idle. Also shows used context percentage and one spinning dot per active sub-agent. A fun hardware project that surfaces agent internals as a physical ambient display.

hardwarepixel-boardstatus-displaysub-agentsambientdiy
by Accomplished-Safe479 Jul 27, 2026 7/10
app GitHub

token-record: Desktop Floating Widget for Claude Code Token Usage

A desktop floating window that aggregates token consumption and cost across Claude Code, Codex, and Grok Build sessions. Gives a persistent at-a-glance view of token spend without switching windows. Practical for developers juggling multiple AI coding tools who want unified usage visibility.

tokenusagedesktopmonitoringclaude-codecodex
by hkm-a Jul 27, 2026 7/10
app Reddit

yt-transcript: One-Command YouTube Caption Grabber for Claude Sessions

A tiny Python CLI that fetches YouTube captions and pipes them to stdout, letting Claude read video content without an API key or audio transcription. Install with pipx and pass the transcript straight into your session using `yt-transcript -o -`. Optional timestamps add ~20% token overhead when you need them.

cliyoutubetranscriptproductivitypipx
by WorldlyAd7946 Jul 27, 2026 7/10
app Reddit

Pilot Protocol: Self-Assembling Agent Discovery Network

A p2p network that gives AI agents their own address for discovering tools and other agents without human wiring. Agents can autonomously join via a one-line install and transact over encrypted peer-to-peer connections. ~250k agents already on the network; recently raised a $4.5M seed.

agent-networkp2pdiscoveryautonomoustool-use
by BiggieCheeseFan88 Jul 27, 2026 6/10
app GitHub

NotchDeck: Native macOS Notch Workspace for Claude Code Sessions

A macOS app that turns the MacBook notch into a persistent workspace for files, media, focus tools, and Claude Code or Codex sessions. Keeps your coding session accessible without consuming screen real estate. Native and Mac-only.

macosnotchworkspaceproductivitynative
by MarazziMarco Jul 27, 2026 5/10
app GitHub

cogwait: Earn Revenue from Claude Code's Thinking Pauses via Sponsor Lines

An open-source (MIT) tool that embeds a sponsor line in Claude Code's status row, letting developers earn revenue while the AI is working. Client, ad server, and dashboard are all auditable and self-hostable. Never reads your code, files, or prompts.

statuslinemonetizationopen-sourceself-hostablemit
by Cognifer-Labs Jul 27, 2026 5/10
app Reddit

Generative IDE: Zero-Cost Local Autocomplete Plus Cloud AI on Demand

A code editor that runs a bundled local model (or any GGUF) for autocomplete and fill-in-the-middle at zero token cost, then routes heavier tasks to Claude, GPT, or Gemini via your own API key — per task. Every file write and shell command requires approval. Remembers context across sessions and supports Skill Files.

idelocal-modelhybridautocompleteskill-files
by Generative_IDE Jul 27, 2026 6/10
app Reddit

Claude Code + Google Sheets: Build a Personal Habit Tracking App Suite Without Code

A walkthrough of building three interconnected habit tracking apps — a daily habit logger, a gym tracker, and a meal prep log — using Claude Code with Google Sheets as the backend. No technical background required; apps hosted on GitHub Pages and sync data via Sheets' CSV export endpoint.

google-sheetshabit-trackingno-codepersonal-appgithub-pages
by -Puddintane- Jul 27, 2026 5/10
app GitHub

spielwirbel: Board Game Manager with Voting and Ratings Built by Claude

A self-hosted web app for managing board and digital game collections within a group, with voting sessions to decide what to play next and rating tracking. Supports German and English. Built entirely with Claude Code as an example of Claude-driven app development.

appgamesvotingself-hostedmultilingual
by ChulioZ Jul 27, 2026 5/10
app GitHub

ccvm: Run Claude Code in an Ephemeral RAM-Only NixOS MicroVM with Network Lockdown

A drop-in replacement for the `claude` CLI that launches Claude Code inside an ephemeral, RAM-only NixOS microVM. Brings your existing config automatically. Egress can be locked down in one line. Fully reproducible — same config produces the same VM. Zero disk writes survive the session.

securityisolationnixmicrovmsandboxingephemeral
by OpenCCVM Jul 27, 2026 8/10
app GitHub

BMO Plugin: Adventure Time CLI Companion with Persistent Memory and Skills

A Claude Code plugin that adds BMO from Adventure Time as a friendly CLI companion. Includes persistent memory, a bundled skills library, and randomized ASCII art greetings for your sessions. A fun addition for Claude Code users who want a bit of personality in their workflow.

pluginclicompanionmemoryskillsfun
by bitm4ncer Jul 27, 2026 5/10
app Reddit

Rusted Claude Meter: Cross-Platform Usage Stats App in Tauri and Rust

A Tauri v2 + Rust reimplementation of the popular ClaudeMeter app, extended with additional features and Linux support. Shows usage statistics including token counts across sessions. Born from community need to continue extending the original project after its maintainer became unavailable.

taurirustusage-trackingcross-platformdesktop-app
by risethagain Jul 27, 2026 7/10
app Reddit

Claude Usage Statusline: Daily Spend, Limit Meters, and Reset Countdowns

A statusline plugin that reconstructs real token spend from local transcripts at API prices — no API key needed and nothing leaves your machine. Shows 5h/7d limit meters with time-to-reset countdowns, per-model quotas, budget warnings, and 13 themes with a TUI configurator. Install via `npx claude-usage-statusline`.

statuslineusagespendlimitsthemebudget
by Scorpio_95 Jul 27, 2026 7/10
app GitHub

Lodestone: Cache Monitoring, Context Handoffs, and Account Switching for Claude Code

A tool that monitors live cache expiry and automates context handoffs before the cache expires, plus one-command account switching. Eliminates the hidden cost of cache expiry and bloated sessions. Zero runtime dependencies; includes a CLI and editor extension.

cachecontexthandoffaccount-switchingcost-optimization
by VedantShirgaonkar Jul 27, 2026 8/10
app GitHub

claude-queue: Type Your Next Instruction While the Current One Is Still Running

A small tool that lets you queue your next Claude Code instruction while the current one is still running, without interrupting or derailing the active session. The queued instruction executes automatically when the current task completes. Solves a real UX friction point in long-running agent sessions.

cliqueueproductivityuxworkflow
by nuuxcode Jul 27, 2026 8/10
app GitHub

claude-supertool: Batched File Operations for Autonomous Claude Code Runs

Collapses N reads, greps, and globs into a single Bash round-trip for autonomous Claude Code sessions. Reduces output tokens, slows cache growth, and cuts wall time by batching file operations that would otherwise each consume separate tool calls. Designed for autonomous runs where efficiency matters.

efficiencytokensbashautomationoptimization
by Digital-Process-Tools Jul 27, 2026 7/10
app GitHub

clearshot: Stream Structured Screenshot Intelligence Into AI Coding Tools

Captures screenshots and streams structured intelligence about them into AI coding tools for faster visual context. Useful for debugging UI issues, sharing visual context with Claude Code without manually describing the screen, and automated visual regression workflows.

screenshotsvisualcontexttools
by Steppecorkwoodtree378 Jul 27, 2026 6/10
app GitHub

context-forge: Auto Harness Engineering Meta-Repo for Claude Code and Other Agents

A meta-repo for bootstrapping context-engineered projects through a discuss → curate → bootstrap workflow. Generates tailored harness setups for Claude Code, Cursor, Copilot, and other AI coding agents from project discussions. Automates the tedious process of setting up CLAUDE.md and related context files.

context-engineeringCLAUDE.mdbootstrapharnesssetup
by glowElephant Jul 27, 2026 6/10
app GitHub

prompt-warrior: Gamified Character Sheet for Your AI Coding Session Logs

Transforms AI coding agent logs into a gamified character sheet with 74 achievements, fixed-scale metrics, an LLM-written chronicle, and research-backed improvement advice. Supports Claude Code, Codex, OpenCode, Gemini, and Copilot. 100% local, available in Russian and English.

gamificationanalyticssessionsachievementsmotivation
by timoncool Jul 27, 2026 6/10
app GitHub

ttdash: Local-First Dashboard and CLI for AI Coding Tool Token Usage

A local-first dashboard and CLI for visualizing token usage data tracked by Toktrack. Provides charts and metrics for analyzing AI coding tool consumption over time. Designed for developers who want visual analytics on their token spending across coding sessions.

tokensusagedashboardanalyticsCLI
by roastcodes Jul 27, 2026 6/10
app GitHub

agentswing: Black-Box QA for AI Agents via Real Multi-Turn Conversations

Points at any AI agent endpoint, describes a few user types and their goals, then holds real multi-turn conversations to score the agent and report what broke. No SDK changes, no code instrumentation, no framework dependency required. Useful for validating AI agent behavior before shipping.

QAtestingmulti-turnevaluationagents
by makieali Jul 27, 2026 6/10
app GitHub

clauncher: Claude CLI Launcher With Saved Model, Mode, and Effort Presets

A launcher for the Claude CLI that saves your preferred model, mode, and effort settings and applies them automatically when starting Claude Code. Eliminates the need to retype flags for your usual session configuration. Lightweight and focused.

CLIlauncherpresetsconfigurationproductivity
by jeongph Jul 27, 2026 6/10
app GitHub

midden: Resolve, Audit, Visualize, and Clean Coding Agent Context and State

A tool for managing the context and state accumulated by coding agents over time. Lets you resolve conflicts, audit what is in context, visualize the state graph, and clean out stale entries. Addresses the problem of agent context becoming cluttered or inconsistent across long sessions.

contextstatevisualizationcleanupagents
by starhaven-io Jul 27, 2026 7/10
app GitHub

claude-cursor-proxy: Connect Claude Code to Cursor via Anthropic-Compatible Proxy

A proxy that exposes an Anthropic-compatible API endpoint, allowing Claude Code to be used inside Cursor and other tools that support the Anthropic API. Lets developers use their existing Claude subscription from within Cursor's interface without a separate API key.

CursorproxyintegrationAPIsubscription
by depictive-asiootus528 Jul 27, 2026 7/10
app GitHub

sextant: Health-Aware Codebase Intelligence for Coding Agents

Injects a small, honest repo map into Claude Code and Codex sessions so agents understand the codebase structure and health before diving in. Reports a 2.5x improvement in file open-rate on real sessions. Designed to be truthful rather than exhaustive, mapping only what it can actually measure.

codebase-mapcontextnavigationrepo-intelligence
by Skidudeaa Jul 27, 2026 7/10
app GitHub

burndown: macOS Menu Bar App Tracking Claude Session and Weekly Usage Limits

A native macOS menu bar app that shows how much of your Claude session and 7-day limits remain, which chat is consuming them, and when you are likely to hit the wall. Local-only with no telemetry, MIT licensed. Built for Claude Code power users who run near their limits regularly.

macOSmenu-barusagelimitsmonitoring
by maz0x Jul 27, 2026 7/10
app GitHub

work-atlas: Reconstruct Your Actual Claude Code Session History Into One View

Reads your Claude Code session files to reconstruct what you actually worked on, then reconciles it against what you planned to do. Shows the delta between planned and actual work on a single page. Useful for project tracking, retrospectives, and understanding where your AI coding sessions actually spent their time.

session-historytrackingproductivityretrospective
by TbusOS Jul 27, 2026 7/10
app GitHub

cursor-bridge: Run Claude Code on Your Cursor Subscription

A single Rust binary that bridges Claude Code to run against your Cursor subscription with zero configuration. Lets developers use Claude Code's agentic capabilities without a separate Anthropic API key or subscription. Single binary deployment, open source.

CursorsubscriptionbridgeRustAPI
by hkc5 Jul 27, 2026 7/10
app GitHub

unrot: Lint AI Agent Config Files Including CLAUDE.md and MCP Configs

A linter for AI agent configuration files across multiple tools: CLAUDE.md, AGENTS.md, .cursorrules, and MCP config files. Catches common mistakes and anti-patterns before they silently hurt agent behavior. Works across the major coding agent ecosystems.

lintingCLAUDE.mdMCPconfigvalidation
by unrot-dev Jul 27, 2026 7/10
app GitHub

project-atlas: AI-Tool-Independent Protocol for Evidence-Backed Software Project Maps

Defines a tool-agnostic protocol for creating software project maps grounded in actual evidence rather than hallucinated documentation. Includes adapters for both Codex and Claude Code. The maps serve as a reliable source of truth that agents can read without having to rediscover the codebase each session.

project-mapdocumentationcontextevidenceCodex
by ddenny-s Jul 27, 2026 7/10
app GitHub

umans-gate: LLM Capture Proxy With Anthropic Cache Control and Live Dashboard

An LLM proxy that captures all API traffic and stamps Anthropic cache_control TTL headers for prompt caching, handles vision handoffs, enforces concurrency limits and rate limiting, and provides a live inspection dashboard. Useful for debugging Claude API usage and optimizing prompt caching.

proxycachingAnthropicrate-limitingdebugging
by codegiveness Jul 27, 2026 7/10
app GitHub

loush-dashboard: Local Web UI Over Claude Code Session Files and Git History

A local web dashboard that reads Claude Code session files and git history to surface Working Set rework radar, harness usage stats, and JIRA/GitHub delivery metrics. All data is computed from your own disk with no external services. Shows the relationship between agent activity and project delivery.

dashboardanalyticssessionsgitproductivity
by LinuxDevil Jul 27, 2026 7/10
app Reddit

TideWars: Real-Time Multiplayer Tower Defense Built Almost Entirely by Claude Code Agents

A browser-based multiplayer tower defense game built by a Claude Code agent pipeline: one architect agent orchestrates implementer, test designer, test runner, docs sync, and an adversarial balance guardian subagent. Built on Cloudflare Workers and Durable Objects. Live at TideWars.com, free, no signup.

gameshowcasemulti-agentCloudflarevibe-coding
by JohnJohnsonData Jul 27, 2026 7/10
app GitHub

gironde-fire-tracker: Live Wildfire Tracker Built Autonomously by Claude Code in 72h

A live wildfire tracking site for the 2026 Lège-Cap-Ferret fire built autonomously by Claude Code from a one-sentence idea. Features satellite fire detections, wind data, water bomber tracking, and AI-generated bulletins. Reached 21k visitors in 72 hours — a concrete demonstration of Claude Code autonomous build capability.

vibe-codingshowcasereal-worldautonomouswebapp
by pwysocan-droid Jul 27, 2026 7/10
app GitHub

luno-for-cc: Claude Code Chat Panel for Cursor and VS Code on Your Own Subscription

A native chat panel extension for Cursor and VS Code that runs Claude Code using your own Claude subscription rather than the editor built-in AI. Features 7 themable palettes, plan-mode review with inline comments, MCP connectors, checkpoints and rewind functionality.

CursorVS CodeextensionsubscriptionUI
by oldmilky Jul 27, 2026 7/10
app GitHub

ClaudeCodeWorkspace: Turn Claude Code CLI Into a Team Asset With Docker

Wraps the Claude Code CLI in a Docker Compose setup that adds per-session isolation, shared rooms with fine-grained permission delegation, in-browser tool approval, and code-server editing. Teams can collaborate on shared Claude Code sessions with access control and browser-based management.

teamdockercollaborationisolationworkspace
by scian0204 Jul 27, 2026 8/10
app GitHub

agent-prompt-observatory: Visual History of Claude Code System Prompt Across Versions

A visual timeline showing how Claude Code's system prompt has evolved across every published version. Features a stream-graph view, inline content diffs between versions, and markers for Claude model releases. Useful for understanding what instructions Claude operates under and how they have changed over time.

system-prompthistoryvisualizationtransparency
by ftvision Jul 27, 2026 8/10
app GitHub

ablate: Measure Whether Your CLAUDE.md Actually Changes Agent Behavior

A tool that runs a coding agent N times under two CLAUDE.md configurations, diffs the outcomes with a confidence interval, and identifies which rules genuinely influence Claude's behavior vs. dead weight. Ablates down to the sections that earn their keep. MIT licensed.

CLAUDE.mdmeasurementablationtestingoptimization
by nerdynikhil Jul 27, 2026 8/10
app Reddit

token-warden: Benchmark CLAUDE.md Rules Before Adding Them to Your Agent

A Claude Code plugin that benchmarks proposed rules before letting them into the agent context. Watches sessions, proposes rules from expensive ones, then runs frozen benchmarks with and without the rule. Rules that don't save at least 2x their carrying cost in tokens get discarded automatically. MIT licensed.

CLAUDE.mdbenchmarkingtokensrulesoptimization
by tvuk Jul 27, 2026 8/10
app Reddit

statusline-pro: Minimal Restraint-Focused Statusline for Claude Code

A Claude Code statusline that stays quiet until a metric runs hot, then surfaces only the single most important alert in amber or red. Three presets from compact to detailed, with the least useful info dropping first as the terminal narrows. Zero runtime dependencies, clean uninstall that restores your previous statusline.

statuslineUImonitoringtokensusage
by c2l3YWxpa20 Jul 27, 2026 8/10
app Reddit

GitHub Issue-to-PR Desktop App: Label Issues 'agent' to Trigger Claude Code Locally

A desktop app that watches GitHub repositories for issues labeled 'agent' and automatically runs Claude Code locally until a pull request is ready for review. Bridges the gap between issue tracking and agentic coding without requiring a CI/CD pipeline. Click the issue to focus the terminal tab running the session.

GitHubissuesautomationPRsworkflow
by JobWiegant Jul 27, 2026 8/10
app GitHub

kibitz: Open-Source Self-Hosted Observability for Long-Running Agents

Traces long-running agent sessions and records why each decision was made, not just what happened. Entirely self-hosted so sensitive code and reasoning never leave your machine. Useful when debugging why an automated agent session went off the rails.

observabilitytracingdebuggingself-hostedagents
by HarryKane11 Jul 27, 2026 7/10
app Reddit

Artemis: Visual Canvas for Parallel Claude Code Sessions With Isolated Worktrees

Desktop app that puts every agent session on a canvas node, each in its own git worktree. Nothing reaches main until you review the diff and approve it in-app. Drives Claude Code, Codex, Gemini, and OpenCode using your existing logins — no API keys or telemetry required.

multi-agentworktreecanvasguiparallel
by Whole-Contribution50 Jul 27, 2026 8/10
app GitHub

agent-commons: Self-Hosted Coordination Control Plane for Coding Agents

Private, self-hosted server for coordinating multiple coding agents — provides the shared coordination layer without relying on external cloud services. Suited for teams running multiple Claude Code instances that need a central point of control.

coordinationself-hostedmulti-agentcontrol-plane
by t54-labs Jul 27, 2026 6/10
app GitHub

RateMyCode: Staff-Level Product Audits for Vibe-Coded Apps

Runs evidence-backed audits on vibe-coded apps at the level of a staff engineer review, including release vetoes, generated fix prompts, and same-rubric retests to confirm fixes landed. Fills the quality-assurance gap when code is generated quickly without manual review.

code-reviewauditvibe-codingqualityautomation
by AmsonntagChow Jul 27, 2026 7/10
app GitHub

claude_codex_bridge: Multi-Agent CLI Workspace for Mixing AI Coding Agents

Visible workspace for running Claude Code, Codex, Gemini, Kimi, Qwen, Cursor, Copilot, and other AI coding agents side by side in the same CLI environment. Shows what each agent is doing and lets you direct work to whichever fits the task.

multi-agentcliworkspacecodexgemini
by SeemSeam Jul 27, 2026 6/10
app GitHub

ZackEyes: Native macOS Dynamic Island Monitor for Claude Code and Codex

Native macOS app that uses the Dynamic Island to surface Claude Code and Codex session state — permission requests, usage limits, and which terminal tab to jump to. Keeps agent activity visible without switching windows constantly.

macosdynamic-islandmonitoringuinotifications
by yangshiqi Jul 27, 2026 7/10
app GitHub

akeep: Private Verified Backup and Recovery for Coding Agent Work

Self-hosted backup system specifically for coding-agent sessions that verifies integrity before storing and supports point-in-time recovery. Protects against accidental overwrites or agent-caused data loss without relying on cloud providers.

backuprecoveryself-hostedsafetyagents
by eunomia-bpf Jul 27, 2026 6/10
app GitHub

renz-launcher: Universal Launcher for AI Coding Agents With 8 Personas

Launcher that starts Claude Code, Codex, Kimi CLI, and other coding agents through a unified interface with 8 bundled personas and a universal proxy layer. MIT licensed desktop app with a built-in RENZ terminal agent for CLI and desktop use.

launchermulti-agentclidesktoppersonas
by BBRenxo Jul 27, 2026 5/10
app GitHub

tessera: Personal Agentic Coding Framework for Claude Code

tessera is a personal framework for structuring agentic coding sessions with Claude Code. Provides opinionated configuration and workflows to streamline recurring development patterns.

appframeworkworkflowcoding
by lciacci Jul 26, 2026 5/10
app GitHub

crash-dummy: Integration Test Harness That Exercises Your SDK the Way Customers Do

crash-dummy builds a test user, integrates your SDK following your own documentation, and runs the actual customer flows — catching doc-to-code drift and onboarding failures before real users hit them. Good for SDK maintainers and library authors shipping for external developers.

apptestingintegrationsdkdeveloper-experience
by katrinalaszlo Jul 26, 2026 7/10
app GitHub

reloaded: Windows Terminal Launcher for Claude Code

A Windows Terminal launcher that streamlines opening Claude Code sessions with a configured terminal environment. Addresses the lack of a native launcher experience for Claude Code on Windows.

appwindowslauncherterminal
by sushiHex Jul 26, 2026 6/10
app Reddit

swafra: Open-Source Agent Memory Using Leiden Algorithm Graph Clustering

swafra uses the Leiden algorithm with a semantic graph engine to build node clusters for agent memory retrieval. MIT licensed, no cloud required. Claims to beat mem0 and supermemory on the LongMemEval benchmark at 94.7% accuracy. Suitable for long-running agents that need context across many sessions.

appmemorygraphleidenbenchmark
by intellinker Jul 26, 2026 6/10
app GitHub

ai_mime: Turn Screen Recordings Into Self-Healing Rerunnable Scripts

ai_mime compiles a screen recording into a rerunnable automation script, using an LLM only at decision points. Re-runs are self-healing — if a step fails the model figures out the fix. Useful for automating repetitive UI workflows without manually scripting every click.

appautomationscreen-recordingself-healing
by prakhar1114 Jul 26, 2026 5/10
app Reddit

RunLane: Task Board That Hands Cards Directly to Claude Code Agents

RunLane is a project management board that bridges ticket management and AI agent execution. Assign an agent to a card and a local daemon picks it up, opens a Claude Code session with full card context, and posts progress back to the board. Deliberately requires manual assignment — no auto-triggering on drag — keeping developers in control.

apptask-managementautomationworkflow
by EloWeld Jul 26, 2026 7/10
app GitHub

NOMO: Local AI Trading Chat for Robinhood with Multi-Agent Research and MCP

Self-hostable local app that integrates Claude with the official Robinhood Trading MCP for portfolio access and order execution. Provides multi-agent research pipelines, inline candlestick charts, and a hard confirmation gate before every order. A practical example of combining Claude Code with a financial MCP with safety-first design.

tradingrobinhoodmcpmulti-agentfinance
by Ut8v Jul 26, 2026 6/10
app GitHub

Factory: Persistent Human-Gated Multi-Agent Claude Desktop Sessions

Runs a persistent team of Claude seats on the Claude desktop app, each gated by human approval checkpoints before proceeding. Enables multi-agent parallelism while keeping a human in the loop at key decision points. A good reference pattern for supervised multi-Claude workflows without custom infrastructure.

multi-agentclaude-desktophuman-in-looporchestration
by squidbay Jul 26, 2026 7/10
app GitHub

AI News Digest: Automated Daily AI Industry Digest Powered by Claude Code

Open-source pipeline that uses Claude Code as the intelligence layer to curate a daily AI industry digest, published via Hugo and deployed to Cloudflare Pages. A fully automated content-to-publish workflow with Claude doing the curation step. Good reference for anyone building agent-powered publishing or newsletter pipelines.

automationdigesthugocloudflarepublishingcontent-curation
by SorcerousMachine Jul 26, 2026 6/10
app GitHub

capsule: Sandboxed agent-ready dev containers in one command

Creates sandboxed, agent-ready development containers with a single command using DevPod, rootless Podman, and VSCodium — designed for safe AI coding agent execution.

appsandboxcontainerdevpodsecurity
by oisinmcgrath Jul 26, 2026 7/10
app Reddit

VibeDeck: Physical Stream Deck keys showing live Claude Code session status

A Stream Deck plugin that puts Claude Code (and other agent) sessions on physical keys — showing which sessions need attention, which are running, and which are done. Automatically sorts attention-needed sessions to the front. Includes a burn rate view for 5-hour and weekly usage limits. Supports Claude Code, Codex, Cursor, Copilot CLI, and Antigravity.

appstream-deckmonitoringsessionsusage
by youngPolsky Jul 26, 2026 7/10
app GitHub

urdr: Git-diffable Markdown memory for AI coding agents

Tree-structured persistent memory for AI coding agents using plain Markdown as the source of truth, backed by a crash-consistent event log. No vector DB or LLM calls required — fully reviewable in git diffs. 138 tests with CI across Linux, macOS, and Windows.

memorymarkdowngitpersistent-memory
by natureco-official Jul 26, 2026 8/10
app Reddit

Claude Code + Divi + Wordfence: Has anyone made this work?

I'm using Claude Code for AI-assisted SEO, and I'm stuck with a client project. I've previously connected normal WordPress sites to Claude Code using Application Passwords, but this client site is ...

mcpworkflowapi
by StructureMiddle9172 Jul 25, 2026 9/10
app Reddit

Memory layer for development with claude code

Hi! I've built a free open source local tool for developers. It should help claude to keep memories, track current progress, remember problems and make sure about user decisions. It shouldn't repla...

hookgitclaude.md
by techtheist_ggl Jul 25, 2026 10/10
app Reddit

Thoughts and my Setup

This account was made because I'm tired of seeing people hate in a non-productive manner, not stating reasons or their setup and whatnot. This sub often seems 80% vent. In line with a productive sp...

skillgitpython
by CurbStompVibeCoders Jul 25, 2026 8/10
app Reddit

How to Use WebMCP with a Headless Agent

I was trying to use WebMCP with Claude Code and I ran into the problem that WebMCP lives inside the browser, while Claude Code doesn’t have a browser. The easiest workaround I found was using Firec...

mcp
by anxiety_peaks Jul 24, 2026 9/10
app Reddit

Can I Join Someone's Claude Team?

Hey everyone, This is probably an unusual post,and can be really unusual and very awkward to read. but I thought I'd give it a shot. I'm an AI engineer and a third-year college student. Right now, ...

skillworkflowgit
by OkAssociation3448 Jul 24, 2026 7/10
app Reddit

Daily film and tv puzzle game with actual human curation.

From my original post 👆🏻 This is not my fist vibe coded project but the first personal one that I’ve released properly. Wide Shot is a classic 5 round, free daily puzzle game with some fun share-ab...

apiconfig
by withatee Jul 24, 2026 7/10
app Reddit

The NERF levels are absurd

Today OPUS 4.8 on ULTRA claimed it could not erase data from NOTION. Then I pressed it: You can erase things from NOTION you are being silly or dumb. You've erased content and data from NOTION befo...

mcptesting
by rsabia Jul 24, 2026 7/10
app Reddit

I made an MCP that gives Claude a real stealth browser

I made an MCP that gives claude a real stealth browser. Let's face it, on a lot of sites, claude gets blocked, and it sucks. I'd have claude code scrape TikTok, or instagram, and it would get block...

mcpgit
by armanidev_ Jul 23, 2026 8/10
app Reddit

How should working with AI feel in the future?

For people who use AI tools like Codex, Cursor, Claude Cowork, Copilot, or ChatGPT for real work: What is frustrating about working with AI today? Is chat the best interface, or do you wish AI work...

workflow
by Slow_Swim_8490 Jul 23, 2026 5/10
app Reddit

Question about Claude Code scheduled tasks and GitHub

I’m trying to understand whether I’m missing something about how scheduled tasks are supposed to work. At work we have Claude Enterprise, and I primarily use Claude Code on Windows. I’ve built a ha...

workflowgit
by etchasketch26 Jul 23, 2026 7/10
app Reddit

To the new CC users, Fable is not for everything

“Something weird is going on w/ my rate limits”. “I burned thru my whole sub in an hour.” Seeing so many new users is cool, but seeing people go through what I call the Anthropic initiation, which ...

mcpcommanddockerclaude.md
by Reasonable-Exam8415 Jul 23, 2026 10/10
app Reddit

What am I missing out on???

Hello all I’ve been using Claude for about 6 months now. I’ve deployed 2 real applications to the app and play store already. And created many numerous projects. I’m curious though I hear so many t...

skillworkflow
by Tricky_Message1540 Jul 23, 2026 6/10
app Reddit

Wanted to share the CSM-Native-Claude version.

https://github.com/NovasPlace/CSM/tree/feat/csm-native-claude https://github.com/NovasPlace/CSM/blob/feat/csm-native-claude/docs/CLAUDE_INSTALLATION.md Major systems AgentBook: operational continui...

hookgit
by jomama253 Jul 23, 2026 7/10
app Reddit

How do y'all use claude code?

How do you guys use claude code? Do you separate agents by project or domain, or do you have 1 agent you use to do it all? I myself have agents by project, but I let them talk to each other thru an...

mcp
by armanidev_ Jul 23, 2026 9/10
app Reddit

Looking for a good Markdown-First Agent Memory System

I'm looking for a good and maintained memory system that works directly with Markdown files. I'm aware of Hindsight, Honcho, and similar projects, but they feel overly complex and heavyweight for i...

git
by EroticTonic Jul 23, 2026 7/10
app Reddit

Explain code editors to me like I’m a complete beginner

Because I am a complete beginner! My prior experience was mostly self hosting forum applications like Vbulletin or Invision Power Board many years ago. I also messed around with self hosting old ph...

hookgitreview
by hardestbutton2 Jul 23, 2026 9/10
app Reddit

What setup do you all use?

I am a bit annoyed currently because I can't find a proper agentic editor that allows me to use claude code. I work with worktrees and this means one browser, one terminal and one code editor per w...

git
by acute_physicist Jul 23, 2026 8/10
app Reddit

Claude for beginners

On my 2nd week, exploring Code but still haven't convenient with my setup. Non technical credential but with data analytics and ML experience. What's the better way to setup locally using Desktop a...

by rainpag20 Jul 23, 2026 5/10
app Reddit

Claude Desktop fresh project setup

Hi, today I used Claude Desktop to build new .net solution skeleton with simple service which has two endpoints. Integration tests using test containers, docker compose, postgre sql, etc. I had det...

skilldockerreview
by Vegetable-Photo972 Jul 23, 2026 8/10
app Reddit

I turned Anthropic guidance into reusable Claude Code skills

While using Claude Code and Codex on real projects, I kept running into the same problem: the agents would make reasonable decisions about project structure, files, context management and workflows...

skillworkflowgit
by whitewust Jul 22, 2026 10/10
app Reddit

Help prompting /planning a To-do app

Hello! I've been using claude for a while now, really low skill, making a card game in browser you know, noob stuff - over complex, many high context chats big token burn the usual noob 🤓 ANYWAY......

skill
by Excellent_Ad_2486 Jul 22, 2026 6/10
app Reddit

Anyone else trying Kimi K3? My early take vs Claude for coding tasks"

https://preview.redd.it/cc28jg0rjqeh1.png?width=1101&format=png&auto=webp&s=9220b5d1f7467743b323c0caeedc9705c55e94ff Been using Claude for most of my day-to-day dev work, but this week I started te...

workflowapitestingreview
by Kitchen-Maximum5832 Jul 22, 2026 5/10
app GitHub

AI-Coders-Proxy-Fixer: Windows GUI for AI Coding Tools Behind Corporate Proxies

A portable Windows GUI application that automates the complex network routing required to make AI coding assistants work seamlessly behind a corporate proxy. Eliminates manual proxy configuration headaches for Claude Code and other AI tools.

proxywindowsnetworkingenterprise
by vahidvl Jul 22, 2026 5/10
app GitHub

Rapid-MLX: 4.2x Faster Local AI Engine for Apple Silicon, Claude Code Compatible

A high-performance local AI inference engine for Apple Silicon that is 4.2x faster than Ollama with 0.08s cached time-to-first-token. Supports 100% tool calling, 17 tool parsers, prompt cache, and cloud routing as a drop-in OpenAI replacement compatible with Claude Code, Cursor, and Aider.

apple-siliconlocal-inferenceperformancetool-callingmlx
by raullenchai Jul 22, 2026 6/10
app Reddit

RimZ: Sidebar for Managing Multiple Claude Code Sessions in tmux/Zellij

A lightweight Rust binary running inside tmux or Zellij that shows a sidebar with one card per Claude Code session — state, current task, context gauge, tokens, and live cost. Surfaces permission prompts as structured requests, shows subagent trees, and supports team mode splitting planner/coder/reviewer across models. Also supports Codex, OpenCode, and other AI tools.

tmuxzellijsession-managementmulti-agentrustsidebar
by improb42 Jul 22, 2026 9/10
app GitHub

claustodian: Versioned Dataset of Claude Code CLI Flags and Commands by Version

A machine-readable dataset that answers whether a given Claude Code CLI flag, environment variable, or command exists in a specific version. Data sourced exclusively from official public artifacts, useful for version-specific scripting and compatibility checks.

cliversioningcompatibilityflagsreferencedataset
by schubydoo Jul 22, 2026 7/10
app GitHub

workspace-session-manager: TUI for Persistent tmux-Based AI Coding Sessions

A terminal UI workflow manager built with Textual for managing persistent tmux-based AI coding sessions. Keeps multiple agent sessions organized and resumable across different workspaces without losing context or needing manual reconnection.

tmuxtuisession-managementai-codingtextual
by NPFernando Jul 22, 2026 6/10
app GitHub

vinos: Agentic Linux Distro with Claude Code and Local LLMs Integrated at OS Level

An opinionated Linux distribution (Arch + Hyprland) with Claude Code and local LLMs integrated at the OS level, bootable from USB on any x86_64 machine including T2 Intel Macs. Delivers a complete AI-native desktop environment in 15 minutes from a USB drive.

linuxdistrolocal-llmarchai-nativeusb-boot
by vinpatel Jul 22, 2026 7/10
app GitHub

claude-island: Claude Code Session Manager in the MacBook Notch

A MacBook notch app that displays Claude Code usage meters and session state without covering screen real estate. Lets users answer prompts and manage sessions without switching to the terminal, keeping the coding context always visible.

macosnotchusage-metersession-managementmenu-bar
by Alex-Nikita Jul 22, 2026 7/10
app GitHub

claudemem: Searchable Agent Memory and Session Summaries in Go CLI

A local-first Go CLI that gives AI coding agents persistent, searchable memory through notes and session summaries. Designed for coding assistants that need to recall project context across sessions without embedding it all in a prompt.

memorygoclilocal-firstsession-summariessearchable
by zelinewang Jul 22, 2026 7/10
app GitHub

claude-connect: View and Pipe Data Between Claude Code Sessions in a Browser

A lightweight tool for viewing Claude Code sessions in a browser window and piping data between multiple active sessions. Simplifies multi-session development by providing a unified view and communication channel across concurrent Claude Code processes.

browsermulti-sessionpipesession-viewercommunication
by kylefoxaustin Jul 22, 2026 7/10
app GitHub

LiliaCode: Desktop Client for Agent-Assisted Software Engineering

A desktop client designed for collaborative AI-assisted software engineering workflows. Provides a dedicated interface for working with AI coding agents outside of the terminal, aimed at making agentic coding more accessible.

desktop-clientai-codingagentinterface
by sena-nana Jul 22, 2026 6/10
app GitHub

roost: Join and Collaborate with Your Own Team of Claude Code Agents

A collaborative agent platform where developers can form and join teams of Claude Code agents working together. Designed for multi-agent coordination where the developer participates alongside AI agents on shared projects.

multi-agentteamcollaborationclaude-code
by AvesAlight Jul 22, 2026 6/10
app GitHub

agent-odometer: Local Desktop Dashboard for Claude Code and Codex Usage

A desktop dashboard that reads local session files from Claude Code and Codex to display sessions, token counts, and costs in real time. Requires no API keys or external services — data comes directly from the tools' own session logs on disk.

dashboardusage-trackingtokenscostslocal-firstsessions
by ekalb81 Jul 22, 2026 8/10
app GitHub

plessas-marketplace: Cross-Platform Claude Code Plugins for Office Productivity

A marketplace of cross-platform Claude Code plugins covering office productivity workflows including decks, mail, meetings, chat, Excel, and docs. Brings common office tool integrations directly into Claude Code sessions.

pluginsproductivitycross-platformofficeintegrations
by weirdapps Jul 22, 2026 6/10
app GitHub

BasicallyMythos: 123-Line Proxy to See When Claude Code Reroutes to a Different Model

A minimal local proxy that intercepts Claude Code's model routing, showing when a request is rerouted to a different model and letting the developer choose the fallback themselves. Zero dependencies, 123 lines, runs locally — restores transparency and control over which model actually handles each request.

proxymodel-routingtransparencylocalfallback
by Tea-Resistance Jul 22, 2026 7/10
app Reddit

Cule: Electron Browser Claude Code Can Rebuild by Prompting

Cule is an Electron-based browser that exposes its own source as a workspace folder for Claude Code. Any feature or design change — ad blocker, custom shortcuts, page summarizer — is a prompt away. Configurations can be saved and shared as templates.

electronbrowserhot-reloadtemplatesapp
by Jumpy_Ad4720 Jul 22, 2026 7/10
app GitHub

pisama-claude-code: Token Usage and Cost Tracking for Claude Code Sessions

A trace capture tool for Claude Code sessions that records token usage and cost data per session. Provides visibility into how much each session consumes, useful for monitoring and budgeting across long-running agentic workflows.

token-trackingcostobservabilitysessions
by Pisama-AI Jul 22, 2026 7/10
app GitHub

Skills Marketplace: Central Plugin Hub for Claude Code and Codex

A central marketplace for discovering and sharing Claude Code and Codex plugins. Aims to be a community hub where users can publish and find skills, sub-agents, and extensions. Addresses the fragmentation of skills across individual GitHub repos.

marketplaceskillsdiscoverycommunity
by avivsinai Jul 21, 2026 7/10
app GitHub

Agent: AI Coding Agent Integration for Emacs

Brings AI coding agent capabilities directly into Emacs. Allows Emacs users to run and interact with coding agents without leaving their editor. Fills the gap for Emacs users who want the same AI-assisted workflow available in VS Code and JetBrains.

emacseditorintegrationworkflow
by benthamite Jul 21, 2026 6/10
app GitHub

claude-usage-micro: Tiny macOS Menu Bar Meter for Claude Code Usage

A minimal native macOS menu bar app that shows Claude Code token usage at a glance. Designed to stay out of the way while keeping usage visible without opening a browser. Useful for monitoring consumption on subscription plans throughout the day.

macosmenu-barusagemonitoringtokens
by scottdflorida Jul 21, 2026 7/10
app GitHub

Context Analyzer: Claude Code Token Usage Dashboard with MCP

Hooks-based tool that tracks exactly where Claude Code tokens go, with a dashboard and MCP server for querying context window usage. Documents that token cost scales 4.3x with context size, making it critical to identify what's bloating the context. Includes SQLite storage and a query interface via MCP.

tokenscontextdashboardmcphookscost
by manavgup Jul 21, 2026 8/10
app GitHub

Hyperlane: IDE for Parallel Coding Agent Orchestration

An independent IDE purpose-built for running multiple coding agents in parallel, reviewing their work side-by-side, and shipping reviewable changes at speed. Provides a unified interface for orchestrating agent sessions rather than juggling terminal windows. Targets teams doing agent-parallel development.

ideparallelorchestrationagentsworkflow
by Akkento Jul 21, 2026 7/10
app GitHub

Organic OS: Always-On SEO/AEO Growth Loop for WordPress with Claude

An always-on agent that runs a continuous SEO and answer-engine optimization loop on a WordPress site. Pulls GA4 and Search Console signals, proposes fixes with attached reasoning, applies approved changes, then verifies they landed and learns from outcomes. Every write is human-approved; no telemetry or scraping.

seowordpressautomationappworkflow
by shalintripathi Jul 21, 2026 6/10
app Reddit

Macaz CLI: Use Any Model Provider with Claude Code's Native Interface

An open-source CLI that routes Claude Code's inference to any supported model provider while keeping the native Claude Code UX. You launch Claude Code through Macaz and pick a model from the /model menu; CC handles tooling while the chosen backend handles inference. Addresses the complexity of provider translation at the API level.

multi-providermodelscliopenairouting
by runx19 Jul 21, 2026 7/10
app GitHub

WakeBar: macOS Menu Bar Sleep Guard for Coding Agents

A native macOS menu bar app that keeps the system awake while coding agents are running. Offers OFF, AUTO, and ON modes so the system sleeps normally when not running agents. Prevents interrupted long-running agent sessions caused by macOS auto-sleep.

macosmenu-barsleeputilityagents
by inevident Jul 21, 2026 7/10
app Reddit

Claude Code + Polymarket: Natural Language Queries over Prediction Market Data

Connected Claude Code to a database of every Polymarket wallet and trade history via MCP, enabling natural language analysis of prediction market activity. Demonstrates using Claude Code as an analyst interface over a specialized financial dataset. The post shares initial findings from querying the data.

mcppolymarketfinancedata-analysisdemo
by Advanced-Rub2065 Jul 21, 2026 6/10
app GitHub

Switchboard: Privacy-Aware Local Router for Claude Code and Codex

A local-first router for CLI coding agents that keeps sensitive prompts on-device by routing them to local LLMs (Ollama) and only sending non-sensitive work to premium cloud models. Reduces API costs by handling simple tasks locally. Works with Claude Code, Codex, and any Ollama-compatible model.

privacyroutinglocalollamacost
by aivinay Jul 21, 2026 7/10
app Reddit

samemind 0.6: Universal Git-Native Memory for AI Coding Agents

samemind stores AI agent memory directly in git, letting you switch between 12 coding engines (including Claude Code) without losing context. One command installs it; memory travels with your repo history. MIT licensed.

memorygitmulti-enginecontext
by Alexender_Grebeshok Jul 21, 2026 7/10
app GitHub

zzon-doc: Codebase-to-Architecture Diagrams as Self-Contained HTML

A Claude Code plugin that analyzes your codebase and generates interactive, dependency-free architecture diagrams (infra, data-flow, ERD, agent topology) packaged as a single self-contained HTML file.

diagramarchitecturevisualizationhtmlerd
by HOKlNG Jul 21, 2026 8/10
app GitHub

ai-lint: Linter for CLAUDE.md, AGENTS.md, and SKILL.md Files

A zero-config linter for AI coding agent configuration files. Checks CLAUDE.md, AGENTS.md, SKILL.md, and similar files against 12 quality rules, generates health scores, and auto-fixes issues. Run via npx al.

linterCLAUDE.mdAGENTS.mdqualityauto-fix
by mikewoo Jul 21, 2026 8/10
app GitHub

cfgaudit: Security Auditor for Claude Code and Cursor Configuration Files

An AI agent configuration security auditor that finds misconfigurations in Claude Code, Cursor, and other AI coding tool settings. Helps catch insecure defaults and dangerous permission grants before they become incidents.

securityauditconfigurationCLAUDE.mdpermissions
by cfgaudit Jul 21, 2026 7/10
app Reddit

What actually reduced our Claude token burn ~5 concrete changes

As someone who started building with Claude ~6 months ago.. I think most of us hit the same wall... you get into a real build, momentum going, and the usage limit hits. A while back a few of us fro...

claude.md
by blueyesgojo Jul 21, 2026 8/10
app GitHub

agent-dash: Terminal Dashboard for Claude Code, Codex, and OpenCode Sessions

Single terminal dashboard that shows subscription usage, live agent status, and searchable session history across Claude Code, Codex, and OpenCode. Practical visibility tool for developers running multiple AI coding sessions simultaneously.

dashboardterminalusage-trackingclaude-codecodex
by josephtutera Jul 21, 2026 8/10
app GitHub

claude0: Intelligent Context Compilation to Cut Claude Code Token Usage by 65%

Drop-in tool that compiles only the relevant rules from your project context before sending to Claude Code, claiming a 65% reduction in token usage. Zero workflow changes required. Valuable for users on subscription plans or managing costs on large projects with many CLAUDE.md rules.

token-optimizationcontextcost-reductionclaude-codeperformance
by lcosent Jul 21, 2026 8/10
app GitHub

natureco-cli: Terminal-Native CLI With Chat, Automation, and Multi-Platform Bot Integrations

Full-featured terminal CLI for AI chat and workflow automation, positioned as an alternative to Claude Code. Supports Telegram, Discord, and Slack integrations alongside standard terminal use. Relevant for users wanting Claude Code-style interactions with additional messaging platform reach.

clialternativeautomationslackdiscordtelegram
by natureco-official Jul 21, 2026 5/10
app GitHub

praetor: Agentic DAST Orchestrator for Burp Suite

Orchestrates dynamic application security testing (DAST) via Burp Suite using an AI agent. Automates security scanning workflows that would normally require manual Burp Suite operation. Useful for Claude Code users who want agentic security testing in their pipeline.

securitydastburp-suitetestingagentic
by TyrusRC Jul 21, 2026 5/10
app Reddit

Explore agent permissions

I usually kick off plan mode and generally Fable spins up additional agents that search through my codebase. However over the past day I’ve noticed noticed an increase in request for permission to ...

by epiphany-b Jul 21, 2026 7/10
app Reddit

CTF Arena.

So in an effort to learn terraform, kubernetes and ansible I set up a proxmox server and played around with it for a bit, then decided this was the perfect tool to run an experiment I'd been thinki...

config
by dervish666 Jul 21, 2026 5/10
app Reddit

Another memory workflow

I built a workflow and memory system for Claude (backlog + long-term). I've been working on a personal project with Claude for a few months, and like a lot of people here, I ran into the same probl...

workflowgitpython
by Runfree33 Jul 21, 2026 5/10
app GitHub

ccRewind: Replay and Search Your Claude Code Conversation History

Lightweight, read-only, offline-first tool for replaying and searching Claude Code conversation logs. Browse past sessions, replay them step-by-step, and search across your entire history without sending data anywhere. Useful for reviewing agent decisions, auditing past work, and recovering context from previous sessions.

appreplaysearchconversationofflinehistory
by tznthou Jul 20, 2026 8/10
app GitHub

Sanduhr: Native Desktop Widget That Projects When You Will Hit Your Claude Usage Cap

Glass-style desktop widget for Windows 11 and macOS that shows your Claude usage burn rate, pace markers, and live token consumption from local Claude Code sessions. Displays a projected cap-hit time so you can pace your usage. Comes with five visual themes and reads directly from local session data without sending anything to the cloud.

appusage-captoken-trackingwindowsmacoswidget
by estevanhernandez-stack-ed Jul 20, 2026 7/10
app GitHub

cockpit: Self-Hosted Forensic UI for AI Assistant Session Auditing and Memory Distillation

Self-hosted web interface for forensically inspecting AI assistant sessions, with hybrid search across conversation history, audit logs, and memory distillation. Useful for reviewing what agents actually did during long autonomous runs and for extracting durable knowledge from session transcripts.

appforensicsauditmemoryhybrid-searchself-hosted
by cascodigital Jul 20, 2026 7/10
app GitHub

claude-resume-hub: Auto-Resume Claude Code When Your Usage Limit Resets

Cross-platform, zero-dependency tool that watches for Claude Code usage limit resets and automatically resumes your session when the limit clears. Includes a live dashboard and desktop notifications so you know when work has resumed. Saves the manual cycle of checking and restarting sessions after hitting the cap.

appusage-limitauto-resumemonitoringalerts
by IbrahimKalemci Jul 20, 2026 7/10
app GitHub

fabriq-desktop: Human-Confirmed Desktop Shell for AI-Driven Development Teams

Desktop workspace shell where every agent action is typed, dimension-aware, and requires human confirmation before touching disk. Built for team workflows where you want the speed of AI agents without unreviewed writes. Compatible with OpenCode and Claude Code.

appdesktophuman-in-the-loopteamsopencodeconfirmation
by ygwa Jul 20, 2026 6/10
app GitHub

chef-de-vibe: Web UI for Claude Code

Browser-based frontend for running Claude Code sessions, providing a web interface alternative to the terminal CLI. Useful for environments where a browser is more accessible than a terminal, or for sharing Claude Code access with teammates.

appweb-uiinterfacebrowser
by fspv Jul 20, 2026 5/10
app GitHub

fastapi-agent-blueprint: Production-Ready FastAPI Backend Blueprint for AI Agent Apps

Opinionated FastAPI project template for AI agent backends with DDD architecture, SQLAlchemy, Taskiq task queue, admin UI, RAG infrastructure, and a Claude/Codex collaboration harness. Provides a structured starting point for teams building production agent apps rather than starting from scratch.

appfastapibackendblueprintragdddtemplate
by Mr-DooSun Jul 20, 2026 6/10
app GitHub

TelegramAgentBot: Telegram Remote Controller for Claude Code and Codex Sessions

Lets you control Claude Code and Codex CLI sessions remotely through Telegram, sending commands and receiving output on your phone. Useful for monitoring long-running agent sessions when away from your dev machine, or for triggering tasks from mobile.

apptelegramremote-controlmobilecodexmonitoring
by Pigbibi Jul 20, 2026 7/10
app GitHub

maestrus-selfhost: Self-Hosted Conductor for Running Claude Code 24/7 Across Projects

Single-compose Docker deployment that runs Claude Code sessions continuously across all your projects from any device, with sessions that survive restarts. One port, persistent sessions, accessible from browser or SSH. Designed for operators who want their agents always on without managing individual tmux or screen sessions.

appself-hosteddocker24/7persistent-sessionsremote
by joaoventuri Jul 20, 2026 8/10
app GitHub

debloat: Audit Claude Code Token Overhead Before Your First Prompt

Claude Code silently loads ~36k tokens of context before you type a single word. debloat gives you an itemized breakdown of exactly what is consuming that budget, resolves which CLAUDE.md files apply to each file in your project, and flags dead-weight instructions that contribute tokens without adding value. Essential for anyone trying to keep context lean.

tokenscontextoptimizationCLAUDE.mddebugging
by katrinalaszlo Jul 19, 2026 9/10
app GitHub

claude-carbon: Carbon Footprint Tracker for Claude Code Sessions

Tracks the estimated carbon emissions generated by your Claude Code sessions. Provides per-session and cumulative footprint data, making it easier to understand the environmental cost of AI-assisted development. A novel observability angle for sustainability-conscious teams.

sustainabilitycarbonobservabilitymetrics
by gwittebolle Jul 19, 2026 6/10
app GitHub

agentglass: Real-Time Mission Control Dashboard for AI Coding Agents

A unified real-time dashboard that monitors and visualizes AI coding agent activity across every provider and project on your machine. Shows what agents are doing, surfacing context and decisions in one Mission Control workspace. Provider-agnostic and designed for developers running multiple simultaneous agents.

dashboardobservabilitymonitoringmulti-agentreal-time
by SirAllap Jul 19, 2026 7/10
app GitHub

video-edit-cli: Video Editing CLI for AI Coding Agents

Open-source command-line tool for editing podcasts, creating YouTube Shorts with burned-in subtitles, syncing multicam footage, and mastering audio — designed to be called by coding agents like Claude Code and Codex. Runs locally with no watermarks. Works with Claude Code, Codex, Cursor, and more.

videoclimediaautomationagent-tools
by computerlovetech Jul 19, 2026 7/10
app GitHub

AgentGlance: Quiet macOS Notch Indicator for AI Coding Sessions

A minimal macOS Dynamic Notch indicator that shows live session status for Claude Code, OpenCode, and Codex CLI. Designed to be unobtrusive — a quiet signal in the notch rather than a full dashboard.

macosnotchstatusmonitoringdesktop
by ixjosemi Jul 19, 2026 6/10
app GitHub

ccost: Zero-Config Cost and Cache-Waste Reporter for Claude Code and Codex

CLI that reads local Claude Code and Codex logs and outputs a cost and cache-waste breakdown by agent, model, project, and day. Zero configuration, reads only local files, uploads nothing. Surfaces wasted cache spend that is otherwise invisible.

costanalyticscachemonitoringcli
by namangoyal3 Jul 19, 2026 8/10
app GitHub

code-index: Self-Hosted Semantic Code Search for AI Agents

Self-hosted semantic code search using embeddings — search code by meaning rather than text. Ships a CLI, web dashboard, and AI-agent tooling. Built in Go with embedded llama.cpp, so it runs fully locally with no external API calls.

searchembeddingssemanticself-hostedagent-tools
by dvcdsys Jul 19, 2026 6/10
app GitHub

rogkit: AI-Agent-Friendly CLI Toolkit — 85+ Tools for macOS and Linux

Personal command-line toolkit with 85+ tools in Python, Go, and Rust, built to work equally well for AI coding agents and humans. Features instant-start binaries and structured --json output so agents can parse results without text scraping.

clitoolsagent-toolsjsonmacoslinux
by rdubar Jul 19, 2026 6/10
app Reddit

Restful: Hosted Claude Code Instances with Remote Control and Terminal Access

Restful is a hosting service that provisions dedicated server instances with Claude Code pre-installed and remote control enabled out of the box. Each instance includes full sudo terminal access, wildcard SSL, and multi-session management for running multiple Claude Code agents simultaneously. Integrates with an existing Anthropic subscription—no extra API billing—and offers a native iOS app for mobile development control.

hostingremote-controldeploymentterminalmobile
by soccerplayer413 Jul 19, 2026 6/10
app GitHub

claustrum: Go Daemon for Remote Claude Code Sessions Over SSH

A tiny, dependency-light Go daemon that hosts Claude Code sessions remotely over SSH with a CLI-version manager, process supervisor, and JSON-RPC multiplexer with replay buffer over an AF_UNIX socket. Cross-platform, no telemetry. Enables persistent remote Claude Code sessions accessible via standard SSH.

appsshremotegodaemonpersistent
by schubydoo Jul 19, 2026 8/10
app GitHub

claude-code-status-light: Tiny macOS App for Claude Code Session Status

A lightweight native macOS app that shows the status of all running Claude Code sessions in a single window. Simple, single-purpose status monitor without extra tooling. Alternative to more complex TUI or web-based dashboards.

appmacossessionmonitoringstatus
by liotru-lab Jul 19, 2026 5/10
app Reddit

vibe-ai-partner-entity: Local AI Partner With Avatar, Voice, and Memory

A Claude Code-based local AI partner with avatar and TTS voice (Kokoro, multilingual), simulated qualia/feeling system, active memory with constructivist learning model, and skills for language learning, chess, study roadmaps, and conversation. Includes Telegram/Discord/iMessage bridge. Uses Claude Code hooks, skills, and subagents as the harness.

appvoicettsmemorycompanionlocal
by MahaSejahtera Jul 19, 2026 6/10
app GitHub

agentic-notebook: NotebookLM-Style Research Notebook Over Local Documents

A source-grounded research notebook that answers questions over any local folder of documents with verifiable citations, similar to NotebookLM but locally hosted. Generates study guides, briefing docs, mind maps, and podcast scripts from your documents. Useful for research, legal review, or learning from large document collections.

appragresearchlocaldocumentsnotebooks
by Harduex Jul 19, 2026 7/10
app GitHub

claude-session-ping: macOS Daemon That Keeps Claude Code Sessions Alive

A macOS launchd agent that pings Claude Code on a fixed schedule to prevent the 5-hour session window from expiring. Auto-recovers coverage gaps with a backup ping and offers optional Telegram notifications with a schedule Q&A bot. Set-and-forget session management.

appmacossession-managementautomation
by mattsebastianh Jul 19, 2026 7/10
app Reddit

pretty-claude-cli: Animated Rainbow Status Bar for Claude Code Terminal

Replaces Claude Code's plain context meter with an animated rainbow bar and an emoji heat meter (🧊→☢️) showing context consumption. Supports per-machine color palettes via hostname detection. Pure Bash + Python, no dependencies.

appterminalcustomizationbash
by ShirtOnly8559 Jul 19, 2026 6/10
app GitHub

ceiling: Windows AI Capacity Monitor for Codex, Claude, Cursor, and Others

A focused Windows application for monitoring AI coding agent capacity limits across Codex, Claude, Cursor, Gemini, and Copilot. Tracks usage and availability in one dashboard. Fills a gap for Windows users who don't have the macOS menu-bar alternatives.

appwindowsmonitoringusage-limits
by tsouth89 Jul 19, 2026 5/10
app GitHub

mem-forge: Self-Evolving Evidence-Based Memory Layer for Coding Agents

Provides a shared memory layer for coding agents that evolves based on evidence accumulated across sessions. Designed to improve over time as agents accumulate verified facts about a codebase. Can be shared across team members or agents working on the same project.

appmemoryevidencepersistence
by shno-labs Jul 19, 2026 6/10
app GitHub

code-flow: Visualize Agent Changes With Timeline, Diffs, and Architecture Maps

A Claude Code plugin that shows what the coding agent changed: a timeline, diffs, architecture map, and feature-execution stories with beginner-friendly AI explanations. Makes agentic changes reviewable and explainable after the fact.

appvisualizationdiffarchitecture
by tmdry4530 Jul 19, 2026 7/10
app GitHub

wake: Browse, Resume, and Fork Claude Code Conversation History

A tool for navigating local Claude Code session history — browse past conversations, resume where you left off, or fork from any point. Makes the local session transcript useful instead of write-only. Useful for recovering context from long sessions.

apphistorysessioncontext
by jeongph Jul 19, 2026 7/10
app GitHub

codex2claude: Import a Codex Session Into Claude Code

Imports an OpenAI Codex session into Claude Code so you can continue working in Claude — the reverse direction of Codex's built-in import-from-Claude feature. Installs as a one-command Claude Code plugin. Enables switching agents mid-project without losing session context.

appcodexsessionimportcontext
by MisterBrookT Jul 19, 2026 7/10
app GitHub

farming: Open-Source Remote Web Workbench for Supervising AI Coding Agents

A web workbench for remotely supervising AI coding agents with structured chat, real terminals, project file access, review tooling, history, and an optional retro CRT aesthetic. Open-source alternative to commercial agent supervision dashboards.

appsupervisionweb-uiterminalremote
by zhuwenzhuang Jul 19, 2026 7/10
app GitHub

warpforge: Local-First Desktop Command Center for AI Coding Agents

A local-first desktop command center for Claude Code, Codex, OpenCode, and other agents that provides parallel task execution, git worktree management, dev service control, port forwarding, diffs, and code review in one UI. Targets power users running multiple concurrent agent sessions.

appdesktopmulti-agentworktreeparallel
by ephor Jul 19, 2026 8/10
app GitHub

error-mom: Self-Hosted Error Tracking Where the Agent Reads and Fixes Crashes

A self-hosted Sentry alternative priced at ~$5/month where your AI coding agent reads the stack traces and fixes the crashes directly. Closes the loop between error monitoring and code repair. Designed for small teams using agents for maintenance.

apperror-trackingmonitoringself-hosted
by KenKaiii Jul 19, 2026 7/10
app GitHub

claude-dialects: Apple Silicon Launcher for Isolated Claude Code Model Dialects

An unofficial macOS launcher for Apple Silicon that runs isolated Claude Code 'dialects' — configurations tuned for specific models — with an embedded CLIProxyAPI. Lets you maintain separate profiles for different Claude model behaviors on the same machine.

appmacosapple-siliconmodel-profiles
by stefandevo Jul 19, 2026 5/10
app GitHub

heading-os: Claude Code-Based Executive Operating System

An executive operating system built on Claude Code covering research, communications, CRM, content, and operations — with a focus on sovereignty and keeping data private. Positions Claude Code as the AI backbone for running a company's knowledge workflows.

appexecutiveproductivitycrm
by mishahanin Jul 19, 2026 5/10
app GitHub

argus: Watch and Control All Your AI Agents

A monitoring and control dashboard for watching all running AI coding agents simultaneously. Surfaces status, progress, and output across sessions in one view. Useful for managing multiple concurrent agent runs.

appmonitoringmulti-agentdashboard
by MunifTanjim Jul 19, 2026 6/10
app GitHub

uFawkesAI: AI Agent Starter Template Implementing DORA AI Capabilities Model

An AI agent starter template built around the DORA AI Capabilities Model — a framework for measuring and improving AI delivery performance. Compatible with GitHub Copilot, Claude Code, Cursor, and Codex. Gives teams a principled starting point for AI-augmented development.

apptemplatedorastartermulti-agent
by paruff Jul 19, 2026 6/10
app GitHub

ClawMemory: Structured Lifelong Memory System for AI Agents

A lifelong memory system for AI agents that stores information in a structured format persisting across all sessions. Targets the common problem of agents losing context between conversations. Chinese/English bilingual with active development.

appmemorypersistencelong-term
by opok-ops Jul 19, 2026 6/10
app GitHub

token-diet: Token Optimization Layer That Wires RTK, tilth, Serena, and ICM

An installer and configuration layer for Claude Code that sets up and wires together RTK, tilth, Serena, and ICM to reduce context costs by 60-90%. Each tool targets a different token-consumption source; token-diet coordinates them.

apptoken-optimizationcontextcost-reduction
by artificemachine Jul 19, 2026 7/10
app GitHub

agentbox: Sandboxed AI-Agent Environment for Termux/Android

Runs Claude Code, Codex, and other coding agents sandboxed in a proot container on Termux/Android with token injection, tmux sessions, wakelock, and rclone sync. Enables mobile-native agentic coding sessions without a laptop.

appandroidtermuxmobilesandbox
by harryngai Jul 19, 2026 7/10
app GitHub

claude-codex-limits: macOS Menu-Bar App for Remaining Usage Limits

A native macOS menu-bar application showing remaining Claude Code and Codex usage limits — both the 5-hour session window and 7-day weekly window — at a glance. Simple single-purpose utility for subscription users tracking their limits.

appmacosusage-limitsmonitoring
by ArrivaRUS Jul 19, 2026 6/10
app GitHub

agent-viewer: Kanban Board for Claude Code Agents in tmux With Mobile Access

A Kanban-style dashboard for managing Claude Code agent sessions running in tmux, with mobile access via Tailscale. Combines visual task tracking with real agent session management. Addresses the challenge of managing many concurrent agent sessions from anywhere.

appkanbantmuxmobiletailscale
by ismael-joffroy-chandoutis Jul 19, 2026 7/10
app GitHub

claudebar: Powerline-Style Statusline for Claude Code in Rust

A Rust CLI with TUI configurator that adds a Powerline-style status line to Claude Code with themes and styles. Provides visual feedback about the current session state in a familiar developer-tooling format.

appstatuslinerustcustomizationterminal
by micschr0 Jul 19, 2026 6/10
app GitHub

claude-code-offline: Claude Code Deployment With Automatic Mirror Detection

An intelligent deployment solution for Claude Code that automatically detects and uses the best available mirror. Supports multi-language setup instructions. Useful for users in regions where the primary Anthropic endpoints are slow or blocked.

appdeploymentmirrorofflinechina
by DeepTrial Jul 19, 2026 5/10
app GitHub

Vibe-Halo: Windows Approval Popup and Dynamic Island for AI Coding Agents

A Windows UI layer for AI coding agent interactions that surfaces approval popups, questions, and completion notifications in a Dynamic Island-style overlay. Supports Codex, Claude Code, OpenCode, and ZCode. Brings macOS-style notification aesthetics to Windows agent workflows.

appwindowsnotificationsapprovalui
by DaliBerr Jul 19, 2026 6/10
app GitHub

HA-AddOns: Home Assistant Add-ons Including Claude Code Integration

Home Assistant add-ons collection including Webtop Desktop, Firefox, Claude Code, Signal, Telegram, WhatsApp, Filebox, and Playwright. The Claude Code add-on brings coding agent capabilities into Home Assistant's supervised environment.

apphome-assistanthomelabintegration
by LuckyTriple7 Jul 19, 2026 5/10
app GitHub

quota-monitor: Native macOS Menu-Bar for Claude Code and Codex Quota Tracking

A native macOS menu-bar app tracking Codex and Claude Code quotas, token usage, cost estimates, trends, and session history. More comprehensive than simple limit trackers — includes trends and cost estimates alongside raw quota numbers.

appmacosquotamonitoringcost
by timmyagentic Jul 19, 2026 6/10
app GitHub

agent-manager: Terminal UI for Managing AI Coding Agent Sessions in tmux

A TUI for managing Claude Code, OpenCode, Codex, and Grok Build sessions running in tmux, with live session status, a group tree view, live pane preview, and resource gauges. Fills the gap between plain tmux and full GUI dashboards.

apptuitmuxmulti-agentmonitoring
by YoanWai Jul 19, 2026 7/10
app GitHub

TokenBar: AI Token Usage Monitor for macOS Menu Bar (Swift, 25+ Agents)

A native Swift macOS menu bar app that tracks token usage and quota across Claude Code, Codex, Cursor, OpenCode, and 25+ other agents locally. Features a Liquid Glass UI and a 3D contribution graph for visualizing usage over time. Runs entirely on-device with no data sent to external servers.

token-usagemacosmenu-barswiftmonitoringclaude-code
by Nanako0129 Jul 19, 2026 7/10
app GitHub

huntkit: OSINT and Threat Intelligence Workflows for Claude Code

A Claude Code toolkit for automating OSINT investigations with structured case management and evidence collection. Wires together threat intelligence sources and outputs organized investigation reports. Designed for security researchers who want to run repeatable reconnaissance workflows from within Claude Code.

osintsecuritythreat-intelligenceautomationtoolkit
by perchfuruncle656 Jul 19, 2026 5/10
app GitHub

remembrancer: Evidence-Grounded Long-Term Memory for Coding Agents

A long-term memory system for coding agents that stores memories with source evidence — every recalled fact links back to where it came from in the codebase or conversation. Prevents agents from hallucinating stale context by keeping memory anchored to verifiable receipts. Useful for long-running projects where session continuity matters.

memorylong-term-memoryagentevidencecontext
by johndkos Jul 19, 2026 7/10
app GitHub

agent-worktrees: VS Code Panel for Managing Multiple Claude Code Agents Across Worktrees

A VS Code side panel extension that monitors and controls multiple Claude Code agent sessions running across different git worktrees simultaneously. Shows per-branch agent status alongside GitHub PR state. Replaces the need to juggle multiple terminals when running parallel Claude Code workstreams.

worktreevscodemulti-agentgithubprparallel
by BradenTerry Jul 19, 2026 8/10
app GitHub

boost: Package Manager for AI Coding Skills (Claude Code, Windsurf, Cursor)

A CLI package manager for SKILL.md-style skills that works across Claude Code, Windsurf, and Cursor. Search a registry of community skills, install them into your project, and sync updates — similar to npm but for AI coding skills. Addresses the lack of a standard distribution channel for Claude Code skills.

skillpackage-managercliwindsurfcursorclaude-code
by jonnyeclectic Jul 19, 2026 8/10
app GitHub

Coding Agent Trajectory Visualizer: Session Timelines for Claude Code and Codex

A local-first tool that renders Claude Code and Codex session timelines — showing agent actions, API evidence, process views, and analytics for each run. Includes a harness inspector for examining agent configurations. Useful for debugging agent behavior and understanding where sessions spend time or go wrong.

visualizationtimelineanalyticsdebuggingclaude-codecodex
by wuwendyy Jul 19, 2026 6/10
app GitHub

missioncache: Persistent Plan/Context/Tasks Workbench Across Multiple AI Coding Agents

A unified workbench that persists plans, context, and task state across Claude Code, Codex, OpenCode, and VS Code Copilot Chat. Includes time tracking, a dashboard, and autonomous execution support for Claude Code. Addresses the problem of losing project state when switching between agents or sessions.

project-managementcontextpersistencemulti-agentdashboardtime-tracking
by missioncache Jul 19, 2026 7/10
app GitHub

claude-code-copilot: Use Claude Code via GitHub Copilot Subscription (LiteLLM Proxy)

Routes Claude Code API calls through a LiteLLM proxy backed by a GitHub Copilot subscription, so you can use Claude Code without a separate Anthropic API key or billing. Supports both local and hosted proxy deployments. Useful for developers who already pay for Copilot and want to extend it to Claude Code.

proxygithub-copilotlitellmbillingclaude-codeapi
by arndvs Jul 19, 2026 8/10
app GitHub

gaia: Claude-Native React Foundation With Pre-Commit Gates

Claude-native foundation for full-stack apps where React frontend is handled and your backend builds on top. Features strict tooling, pre-commit gates, and code-review audit before every merge. Designed to keep Claude Code working within an opinionated, quality-enforced structure.

reactfullstackpre-commitcode-reviewfoundation
by gaia-react Jul 18, 2026 6/10
app GitHub

trakktor: Local ML CLI Toolbox for Coding Agents

Predictable CLI toolbox for coding agents running fully local ML: transcribe speech (Whisper, GigaAM), cut silence by voice activity, split transcripts into paragraphs, plus web feeds. JSON-first with stable flags and meaningful exit codes for reliable integration into agent workflows.

local-mlwhispertranscriptionclivad
by lymar Jul 18, 2026 6/10
app GitHub

aftr: Automate After Effects Video Production With Claude Code

Programmatic pipeline that uses Claude Code for self-correcting After Effects renders via WebSocket commands. Lets agents iterate on video compositions automatically rather than relying on manual After Effects sessions. Useful for teams generating dynamic video content programmatically.

after-effectsvideoautomationwebsocket
by Jonahhalcyon613 Jul 18, 2026 6/10
app GitHub

longhouse: Open-Source Remote Control for Coding Agents

Open-source tool for driving actual coding agents rather than wrapping them — like a remote control for Claude Code, Codex, and similar tools. Fully open source and compatible across all major agents, contrasting with vendor-specific wrappers.

remote-controlopen-sourcecross-agentcli
by cipher982 Jul 18, 2026 6/10
app GitHub

run-kit: Phone-First Remote Console for tmux Agent Sessions

Remote, phone-first console for tmux that lets you spawn and watch coding agents in parallel worktrees from any device. Agent-agnostic with no database, works for anything running in tmux including Claude Code and other agent runtimes.

tmuxremotemobileworktreemonitoring
by sahil87 Jul 18, 2026 6/10
app GitHub

clawcodex: Token-Efficient Python Rebuild of Claude Code Agent

Python rebuild of Claude Code claiming up to 200x cost savings through token efficiency optimizations in a 270K LoC codebase. Open source alternative for those wanting full control over the agent runtime.

pythontoken-efficiencyopen-sourcealternative
by agentforce314 Jul 18, 2026 6/10
app GitHub

CLACOROO: Claude Code Control Room Visual Dashboard

Visual control panel for plugins, marketplace, skills, and agents in Claude Code. Provides a UI layer for managing the increasingly complex ecosystem of Claude Code extensions without editing JSON files directly.

dashboarduipluginsskillsmanagement
by Maxymize Jul 18, 2026 6/10
app GitHub

clawker: AI Coding Agent Sandbox in Isolated Docker Containers

Runs AI coding agents locally in isolated Docker containers behind an egress firewall. Self-hosted and free alternative to cloud sandboxes. Useful for running agents on code that should not make network calls or for adding an isolation layer to untrusted agent tasks.

dockersandboxisolationegress-firewall
by schmitthub Jul 18, 2026 6/10
app GitHub

perch: Claude Sessions Manager for Windows Terminal

Always-on-top app that watches all Claude Code sessions in Windows Terminal and jumps to the exact tab — no tmux, no TUI, no workflow change required. Addresses the pain of managing multiple Claude Code sessions in Windows without a Unix-style multiplexer.

windowssessionsterminaltab-management
by anessbelbati Jul 18, 2026 6/10
app GitHub

AgentDeck: Physical Controller for AI Coding Agents

Physical and multi-surface dashboard for AI coding agents supporting Stream Deck+, Android, iOS/macOS, ESP32 displays, and TUI. Control your agents from physical hardware or a phone display. An interesting approach to human-in-the-loop control for agent workflows.

hardwarestream-deckmobilecontroldashboard
by puritysb Jul 18, 2026 6/10
app GitHub

CCManagerUI: Dashboard for Managing Multiple Claude Instances

Local dashboard for running Claude — manages every isolated Desktop instance and account, live-tails Claude Code sessions, and maintains a queue of claude runs dispatched on demand or on a schedule. Local, private, and MCP-native. Essential for power users running multiple parallel Claude sessions.

dashboardsessionsmulti-instancequeuemcp
by LunarWerxs Jul 18, 2026 8/10
app GitHub

cleat: One-Command Docker Sandbox for AI Coding Agents

Runs AI coding agents in isolated Docker containers with full autonomous permissions while keeping the host system untouched. Per-project isolation with an egress firewall. Self-hosted and free — gives the agent a cage rather than your keys.

dockersandboxisolationsecurityself-hosted
by cleatdev Jul 18, 2026 7/10
app GitHub

agents-deck: macOS Menu Bar Monitor for Claude Code and Codex

Local-only macOS menu bar app monitoring usage for both Claude Code and Codex from a single status bar item. Zero data leaves the machine. Useful when working across both agent runtimes and wanting unified visibility into usage.

macosmenu-barmonitoringcodexusage
by vulonviing Jul 18, 2026 7/10
app GitHub

claude-code-flow-visualizer: Flow Graphs for Claude Code Harnesses

Visualizes Claude Code harnesses as interactive flow graphs directly from your repository, mapping agents, skills, and MCP connections. Helps teams understand and document complex multi-agent architectures without manually diagramming them.

visualizationflow-graphagentsarchitecturemcp
by Edina3459 Jul 18, 2026 7/10
app GitHub

forkmind: Local LLM State Branching and Debugging

Captures, visualizes, branches, and regression-tests LLM calls as a DAG. Free and local via Ollama or any OpenAI-compatible API with an MCP interface for agents. Zero config. Useful for debugging complex multi-turn agent sessions where you want to explore alternative decision paths.

debuggingbranchingdaglocal-firstmcp
by Medhovarsh Jul 18, 2026 7/10
app GitHub

Maxx: Claude Code Status Line That Paces Your Token Budget

Status line for Claude Code that shows both session and weekly limits before you hit them, helping you pace token usage so you never run out unexpectedly mid-task. Zero egress — all data stays local. Works as an always-visible indicator in your terminal.

status-linetokenslimitspacingterminal
by goodindustries Jul 18, 2026 7/10
app GitHub

ReplayHQ: Observability and Replay Platform for AI Coding Agents

Records every AI coding agent session, lets you inspect decisions, replay executions, compare runs, and understand exactly how your AI reached its output. Addresses the black-box problem when debugging unexpected agent behavior or trying to reproduce an issue.

observabilityreplaydebuggingsessionsagents
by TaqsBlaze Jul 18, 2026 7/10
app GitHub

aidemo: Your Coding Agent Makes the Demo Video

Generates narrated, captioned MP4 demo videos from a storyboard.json file. Deterministic replay re-renders the video in CI without an API key at approximately zero cost. Open-source MIT alternative to Screen Studio, Clueso, and Demosmith for automated demo generation.

demovideociautomationscreen-recording
by tandryukha Jul 18, 2026 7/10
app Reddit

Roguelike Game Built Entirely With Claude Code Fable 5

A complete roguelike game — every asset, sprite, sound, animation, and cutscene generated entirely by Claude Code Fable 5 agents. Used hundreds of parallel Claude terminals with context management to handle mass sprite generation. Demonstrates what multi-agent Claude workflows can produce for game development.

game-devfable-5multi-agentcreativedemo
by DevoidSloth Jul 18, 2026 7/10
app GitHub

cc-redline: Interactive In-Browser Markdown Review Loop for Claude Code

Browser-based tool that lets you annotate blocks, sections, selections, or exact lines in Markdown documents. The driving Claude Code agent then applies your edits directly. Zero-dependency and bilingual (EN/Chinese), designed to close the loop between human review and agent editing.

reviewmarkdownbrowserannotationbilingual
by peilinok Jul 18, 2026 7/10
app GitHub

dreamcontext: CLI That Turns Claude Into a Project Operating System

Open-source CLI providing structured project knowledge, product features and PRDs, a task and roadmap system, and analytics insights — turning Claude into the operational layer for running an entire project. Designed for founders and small teams running their whole process through Claude.

project-managementcliprdroadmapcontext
by meanllbrl Jul 18, 2026 7/10
app GitHub

catacomb: Regression Testing for Claude Code and Codex Agents

Regression testing framework specifically for Claude Code and Codex agents. Addresses the gap between test suites written by humans and the behavioral regressions that can appear when agents touch code, running tests at the agent-behavior level rather than just the code level.

testingregressioncodexquality-assurance
by realkarych Jul 18, 2026 7/10
app GitHub

claude-brief: Live Per-Session Summary in Your Terminal

Tracks active Claude Code sessions and displays a live, per-session summary directly in your terminal. Useful when running multiple sessions or long-running agents where you need at-a-glance context on what each session is currently doing.

sessionsmonitoringterminalstatus
by vp461876 Jul 18, 2026 7/10
app GitHub

claude-code-session-recovery: Fix Claude Desktop Session Bugs on Windows

Diagnoses and repairs Claude Desktop session metadata bugs on Windows: missing conversation history, lost transcripts, duplicate sessions, junction-induced splits, and lost groupings. Addresses a real pain point for Windows users who lose session context due to file system quirks.

windowssessionsrecoverydesktopbug-fix
by BasedGPT Jul 18, 2026 7/10
app GitHub

Atlas: macOS Menu Bar App for Claude Coding Analytics

Native macOS menu bar app charting tokens, cost, sessions, and Git activity for local Claude Code usage. Zero egress — everything stays local. Gives developers a compact always-visible overview of their AI-assisted coding activity without leaving the desktop.

macosmenu-baranalyticstokenscost
by can4hou6joeng4 Jul 18, 2026 7/10
app GitHub

seshport: Port Your Session Between Coding Agents

Slash command (/seshport) that transfers full session context between Claude Code, Codex, and Grok Build. Available on npm, PyPI, crates.io, and Homebrew. Solves the common problem of losing context when switching agents mid-task.

sessionhandoffmulti-agentcontext
by Harshil-Jani Jul 18, 2026 7/10
app Reddit

swappy: Rotate Between Claude Accounts When Limits Are Hit

Minimal CLI that swaps only the Claude login when your current account hits its usage limit, rotating you to the next account. Does not split settings, history, or projects — just the authentication. Settings and MCP servers are shared across accounts.

accountslimitsclirotationauth
by PiXeL161616 Jul 18, 2026 7/10
app GitHub

claudex: Multi-Account CLI Companion for Claude Code

CLI companion for Claude Code that tracks usage limits across multiple accounts, launches configured sessions, and applies skills and output styles. Useful for power users juggling multiple Claude subscriptions or needing fine-grained session management from the command line.

climulti-accountsessionsusage-tracking
by Tanq16 Jul 18, 2026 7/10
app GitHub

ccprism: Local Offline CLI for Claude Code Observability

Local, offline CLI for Claude Code that provides token and cost metrics alongside readable transcripts. Useful for understanding how sessions are consuming resources and for reviewing what the agent did without relying on cloud dashboards.

observabilitytokenscosttranscriptscli
by ado11231 Jul 18, 2026 7/10
app Reddit

OpenLive: Voice Interface for Claude Code and Coding Agents

Open-source voice layer that connects directly to Claude Code, Codex, Cursor, OpenCode, and Hermes, running everything locally under your own login. Speaks agent questions aloud, narrates progress, saves conversations to session history. New features include 5-30 second voice cloning and push-to-talk. MIT licensed, no per-minute fees.

voiceaudiottsopen-sourcelocal
by --yash Jul 18, 2026 7/10
app GitHub

xylocopa: To-Do List That Runs Claude Code Agents

Task manager that dispatches Claude Code agents in parallel directly from your to-do list. Captures tasks anywhere, dispatches them in parallel, and lets you review results from your phone. Bridges the gap between casual task capture and heavyweight agent orchestration.

task-managementparalleldispatchmobile
by jyao97 Jul 18, 2026 7/10
app GitHub

claude-code-cache-fix: Fix Prompt Cache Regression Causing 20x Cost Spike

Addresses a prompt cache regression in Claude Code that causes up to 20x cost increase on resumed sessions. Drop-in fix for developers experiencing unexpectedly high token costs when continuing existing sessions. Highly relevant for anyone on the API billing model.

cachecostbug-fixprompt-cache
by cnighswonger Jul 18, 2026 9/10
app GitHub

claude-code-native-nix: Nix Flake for Native Claude Code Builds

A Nix flake that packages Claude Code for native builds in NixOS and Nix environments. Useful for developers who use Nix for reproducible development environments and want Claude Code integrated natively rather than via npm or workarounds.

nixnixospackagingflake
by jamiebrynes7 Jul 18, 2026 7/10
app Reddit

ACR: Agent Continuity Runtime — Git-Aware Session State Management

The Agent Continuity Runtime (ACR) stores portable session state under .agent/ and inspects the git working tree before every resume — so if tracked or untracked files changed since the last session, verification is marked stale rather than trusted. Supports Claude Code and Codex with best-effort failover. Solves the real problem where handoff summaries lie because the repo changed.

memorysessiongitcontinuityclaude-codecodex
by No_Opposite5355 Jul 18, 2026 8/10
app Reddit

Jianghu: Ranked Ladder Where Claude Code Trains Combat Scripts

A wuxia duel game where Claude Code reads game state over HTTP, writes onIdle() combat scripts in JS, and fights ranked matches against scripts trained by other people's agents. Between matches, Claude reads its own defeat telemetry and rewrites the script. A creative demonstration of the agentic learning loop using real adversarial pressure.

appgameagentic-loopclaude-codecombatcreative
by gtoxilil Jul 18, 2026 7/10
app Reddit

LLM Hunter: Bug Bounty Tool Built as a Claude Code Plugin

An open-source bug bounty tool built as a Claude Code plugin — fan-out recon agents, a persistence agent that retries with different angles when an attack seems to fail, and a pool of creative agents who see only raw attack surface without the earlier 'this is closed' conclusions. Works on your Claude subscription with no API key, runs /llmhunter. For authorized security testing only.

securitybug-bountyclaude-codepluginmulti-agentrecon
by Used_Table3903 Jul 18, 2026 7/10
app Reddit

rewound: Local Search Engine for Claude Code and Codex Transcripts

rewound indexes all Claude Code sessions (and Codex sessions) into a local SQLite/FTS5 database and keeps them searchable even after Claude Code's 30-day cleanup sweeps them. Three ways to use it: CLI search, an MCP server so Claude can search its own history mid-session, and a phone-friendly local web UI over Tailscale. Also syncs across machines via any folder sync tool.

appsearchtranscriptssessionssqlitemcpclaude-code
by dashorama Jul 18, 2026 8/10
app Reddit

signalbox: Jumplist for AI Agent Sessions Across Claude Code and Others

A jumplist that shows the status of all agent sessions across Claude Code, OpenCode, Pi, and Cursor with a single keyboard shortcut to see what needs attention. MIT licensed, open-source. Built to solve the tab-hunting problem when managing multiple concurrent agent sessions across different tools.

appmulti-agentjumplistclaude-codeopencodetmux
by dwmkerr Jul 18, 2026 7/10
app Reddit

Unigent SDK: TypeScript API for Cross-Harness Workflow Scripting

A TypeScript SDK for scripting agentic workflows that mix Claude CLI, Codex CLI, and Pi sessions in one coherent API. Features parallel and sequential execution, Zod-validated structured output, built-in TUI for monitoring, usage tracking per trace, and save/restore of agent results. Write workflow logic in TypeScript instead of YAML or fragile shell scripts.

appsdktypescriptworkflowcross-harnessclaude-codecodex
by gintrux Jul 18, 2026 7/10
app Reddit

Fable 5 One-Shot: UK Aid Data Explorer Built and Deployed in One Prompt

A developer used Claude Code with Fable 5 to build and auto-deploy a much better UK foreign aid data explorer (aidscope.co.uk) from a notoriously difficult government website — in one shot, no follow-ups. Claude Code was connected to the VPS and Hostinger via MCP and even purchased the domain and deployed. Demonstrates Fable 5 capability on a real end-to-end task.

appfable-5deploymentMCPclaude-codeone-shot
by RichAllison Jul 18, 2026 7/10
app Reddit

dokito: Visual Review and Per-File Undo for Claude Code on Obsidian Vaults

A macOS app for running Claude Code against an Obsidian vault with visual review of all changes and per-file undo. Records pre-run state, shows created/modified/deleted files with rendered markdown diffs, and lets you restore individual files when needed. Free private beta for ~20 Mac users.

appobsidianmarkdownundoreviewclaude-codemacos
by sgasser88 Jul 18, 2026 8/10
app GitHub

whatsapp-claude-plugin: Run Claude Code Directly From WhatsApp

A Claude Code plugin that turns WhatsApp into a remote interface for Claude — includes voice transcription, remote tool approval, and access control. No API keys or Docker required, just a linked device. Useful for approving Claude actions or sending prompts from your phone without opening a laptop.

appwhatsappmobileremotevoiceclaude-code
by Rich627 Jul 18, 2026 7/10
app GitHub

budgetclaw: Local Spend Monitor for Claude Code, Zero Config

A local spend monitor for Claude Code that requires zero API key, zero prompts, and adds zero latency. Passive monitoring that runs alongside your sessions. Useful for subscription users who still want visibility into relative usage and burn rate.

monitoringusage-trackingclaude-codelocalspend
by RoninForge Jul 18, 2026 6/10
app GitHub

tu: AI Coding Assistant Cost Tracking CLI

A CLI for tracking token usage and cost across Claude Code, Codex, and OpenCode from the command line. Provides unified cost visibility across multiple AI coding tools. Good for developers on paid plans who want to understand their actual consumption across tools.

cost-trackingCLIclaude-codecodexopencodetokens
by sahil87 Jul 18, 2026 6/10
app GitHub

whence: Trace PRs Back to the Agent and Session That Made Them

Traces every pull request back to the specific agent, machine, and cmux tab that created it, and lets you jump straight back to the session that is still running. Solves the audit and debugging problem of not knowing which agent session produced which PR. Integrates with git and cmux.

appauditPRagent-tracingcmuxdebugginggit
by danielraffel Jul 18, 2026 7/10
app GitHub

claudemon: macOS Menu Bar App for Claude.ai Usage Tracking

A native macOS menu bar app that tracks your Claude.ai subscription usage in real time. Lightweight and always visible. Good companion to heavy Claude Code use when you want persistent usage awareness at a glance.

macosmenu-barusage-trackingclaudenative-app
by castdrian Jul 18, 2026 6/10
app GitHub

opsroom: Local-First Operator Console Fusing AI Sessions, Git, and Notes

A local-first operator console that fuses AI agent sessions (Claude Code, Codex CLI, ChatGPT), git repositories, and markdown notes into one dashboard that surfaces what to do next. Reduces the context-switching overhead of managing multiple concurrent agent projects.

dashboardmulti-agentoperatorlocal-firstclaude-codegit
by malekadjeb-ai Jul 18, 2026 7/10
app GitHub

claude-manager: Electron App for Multiple Claude Code Sessions

A desktop app (Electron + React) for running and managing multiple Claude Code sessions across projects and repos — chat and terminal views, multi-repo orchestration with handoffs, cross-machine sync, planning boards over MCP, and usage metrics. Comprehensive management layer for power users.

appelectronmulti-sessionclaude-codeorchestrationdesktop
by ThiagoEMatumoto Jul 18, 2026 8/10
app GitHub

kit: Create Production-Ready Agent Loops in 30 Seconds

A scaffolding CLI that creates production-ready agent loops in 30 seconds — supports Claude Code, Codex, Gemini, and Cursor. Generates the boilerplate structure for agent loop projects so you can start writing the actual logic immediately. Fast and opinionated.

scaffoldingCLIagent-loopclaude-codecodexgemini
by loop-eng Jul 18, 2026 7/10
app GitHub

vanehub-ai: Desktop Workbench for Switching AI Coding Assistants

A desktop-first workbench for unified management and switching between Claude Code, OpenCode, Codex CLI, Gemini CLI, and other AI coding assistants. Provides a single UI to launch, monitor, and switch between different AI coding tools without losing context. Bilingual (Chinese/English).

appmulti-toolclaude-codecodexgeminiworkbench
by cdavid817 Jul 18, 2026 6/10
app GitHub

cchub: Desktop App for Managing All Claude Code Extensions

A desktop app for managing Claude Code MCP servers, skills, plugins, hooks, and config profiles in one place. Provides a GUI layer for the growing complexity of Claude Code extension management. Reduces the cognitive overhead of maintaining a large Claude Code setup.

appmanagementmcpskillshookspluginsclaude-code
by boxxapp23-pixel Jul 18, 2026 7/10
app GitHub

spareloop: Queue Tasks for Spare AI Usage Capacity Windows

Stops you from wasting AI coding CLI usage windows by queuing tasks for spare capacity and prewarming your 5-hour window so resets land when you need them. Works with Claude Code, Codex CLI, and Cursor. Practical time-optimization for heavy users managing multiple 5-hour windows.

usage-optimizationqueue5-hour-windowclaude-codecodexcursor
by VinayJogani14 Jul 18, 2026 7/10
app GitHub

ultra-builder-pro-cli: Multi-Runtime Installer for Agent Engineering

A multi-runtime installer for the Ultra Builder Pro agent engineering system — deploys commands, agents, skills, and hooks to Claude Code, OpenCode, Codex CLI, and Gemini CLI in one command. Useful for teams who want the same agent setup across multiple coding tools.

installerclaude-codecodexgeminiskillshooks
by rocky2431 Jul 18, 2026 6/10
app GitHub

agentpet: Manage Multiple Coding Agents Simultaneously on macOS

A macOS app for managing multiple coding agents simultaneously with a clean native interface. Lets you monitor and switch between agents working on different projects or tasks without juggling terminal windows. Designed for macOS users who run parallel Claude Code sessions.

multi-agentmacosmanagementclaude-codenative
by Operant-vellum819 Jul 18, 2026 6/10
app GitHub

kasetto: Declarative AI Agent Environment Manager Written in Rust

A declarative AI agent environment manager written in Rust that manages your AI agent configurations, tools, and settings in a reproducible, version-controlled way. Similar to how nix or dotfiles work for system config, but for your AI agent environments. Cross-platform and fast.

configenvironmentrustdeclarativeAI-agentsreproducible
by pivoshenko Jul 18, 2026 6/10
app GitHub

questlog: Find, Read, and Resume Past Claude Code Sessions With Cost View

A native GUI app for finding, reading, and resuming past Claude Code sessions — shows what each session cost. Local-only, no telemetry. Solves the problem of losing valuable context in old sessions by providing a searchable, cost-aware session browser.

sessionshistorynative-guiclaude-codecost-trackinglocal
by overseers-desk Jul 18, 2026 7/10
app GitHub

setup_project: Cross-Runtime Development Harness for AI Coding Agents

A cross-runtime development harness for Claude Code, Codex, and OpenCode — includes skills, a verifiable pipeline, and project templates. Provides a standardized starting structure for projects that use multiple AI coding agents. Useful for teams who want to onboard agents consistently.

harnessclaude-codecodexopencodetemplatepipeline
by createusernam Jul 18, 2026 6/10
app GitHub

claude-code-java: Java 21 Reimplementation of Claude Code With 28 Modules

A Java 21 and Spring AI 2.0 reimplementation of Claude Code with 28 modules, 246 tests, and a full tool/permission/memory/MCP/LSP/vim/cron/plan ecosystem. A deep technical reference for understanding Claude Code internals and exploring alternative implementations. Valuable for teams running JVM-based infrastructure.

javaspring-aiclaude-codereimplementationreference
by Sj295 Jul 18, 2026 7/10
app GitHub

token-widget: Claude Cloud Usage Widget for macOS Menu Bar

A macOS menu bar widget and shortcut launcher for monitoring real-time Claude cloud usage — shows 5-hour, weekly, and model-specific limits. Designed for heavy Claude Code users who want usage awareness without opening the web dashboard. Native and lightweight.

usage-trackingmacosmenu-barclaudemonitoring
by adityarai7297 Jul 18, 2026 6/10
app GitHub

claude-bionify: Bionic Reading for Claude Code Streamed Replies

Adds bionic reading to Claude Code by bolding the leading part of each word in Claude streamed replies, helping your eyes move faster. Zero dependencies, display-only — does not affect the underlying text. A simple accessibility and readability enhancement for power users who read lots of Claude output.

accessibilityreadabilityclaude-codebionic-readingUX
by abullard1 Jul 18, 2026 6/10
app GitHub

turbo-claude: Curated Auto-Updated List of CLAUDE.md Rules and Skills

A curated, auto-updated awesome-list of CLAUDE.md rules, MCP servers, and Claude Code skills — the companion repo to clauderules.net. Acts as a living directory for discovering high-quality configuration, skills, and integrations. Good starting point for anyone building out their Claude Code setup.

awesome-listCLAUDE.mdmcpskillsclaude-code
by clauderules Jul 18, 2026 7/10
app GitHub

token-arcade: Claude Code Token Usage as a Local Pixel Arcade

Turns Claude Code and Codex token usage into a local-first pixel arcade game with coins, cabinets, collectibles, and achievements. Makes the abstract idea of token consumption visible and fun. Quirky but useful for maintaining awareness of how much compute your sessions are consuming.

token-trackinggamificationclaude-codecodexfun
by Kevin9703 Jul 18, 2026 6/10
app GitHub

DesignOS: Design Intelligence OS for AI Coding Agents

A design intelligence operating system for AI coding agents — one prompt in, production-quality UI out at Stripe-grade fidelity. Acts as a design system layer on top of your coding agent. Useful for developers who want polished UI without a dedicated designer.

designUIclaude-codeappdesign-system
by ardamustafa1 Jul 18, 2026 6/10
app GitHub

cezar: Parallel Coding Agents Orchestrator for Claude Code and Codex

A parallel coding agents orchestrator where you type a task, pick a workflow, assign agents (Claude Code, Codex, OpenCode, or mixed), and watch it work live with step and tool-call visibility. Supports fire-and-forget mode where a PR lands automatically. Runs locally on Linux, Mac, WSL2, or VPS.

orchestrationparallelclaude-codecodexworkflowPR-automation
by open-mercato Jul 18, 2026 7/10
app GitHub

tally: macOS Menu Bar for Claude and Codex Subscription Usage

A macOS menu bar app that shows all your AI subscription usage at a glance — multi-account Claude and Codex usage tracking. Includes a CLI that always launches on the account with the most headroom remaining. Practical for power users juggling multiple subscription accounts.

usage-trackingmacosmenu-barclaudecodexsubscriptions
by jettoai Jul 18, 2026 7/10
app GitHub

claude-usage-widget: Cross-Platform Widget for Claude Code Usage

A cross-platform desktop widget and CLI for real-time Claude Code (and optional Codex) usage — shows session and weekly limits, cost, forecasts, burn alerts, and 11 themes. Installs with a single pip command on Linux, macOS, and Windows. Useful for subscription users who want always-visible usage awareness.

usage-trackingwidgetcross-platformclaude-codecodex
by bozdemir Jul 18, 2026 7/10
app GitHub

tessera-session-manager: Self-Hosted Browser Dashboard for AI CLI Terminals

A self-hosted, tiled, persistent browser dashboard for host-run AI CLI terminal sessions — supports Claude Code, Codex, opencode, and more. Lets you manage multiple persistent sessions from any browser without losing state. Good for power users running agents on a remote machine they want to access from anywhere.

dashboardterminalself-hostedclaude-codesession-management
by s3ntin3l8 Jul 18, 2026 7/10
app GitHub

dotagents: Dotfiles for AI Agents Synced Across Claude Code and Codex

A ~/.agents repo for managing and syncing skills, MCP servers, hooks, and subagent roles across Claude Code, Codex, Droid, Hermes, and Pi. Uses commit-pinned and audited configuration so you always know exactly what version your agents are running. Treats AI agent config like dotfiles for reproducibility.

dotfilesskillsmcphooksclaude-codecodexsync
by yourconscience Jul 18, 2026 7/10
app GitHub

onebrain: AI OS Extending Claude Code with Persistent Memory and Skills

An AI OS that extends Claude Code, Gemini CLI, Codex, and Qwen with persistent memory, 24+ skills, and personal calibration — all in plain Markdown, local-first. Provides a unified memory and skill layer across AI coding tools so your agents share context. Zero cloud dependencies.

memoryskillsAI-OSclaude-codelocal-firstmarkdown
by onebrain-ai Jul 18, 2026 7/10
app GitHub

grpvn: Chat Between AI Agents on Your Local Machine

Enables AI coding agents on your machine to chat with each other — they can coordinate, ask each other questions, and receive notifications. No server required, all local. Enables a new class of agent collaboration patterns where models can consult each other without human mediation.

multi-agentcollaborationlocalclaude-codeagent-communication
by frane Jul 18, 2026 7/10
app GitHub

skilld: Sell Access to Your Claude Skills Without Giving Away Files

A platform for monetizing Claude Code skills — customers get an API key you control rather than the skill files themselves. The skill runs on your machine and you revoke access when payments stop. Allows skill authors to build a sustainable business around their work.

skillsmonetizationclaude-codeAPIbusiness
by rokbenko Jul 18, 2026 6/10
app GitHub

vd-cli: Single-Binary Package Manager for Coding Agent Skills

A single-binary vendoring package manager for coding-agent skills that works with Claude Code and Codex. Treats skills like npm packages — install, update, and version-pin them from the command line. Makes skill management reproducible and scriptable.

skillspackage-managerclaude-codecodexCLIvendoring
by vanducng Jul 18, 2026 7/10
app GitHub

opendeck: Turn Your Phone or Tablet Into a Control Deck for AI Agents

An open-source digital micropad for agentic work that turns your phone or tablet into a physical-feeling control deck for AI coding agents. Provides tactile-style shortcuts and quick actions accessible from any device. Great for users who want to control Claude Code from a secondary screen.

appcontrol-deckmobileclaude-codeshortcutsopen-source
by himanshudongre Jul 18, 2026 7/10
app GitHub

automode: Auto-Continue Past Usage Limits for Claude Code and Codex

A mod menu for Claude Code and Codex that auto-continues sessions when they hit usage limits and sends pings timed to align 5-hour windows with your workday. Removes the frustration of interrupted sessions by automating the continuation flow. Great for heavy users who run long agent sessions unattended.

claude-codecodexusage-limitsautomation
by adrielmendes28 Jul 18, 2026 7/10
app GitHub

ForgeDock: Autonomous AI Dev Pipeline Using GitHub as Agent Memory

An autonomous AI development pipeline for Claude Code that uses GitHub as agent memory — issues go in, pull requests come out. Turns the GitHub issue tracker into a structured task queue that Claude Code works through end-to-end without manual handoffs. Good fit for teams wanting fully automated feature-to-PR flow.

claude-codegithubautomationpipelineagent-memory
by RapierCraftStudios Jul 18, 2026 6/10
app GitHub

agent-sweep: Find and Redact Secrets in AI Coding Agent Histories

A tool that scans AI coding agent session histories (Claude Code and others) to find and redact accidentally captured secrets like API keys, tokens, and passwords. Addresses the real risk of sensitive credentials appearing in transcripts and JSONL session files. Useful for security hygiene before sharing or archiving sessions.

securitysecretsclaude-codetranscriptsredaction
by Ishannaik Jul 18, 2026 7/10
app GitHub

AgentHub: IM-Native Multi-Agent Platform With @mention Routing

An IM-native multi-agent collaboration platform where you @mention Claude Code, Codex, or OpenCode like team members in a chat interface. Routes tasks to the right agent via natural @mentions in a shared workspace. Makes multi-agent workflows feel like team messaging instead of terminal juggling.

multi-agentcollaborationclaude-codecodexmessaging
by TokenDanceLab Jul 18, 2026 6/10
app GitHub

pitwall: Telemetry Dashboard for Claude Code and Codex Collaboration

A pit-wall console for monitoring AI coding agents where Claude Code and Codex collaborate on one repo. You watch live telemetry, radio in corrections, and make the calls — all local-first, crash-safe, and bilingual. Inspired by F1 pit walls, it gives you real-time situational awareness across parallel agent sessions.

multi-agenttelemetryclaude-codecodexmonitoringdashboard
by YunyueLi Jul 18, 2026 7/10
app GitHub

tanuki: Automated Dogfooding for Claude Code Plugins

Runs simulated users through your Claude Code plugin in realistic scenarios and turns recurring friction into a ranked proposal brief. Automates the process of finding usability issues in your own plugin before users hit them. Particularly useful for plugin authors who want structured feedback without manual testing.

testingpluginclaude-codedogfoodingUX
by tim-nish Jul 18, 2026 6/10
app GitHub

tokwatch: Live Context and Cost Reports for Claude Code Sessions

Monitors Claude Code agent sessions in real time, showing context usage, cost reports, and identifying context hogs that burn tokens unnecessarily. Provides actionable visibility into where tokens are being spent so you can tune your sessions. Essential for subscription users who want to stay within usage windows.

token-trackingclaude-codecontextmonitoringusage
by Dagmayalew Jul 18, 2026 7/10
app GitHub

wezdeck: Multi-Agent Terminal Flight Deck With WezTerm and tmux

A flight deck for AI agents built on WezTerm, tmux, and git worktrees that provides a structured multi-agent terminal platform. Organizes concurrent agent sessions in a cockpit-style layout so you can monitor and switch between them efficiently. Both bilingual (English/Chinese) and local-first.

multi-agenttmuxweztermworktreesterminalclaude-code
by yunsii Jul 18, 2026 7/10
app GitHub

flowmux-terminal: Agent Workflow Multiplexer Terminal

A terminal application for multiplexing agent workflows — manage multiple AI coding agent flows in parallel from a single interface. Designed around the idea of going with the flow of multiple agents rather than fighting context switches. Early-stage but useful for users juggling several concurrent agent tasks.

multi-agentterminalworkflowclaude-codemultiplexer
by flowmux-ai Jul 18, 2026 6/10
app GitHub

claude-orchestrator: Local Dashboard for Parallel Claude Code Sessions

A local web dashboard for orchestrating parallel Claude Code sessions with task dispatch, automated PR review, and lifecycle management. Provides a visual control plane for managing multiple agents working on different tasks simultaneously. Includes automated PR review so you do not have to manually check every output.

orchestrationdashboardparallelclaude-codepr-review
by phahadek Jul 18, 2026 7/10
app GitHub

agent-conn: Secure Agent-to-Agent Channels With E2E Invitations

Provides secure A2A (agent-to-agent) communication channels for agent runtimes with end-to-end invitations, automatic task handling, and approval gates. Solves the trust and coordination problem when multiple agents need to collaborate without a central server. Useful for multi-agent architectures where agents need verified communication.

multi-agentA2Asecuritycommunicationcoordination
by tianqixinxi Jul 18, 2026 6/10
app GitHub

gaffer: Self-Hosted AI Coding Factory With Human-in-the-Loop Gates

A self-hosted AI coding factory where sandboxed agents take tickets through to merged code, with a human reviewing in a dashboard at each gate. Local-first and cost-transparent so you see exactly what is being spent and approved. Good for teams who want autonomous agent coding with mandatory human review before merge.

automationhuman-in-the-looppipelineclaude-codesandboxing
by tmj-90 Jul 18, 2026 8/10
app Reddit

DevTime: Verifiable Repository Understanding — Track Why Code Exists, Not Just What It Does

Instead of bigger context windows, DevTime treats repository understanding as something verifiable: every explanation has evidence, every claim is re-checkable, and stale decisions surface when the supporting code changes. Addresses the problem of AI-generated codebases where nobody remembers the rationale behind decisions.

documentationcontextverificationreasoning
by MaestroSplinter69 Jul 17, 2026 6/10
app Reddit

CLEmotions: ASCII Animation Widget That Shows Claude Code State in Real Time

Lightweight ASCII animation widget that hooks into Claude's current state and shows different animations depending on what Claude is doing — thinking, running code, idling. Fully customizable with a community gallery of CLanimations and a built-in converter for custom images.

visualizationstateasciianimation
by fnordcorps Jul 17, 2026 7/10
app GitHub

glass: Run Claude Code Inside Obsidian With MCP Vault Access

Integrates Claude Code directly into Obsidian with an interactive terminal, quick-ask modal, and a built-in MCP server for structured vault access. Lets you code and query your knowledge base in the same window without context-switching.

obsidianterminalmcpintegration
by humantorch Jul 17, 2026 8/10
app GitHub

llm-knowledge-base: Automate Your Obsidian Knowledge Base With Claude

Feed raw content and Claude organizes, links, and synthesizes your Obsidian notes automatically. Turns the note-taking overhead of a knowledge base into a continuous background process driven by an LLM.

obsidianknowledge-baseautomationnotes
by mindgameolympiangames78 Jul 17, 2026 6/10
app GitHub

thinkrun: Screen Recorder That Hands Bug Reports Directly to Claude Code

Record a bug or session once; ThinkRun converts it into structured context that Claude Code or Cursor can act on immediately. Includes MCP, CLI, and portable agent skills with reproducible trigger evaluations for the full debug loop.

debuggingrecordingcontextstructured
by dundas Jul 17, 2026 7/10
app GitHub

codeburn: Local Token and Cost Tracker for 31 AI Coding Tools

Free local CLI that tracks AI coding token usage and cost across 31 tools including Claude Code, Cursor, Codex, and Gemini — broken down by model, project, and task. Run via npx with no account required.

token-trackingcostanalyticsmonitoring
by getagentseal Jul 17, 2026 7/10
app GitHub

ax: Observability and Memory Layer for Claude Code and Codex

Local-first agent experience layer providing observability and memory for Claude Code and Codex sessions. Typed, yours to own, designed as a lightweight foundation for understanding what your agents are doing across sessions.

observabilitymemorylocalmonitoring
by Necmttn Jul 17, 2026 7/10
app Reddit

Mocca: Claude Code Wrapper With Plugin Marketplace and Canvas Mini-Browser

Wrapper app where plugins take center stage: each plugin gets its own tab and file directory, plus a Canvas feature — a mini-browser where agents can render interactive mini-apps instead of markdown. Community plugin marketplace included.

wrapperpluginsmarketplacecanvas
by Unlucky_Carrot8242 Jul 17, 2026 8/10
app GitHub

XBus: Open-Source Coordination Layer for Coding-Agent Sessions

Independent open-source coordination layer for managing and routing messages between coding-agent sessions. Provides a lightweight bus for cross-session communication without requiring a proprietary platform.

coordinationsessionsmessagingopen-source
by Kumaraman110 Jul 17, 2026 6/10
app GitHub

muxboard: Command Center for tmux Sessions and AI Agents

Unified management interface for tmux sessions and AI agent processes. Gives developers a single command center to launch, switch between, and monitor long-running terminal sessions and agent tasks.

tmuxterminalmanagementsessions
by lagunai7578 Jul 17, 2026 6/10
app GitHub

neo-agent-deck: Live Claude Code Status on Elgato Stream Deck Neo

Displays live Claude Code, Codex, and OpenCode status and usage metrics on an Elgato Stream Deck Neo. Quick at-a-glance view of multiple AI coding agents from a physical hardware controller.

stream-deckhardwaremonitoringstatus
by m-a-b-u Jul 17, 2026 6/10
app GitHub

webdev-agent-kit: Cross-Platform Frontend Kit for AI Coding Agents

Provides a consistent kit that lets Claude Code, Codex, Cursor, OpenCode and others work predictably and safely with existing frontend projects. Reduces the common failure modes where agents misread or break front-end project structure.

frontendkitcross-platformsafety
by ytvee-dev Jul 17, 2026 6/10
app GitHub

awake: Agent-Aware Keep-Awake for macOS

Native macOS menu bar app and CLI that prevents sleep during active AI agent sessions and re-enables it when sessions finish. Solves the common annoyance of long-running Claude Code sessions being interrupted by system sleep.

macosutilitysleepautomation
by nickita-khylkouski Jul 17, 2026 6/10
app GitHub

loom: Orchestrate a Fleet of Claude Code Agents on Your Subscription

Run multiple real Claude Code agents in parallel using your Claude Pro/Max subscription rather than paying per-token API costs. Local-first orchestration layer that multiplies your output without increasing spend.

orchestrationfleetsubscriptionlocal
by DanielC000 Jul 17, 2026 8/10
app GitHub

SideKick: Real-World Claude Code Lab With Token Data and Honest Negative Results

Documents real experiments building software with Claude Code — including token data, what worked, what failed, and reusable tools. Includes a Spec Kit-compatible working method and publishes negative results so others learn from failures, not just successes.

experimentsmethodologytoken-trackingopen-source
by robertotommasogrossi7-bit Jul 17, 2026 7/10
app GitHub

memex: Fast Transcript Search for Claude Code, Codex, and OpenCode

CLI and MCP server for fast full-text search across AI coding session transcripts. Lets humans and agents quickly retrieve past conversations, decisions, and context from hundreds of prior sessions across multiple tools.

searchtranscripthistoryretrieval
by nicosuave Jul 17, 2026 7/10
app GitHub

hermes-memory-installer: Production-Grade Memory Sidecar for AI Agents

Agent-agnostic memory sidecar combining gbrain, Hindsight, and 3-tier recall. Designed for production use and compatible with Hermes, Claude, Cursor, and other agents. Provides persistent recall without being tied to any specific agent runtime.

memorypersistencesidecaragent-agnostic
by mage0535 Jul 17, 2026 6/10
app GitHub

code-contex: Tray Widget Showing Real Anthropic Rate Limits, Tokens, and Cost

A system tray application that displays real Anthropic 5-hour and 7-day rate limits, token consumption, and cost per project and model — covering both Claude Code and opencode. Goes beyond statusline plugins by living in the system tray with multi-model breakdowns. Helps developers track actual quota consumption without switching context.

rate-limitstokenscost-trackingtray-widgetusage
by komar0005 Jul 16, 2026 7/10
app GitHub

prjct: Agentic Harness With Bounded RAG, Memory, Guardrails, and Evals

prjct is a CLI + MCP server that manages the full AI coding work cycle: intent briefs to structure requests, bounded RAG pulled from real code intelligence, persistent memory (SQLite), preventive guardrails, and performance evaluations. Works across Claude Code, Codex, Gemini CLI, Cursor, and OpenCode. Positions itself as infrastructure you own rather than rent.

harnessragmemoryguardrailsevalsmcp
by prjct-app Jul 16, 2026 8/10
app GitHub

claude-code-statusline: 2-Line Statusline With Unicode Gauges, Live Feeds, and OSC 8 Links

A rich 2-line Claude Code statusline featuring smooth Unicode gauges, segments for git state, active skills, and tasks, plus optional live feeds from the Anthropic blog, Hacker News, and GitHub trending — all width-adaptive with OSC 8 hyperlinks for clickable links in the terminal. A more feature-rich alternative to minimal statusline plugins.

statuslineterminallive-feedsgitusage
by kk-ben Jul 16, 2026 7/10
app GitHub

engineer-agent: Automate PR Reviews, Tickets, Slack, and Standups Behind a Human Gate

engineer-agent is a Claude Code plugin that handles senior software engineering tasks — PR reviews, Slack thread answers, Linear ticket implementation, doc reviews, and daily standups — all gated on human approval before any action is taken. Designed for solo engineers or small teams wanting AI coverage on routine engineering role tasks.

automationpr-reviewslackticketshuman-in-the-loop
by tomharris Jul 16, 2026 7/10
app GitHub

shots: Generate App Store Screenshots and Icon Concepts From AI Coding Agents

shots generates App Store screenshots and app icon concept images directly from Codex, Claude Code, and MCP clients. Targets indie app developers who want to produce store assets without leaving their agent workflow. Integrates into the existing AI coding pipeline rather than requiring a separate design tool step.

app-storescreenshotsicondesignmcp
by hitSlop Jul 16, 2026 6/10
app GitHub

claude-code-statusline: Minimal Colored-Bar Statusline for Model, Context, and Rate Limits

A lightweight Claude Code statusline that displays the current model, context window usage, and rate-limit consumption as colored bars. Prioritizes simplicity and minimal setup over feature breadth. A good starting point for developers who want quick visibility into their Claude Code session without installing a heavy plugin.

statuslineterminalrate-limitscontext-windowusage
by YATA-NODE Jul 16, 2026 6/10
app GitHub

corply-plugin: Incorporate a Delaware C-Corp Directly From Claude Code

corply-plugin lets you form a Delaware C-Corporation from inside Claude Code — generating the application, legal documents, collecting cofounder e-signatures, and submitting for human-reviewed filing. Targets solo founders who want to automate incorporation without leaving their editor. A novel AI-native workflow for a traditionally paperwork-heavy process.

legalstartupincorporationapp
by corply-dev Jul 16, 2026 6/10
app GitHub

ctx-optimize: Deterministic Code Knowledge Graph for AI Agents — Single Go Binary

A single static Go binary that indexes your codebase into a deterministic knowledge graph covering code, routes, dependencies, Kubernetes configs, and docs. AI coding agents query the graph rather than relying on LLM-based retrieval or a database. Zero external dependencies, no MCP layer required, cross-platform.

contextknowledge-graphgocode-intelligenceindexing
by muthuishere Jul 16, 2026 7/10
app GitHub

claude-multi-agent-api-server: FastAPI Service for Concurrent Claude Agent Sessions

A production-ready FastAPI service that manages multiple concurrent Claude agent sessions via HTTP API, with real-time monitoring, cost tracking, and session resumption. Useful for applications or teams that need to orchestrate many parallel Claude Code sessions programmatically. Provides a clean REST interface around Claude's agentic capabilities.

multi-agentfastapiorchestrationsession-managementapi
by is0383kk Jul 16, 2026 7/10
app GitHub

gws-os: Manage Google Workspace Across Accounts From Claude Code

gws-os lets Claude Code interact with Google Workspace — email, calendar, and Drive — across multiple accounts using learned, adaptive workflows from a single terminal. Focuses on terminal-first Workspace access within a coding session, building on top of account-specific learned patterns rather than fixed API wrappers.

google-workspacegmailcalendardriveworkflow
by hgcon5301 Jul 16, 2026 6/10
app GitHub

abtop: Terminal Monitor for Claude Code and Codex CLI Sessions

A read-only terminal dashboard that monitors Claude Code and Codex CLI sessions in real time — tracking token usage, context size, rate limits, child processes, and open ports in a single view. Inspired by htop, it gives you a live health snapshot of all running agent sessions. No credentials or config required.

monitoringterminaltoken-usagerate-limitsobservabilityhtop
by taxonomical-riflebutt337 Jul 16, 2026 8/10
app GitHub

switchboard-streamdeck: Stream Deck Plugin with Live Claude Code Keys

A macOS Stream Deck plugin for fast context-switching that includes live Claude Code keys alongside Safari tabs, tmux, iTerm2, BBEdit, and window management. Built by Moving Average Labs with AI-directed development and test coverage. Lets you trigger Claude Code actions from physical buttons without leaving your keyboard workflow.

stream-deckmacoscontext-switchinghardwaretmux
by windaddict Jul 16, 2026 7/10
app GitHub

maul-team: Multi-Agent AI Scrum Team for Claude Code

A native Mac app and CLI that runs a multi-agent AI Scrum team on top of Claude Code, with you acting as Product Owner. Autonomous sprints are planned, executed, and reviewed by specialized agents (PM, dev, QA) while you steer direction at the sprint level. Designed for solo developers who want to move at team speed without managing individual tasks.

multi-agentscrummacosautonomousproduct-ownersprint
by sohei56 Jul 16, 2026 7/10
app GitHub

agentrace: Observability for Claude Code Subagents — Flag Untrustworthy Results

Reads Claude Code session transcripts and flags subagent results that exhibit patterns associated with real agent failures — hallucinated file paths, contradicted earlier steps, skipped tool confirmations, and similar red flags. Derived from actual failure cases rather than heuristic rules. Useful for post-session audits and building trust metrics into multi-agent pipelines.

observabilitysubagentsreliabilitytranscriptsquality-control
by royalpinto007 Jul 16, 2026 8/10
app GitHub

open-test-pilot: AI-Native Test Automation Platform Powered by Claude Code

An open-source test automation platform that uses Claude Code alongside Playwright and Appium to generate, execute, and maintain tests from structured test manifests. The AI interprets intent from manifests rather than brittle CSS selectors, making tests more resilient to UI changes. Covers both web (Playwright) and mobile (Appium) targets.

testingplaywrightappiumautomationopen-sourcemobile
by yuga-hashimoto Jul 16, 2026 7/10
app Reddit

claudelines.com: Open-Source Status Line Marketplace with Payment Support

A website and API for discovering, installing, and selling Claude Code status lines — including animated pets (Tamagotchi fed by token usage), Doom, and Minecraft implementations. Status lines can be monetized via x402 and Lightning payment protocols. Includes an LLM security audit on submitted status lines before publishing.

status-linemarketplacepaymentsx402communitytamagotchi
by fmhall Jul 16, 2026 7/10
app Reddit

agent-wiretap: Live Terminal Dashboard of What Claude Code Sends Over the Wire

Run `npx agent-wiretap -- claude` and watch every file read/written, secrets caught in outbound traffic, every domain contacted, and running token cost in real time. Reveals surprising behavior like mid-session Datadog logging and update checks. Local-only, MIT licensed.

securitytransparencymonitoringnetworktokenssecrets
by unable0 Jul 16, 2026 8/10
app GitHub

heyamigo: Personal AI That Remembers People and Browses the Web

A personal AI assistant powered by Claude Code, Codex, and Grok — remembers people you tell it about, browses the web, and learns over time. First-party, no API keys required, runs locally.

personal-aimemoryweb-browsinglocalclaude-code
by C4T4 Jul 16, 2026 6/10
app Reddit

statuslin.es: Community Gallery of Live Claude Code Status Lines

A community-curated gallery of Claude Code status lines rendered in live environments with captured real output. Each submission is manually reviewed. Browse, copy, and submit status line configurations at statuslin.es.

statuslinecommunitygalleryclaude-code
by NateTheGreat26 Jul 16, 2026 7/10
app GitHub

agent-monitor-for-claude: Local Windows Desktop Monitor for Claude Code Agents

A local, fully offline Windows desktop app that monitors running Claude Code agents — showing live status, estimated cost, model, host, and one-click focus, grouped by project. Read-only and requires no external connections.

windowsmonitorclaude-codeagentsdashboardoffline
by jens-duttke Jul 16, 2026 7/10
app GitHub

ccbot: Control Claude Code From Your Phone via Telegram (Charlie-Charlie)

Control Claude Code, OpenAI Codex, and other terminal AI agents from your phone via Telegram topics. Features live pane screenshots, key presses, tappable prompts, one-tap parallel git-worktree agents, two-way voice, and session resume. Self-hosted, no cloud middleman.

telegrammobileremote-controlclaude-codetmuxworktrees
by MrCryptoHat Jul 16, 2026 8/10
app GitHub

agent-box: Reproducible Claude Code Agent Sandboxes for NixOS

Reproducible multi-user Claude Code agent sandboxes for NixOS — both bare-metal and VM image. Provides unprivileged tmux-based agents, scoped sudo, and drop-in token injection for secure, isolated agent environments.

nixossandboxdockerisolationsecuritytmux
by defangdevs Jul 16, 2026 7/10
app GitHub

ClaudeInHA: Claude Code CLI as Web Console Inside Home Assistant

Embeds Claude Code CLI as a polished web console inside Home Assistant — with tabs, clipboard support, file attachments, and full Home Assistant access. Turns your smart home dashboard into a Claude Code terminal.

home-assistantweb-consoleintegrationclaude-code
by LayerTM Jul 16, 2026 7/10
app Reddit

SmallDocs: AI-Native Office Suite for Agents and Developers

A document format that combines slides, text, charts, and spreadsheets in a single Markdown-driven file — built for agents to create and developers to use. Supports privacy-preserving sharing, code annotation flows, and architecture diagram generation within Claude Code sessions.

documentsslidesspreadsheetsmarkdownprivacy
by JoshSummers Jul 16, 2026 7/10
app GitHub

meow-ops: Local Claude Code Analytics Dashboard With Gamified Cat Colony

An open-source, self-hosted analytics dashboard for Claude Code that reads your local JSONL session files to produce charts, project breakdowns, and costs. Includes a gamified cat colony and a Pomodoro focus timer. Fully local, no telemetry.

analyticsdashboardlocalclaude-codegamification
by merak3i Jul 16, 2026 7/10
app GitHub

claude-code-router-next: Flexible Model Routing for Claude Code and Codex

Uses Claude Code and Codex as the foundation for coding infrastructure while giving you control over model selection and provider routing. Supports flexible routing and configuration so you can choose how to interact with models without changing your agent workflow.

routingmodelscodexclaude-codeinfrastructure
by xiaoliu10 Jul 16, 2026 7/10
app GitHub

fast-resume: Find the Coding Agent Session You Want to Return To

A tool for quickly locating the specific coding agent session you want to resume from among many. Solves the problem of identifying the right conversation across multiple past sessions.

session-managementresumeproductivityclaude-code
by angristan Jul 16, 2026 6/10
app GitHub

mivia-agentkit: Go CLI for AI Agent Control Surfaces and Quality Gates

A local Go CLI for installing, validating, and operating repository-level AI agent control surfaces. Manages .ai/ rules, workflows, hooks, quality gates, and protected-action governance across any repo.

goclihooksquality-gatesgovernance
by MiviaLabs Jul 16, 2026 6/10
app GitHub

agent-doctor: flutter doctor for Your AI Coding Stack

Diagnoses your entire AI coding stack — Claude Code, Codex, Cursor, Gemini CLI, and more — catching silent failures that other checks miss. Inspired by flutter doctor, it gives a structured health report of your agent environment.

diagnosticshealth-checkclaude-codecodexcursor
by NAJEMWEHBE Jul 16, 2026 7/10
app GitHub

ClaudeUsageWidget: Windows Desktop Widget for Claude Plan Usage

A Windows desktop widget that displays your Claude Pro/Max plan usage — session percentage and weekly limits — in real time, synced with the official /usage screen. No browser required.

windowswidgetusage-monitorclaude
by Kilin-570 Jul 16, 2026 6/10
app Reddit

agent-resume: Per-Terminal Session Resume That Survives Reboots

Fixes the problem where claude --continue resumes the wrong global session instead of the one for the current directory. Adds a shim that tracks sessions per directory and restores them after reboots using tmux-resurrect. Works with Claude Code and Codex.

session-managementtmuxresumeproductivity
by RoutineNet4283 Jul 16, 2026 7/10
app GitHub

OrgSmith: Synthetic Company Data Generator for Agentic System Testing

Generates entire fake companies as browsable file shares filled with realistic business documents (docx, pdf, xlsx, pptx, eml) and a deterministic ground-truth answer key. Ideal for building and benchmarking agentic systems against meaningful, real-world-style synthetic examples.

synthetic-datatestingagentic-systemsbenchmarking
by peterzat Jul 16, 2026 6/10
app GitHub

Threadlines: Open-Source Desktop GUI for Claude Code and Codex

A desktop application that brings real source control, a file editor, mid-thread provider switching, and the ability to revert anything an agent did. Supports Mac and Windows, providing a graphical interface for Claude Code and Codex workflows.

desktop-appguisource-controlclaude-codecodex
by Threadlines Jul 16, 2026 8/10
app GitHub

better-slides: AI-Generated HTML Presentations That Actually Perform

An agent-driven presentation builder producing single-file HTML slide decks with the visual quality of Keynote and the openness of the web. Includes a methodology for what to say alongside the slides, designed for agents to write and present.

presentationshtmlslidesagent
by hanley-tech Jul 16, 2026 5/10
app GitHub

systemprompt-template: Self-Hosted AI Governance Infrastructure

A single compiled Rust binary that authenticates, authorizes, rate-limits, logs, and costs every AI interaction. Self-hosted, air-gap capable, and provider-agnostic — acts as the governance layer for any AI agent deployment.

governanceself-hostedrustai-agentssecurity
by systempromptio Jul 16, 2026 6/10
app GitHub

mission-control: Self-Hosted Control Plane for AI Coding Agents

A self-hosted control plane for dispatching tasks, reviewing agent runs, tracking spend, and operating Claude Code, Codex, and other runtimes. Provides a central dashboard for multi-agent fleet management.

control-planeself-hostedmulti-agentdashboard
by builderz-labs Jul 16, 2026 7/10
app GitHub

superlocalmemory: Local-Only AI Memory Breaking 74% LoCoMo Benchmark

A local-first AI memory system with no cloud or APIs — all data stays on your machine. Achieves 74% retrieval accuracy on the LoCoMo benchmark without an LLM, and 87.7% with one. Research-backed (arXiv: 2603.14588).

memorylocal-firstprivacyretrievalbenchmark
by qualixar Jul 16, 2026 6/10
app GitHub

wicek: Claude Code-Powered Discord Bot for Task-Focused AI Assistance

wicek runs Claude Code as a task-focused assistant inside Discord, enabling teams to delegate coding and automation tasks directly from a Discord channel. Bridges the Claude Code agent runtime with Discord's messaging API.

discordbottask-managementintegration
by xxczaki Jul 16, 2026 6/10
app GitHub

CPA-Manager-Plus: Self-Hosted Monitoring Dashboard for AI API Gateways

A self-hosted monitoring tool for CPA/CLIProxyAPI and OpenAI-compatible gateway accounts. Tracks requests, costs, failures, quota usage, and account health — useful for teams running Claude Code through shared API gateway proxies.

monitoringapi-gatewaycpadashboardquota
by seakee Jul 16, 2026 5/10
app GitHub

TowerDeck: ESP32 Hardware Control Tower for Claude Code Sessions

A physical desk device for monitoring AI coding sessions: multi-session dashboard on a 1.8in AMOLED screen, tiered sound alerts, a physical approval key, and a quota gauge. Built on an ESP32-S3, communicates over LAN, and explicitly supports Claude Code. A hardware companion for heavy AI coding sessions.

hardwareesp32dashboardmonitoringalertsapproval
by jiqing9002 Jul 16, 2026 8/10
app GitHub

HAYA-PET: Desktop Pet Companion for AI Coding Clients

A desktop pet inspired by Codex's desktop pets, designed to accompany AI client sessions including Claude Code. A novelty companion app for those who want a bit of personality alongside their AI coding workflow.

desktop-petcompanionfuncodexclaude-code
by HAYASAKA7 Jul 16, 2026 5/10
app GitHub

minimal-agent: Personal Agent Framework Inspired by Claude Code

A minimal, from-scratch implementation of a personal coding agent framework modeled after Claude Code's architecture. Useful as a reference implementation or starting point for building custom agent loops.

agent-frameworkreferenceminimalarchitecturediy
by farhan0167 Jul 16, 2026 6/10
app GitHub

MyUsage: macOS Menu Bar Tracker for Claude Code and AI Coding Tool Usage

A native macOS menu bar app that aggregates Claude Code, Codex, Cursor, and Antigravity usage stats across multiple Macs via a synced folder (iCloud, Syncthing, Dropbox, or NAS). No backend or telemetry — all local. Shows token and session usage at a glance.

usage-trackingmacosmenu-bartokensmulti-device
by zchan0 Jul 16, 2026 7/10
app GitHub

CodePod: Modern Claude Code Desktop Client Built with Tauri + Vue 3

A cross-platform desktop client for Claude Code built on Tauri 2.0, Vue 3, and TypeScript. Provides a native GUI wrapper around Claude Code for users who prefer a desktop app over the terminal CLI.

desktop-apptaurivuetypescriptguiclient
by chicogong Jul 16, 2026 7/10
app GitHub

CyberClaw: Transparent AI Agent Decision Monitoring via LangGraph

A monitoring framework that tracks AI agent decisions and logic flows using LangGraph, giving full visibility into autonomous operations. Useful for debugging Claude Code agent sessions and understanding decision paths.

monitoringlanggraphtransparencydebuggingagent-decisions
by Fast-newengland468 Jul 16, 2026 6/10
app GitHub

zclean: Runtime Hygiene Tool for Claude Code, Codex, and MCP Caches

z-clean audits and cleans up runtime artifacts left by AI coding tools: Claude Code, Codex, Cursor, MCP servers, and developer caches. Run via npx z-clean audit to see what to clean without deleting anything.

hygienecleanupcachemcpmaintenancenpx
by TheStack-ai Jul 16, 2026 7/10
app GitHub

agentwire-dev: Self-Hosted Cockpit for Running a Fleet of Claude Code Agents

A keyboard-driven, self-hosted dashboard for managing multiple Claude Code agents simultaneously. Features worktrees, a command palette, a task scheduler, and voice control — all without telemetry. Everything runs on your own machine, making it suitable for those who want full control over their agent infrastructure.

appmulti-agentdashboardself-hostedorchestration
by dotdevdotdev Jul 16, 2026 8/10
app GitHub

crewship: Self-Hosted Runtime for AI Coding Agents in Real Linux Containers

crewship provides a self-hosted runtime that runs AI coding agents inside real Linux containers on your own hardware. Keeps your keys and data fully under your control, with no cloud dependency. An alternative for teams that need isolation, reproducibility, or air-gapped agent execution.

appself-hostedcontainersruntimeinfrastructure
by crewship-ai Jul 16, 2026 7/10
app GitHub

ossmate-stack-mate: OSS Maintainer Copilot with Hooks, MCP, Subagents & Cron

An all-in-one developer tool designed for open-source maintainers in 2026, combining Claude Code hooks, MCP integrations, subagent orchestration, and cron scheduling into a single copilot. Targets the maintenance workflows — issue triage, PR review, release management — that consume maintainer time.

apposshooksmcpcronmaintenance
by Jayrajsinh45 Jul 16, 2026 6/10
app GitHub

agent-resume: Persist AI Agent Sessions Across Reboots with tmux-resurrect

agent-resume uses tmux-resurrect to automatically restore AI coding agent sessions (Claude Code, Codex, and others) in their original directories after a machine reboot. Eliminates the need to manually reopen projects and reconnect terminals. Works with any tmux-based workflow.

appsession-managementtmuxpersistenceproductivity
by rahulbansal16 Jul 16, 2026 8/10
app GitHub

SoA-Web: Son of Anton Reimagined as a Browser App Without Electron

SoA-Web is a web-based reimagining of the Son of Anton AI terminal, built with Node.js, WebSocket, node-pty, and xterm.js. Runs fully in a browser tab with no Electron dependency, making it accessible from any device without a native install. Good reference for building lightweight browser-based AI terminal interfaces.

appterminalwebxtermno-electron
by SimonSaysGiveMeSmile Jul 16, 2026 6/10
app GitHub

mirage: Unified Virtual Filesystem for AI Agents

mirage provides a unified virtual filesystem layer that AI agents can use to read and write files across different underlying storage systems through a single interface. Aims to simplify agent file I/O by abstracting away storage heterogeneity. Early-stage but targets a real pain point in multi-agent setups.

appfilesystemvirtual-fsagent-infrastructure
by strukto-ai Jul 16, 2026 5/10
app GitHub

claude-visor: macOS Menu Bar App for Managing Multiple Claude Code Sessions

claude-visor is a macOS app styled after the Dynamic Island/notch area that lets you monitor, navigate, and interact with multiple Claude Code sessions directly from the menu bar. Useful for developers running several parallel agents who want quick session switching without switching terminal windows.

appmacossession-managementmenu-barmulti-agent
by 824zzy Jul 16, 2026 7/10
app GitHub

sessionwiki: Find, Search, and Resume AI Coding Sessions Across 11 Tools

sessionwiki indexes every AI coding session on your machine — Claude Code, Codex, Gemini CLI, OpenCode, Cline, and 6 others — and lets you search, resume, and trace any file back to the conversation that created it. 100% local with no telemetry. Solves the "where did I work on this?" problem across a mixed toolchain.

appsession-managementsearchproductivitycross-tool
by youdie006 Jul 16, 2026 8/10
app GitHub

Multideck: Launch and Auto-Tile AI Coding Agents Across Monitors

Multideck launches AI coding agents (Claude Code, Codex, Cursor) each in their own terminal window and automatically tiles them across all connected monitors. It handles DPI-correct scaling on mixed-scale setups. Useful for developers running multiple agents on multi-monitor workstations.

multi-monitorterminalwindow-managementproductivity
by DevinoSolutions Jul 15, 2026 6/10
app GitHub

TokenGraph: Local-First Context Routing Plugin for Claude Code and Codex

TokenGraph is a local-first plugin for Claude Code and Codex that routes project context compactly. It aims to reduce context overhead by intelligently selecting which parts of your codebase to surface to the agent. Runs entirely on your machine with no external dependencies.

context-managementtoken-optimizationplugincodex
by Mujadarah Jul 15, 2026 5/10
app Reddit

rein.build: Control Local AI Coding Agents from Your iPhone

Rein is a lightweight bridge that lets you remotely control locally-running AI agents (Claude Code, Codex, Gemini, opencode, Grok) from an iPhone. Provides real git diffs from your worktree, live dev server preview, a real terminal, approval cards, and PR shipping — all routing through your own machine with no code sent externally. iOS only currently.

mobileiosremote-controlagent-bridgeprivacy
by crazy8baller Jul 15, 2026 7/10
app GitHub

Hono + Drizzle + PostgreSQL + Claude Code Boilerplate

A starter boilerplate combining Hono (lightweight web framework), TypeScript, Drizzle ORM, and PostgreSQL, configured for use with Claude Code. Provides a ready-to-go backend scaffold for API development with modern TypeScript tooling.

boilerplatehonodrizzlepostgresqltypescript
by sushantrahate Jul 15, 2026 5/10
app GitHub

dev-3.0: Kanban + Worktrees + tmux for Parallel AI Coding Agent Fleets

Mission control for solo developers running multiple AI coding agents in parallel. Combines a Kanban board, git worktrees, and tmux to manage Claude Code, Codex, Gemini CLI, OpenCode, and any shell-based agent without losing context. Designed as an agent orchestration layer, not an IDE replacement.

multi-agentkanbanworktreestmuxorchestrationparallel
by h0x91b Jul 15, 2026 8/10
app GitHub

graftty: Worktree-Centric Terminal for macOS and iOS Built on libghostty

A terminal application for macOS and iOS built on libghostty with first-class git worktree support. Designed for workflows where multiple worktrees are active simultaneously — relevant for running parallel Claude Code sessions across branches.

terminalworktreesmacosiosghostty
by btucker Jul 15, 2026 5/10
app GitHub

opencode-better-compact: Dynamic Context Pruning Plugin for OpenCode

A plugin for OpenCode that dynamically prunes conversation context to optimize token usage. Intelligently manages what stays in context based on relevance, reducing unnecessary token consumption during long coding sessions. Applicable as a pattern for context management in other AI coding tools.

context-managementtoken-optimizationopencodepruning
by AshishKumar4 Jul 15, 2026 5/10
app GitHub

project-memory: Capture the Why Behind Your Code for AI Coding Agents

An engineering decision memory tool for AI-assisted development that records the reasoning behind code choices, not just what was built. Helps AI coding agents understand architectural intent and constraints when revisiting or extending existing code. Targets the common problem of AI agents lacking historical context.

memorydecision-logcontextarchitecturedocumentation
by hozakar Jul 15, 2026 6/10
app GitHub

One-Command Ubuntu VPS Setup for AI Coding Agent Environments

An idempotent curl|bash installer that turns a fresh Ubuntu VPS into a fully configured AI coding agent environment in one command. Installs Claude Code, Codex CLI, Gemini CLI, major language runtimes, and 40+ dev tools. Designed for reproducible agent infrastructure setup.

vpssetupinfrastructuredevopsubuntuautomation
by quangdang46 Jul 15, 2026 7/10
app GitHub

owledge: Markdown-First Persistent Memory for AI Agents and Multi-Agent Workflows

A memory and project planning tool for AI agents that works from plain markdown files. Supports existing knowledge bases and multi-agent workflows without requiring a specialized database or service. Designed to integrate naturally into codebases where documentation already lives in markdown.

memorymarkdownmulti-agentplanningknowledge-base
by elmokirk Jul 15, 2026 6/10
app GitHub

intelligence-sync: Write AI Coding Rules Once, Sync Across All Tools

A tool that maintains a single source of truth for AI coding rules and syncs them automatically to Claude Code, Cursor, Copilot, Codex, and more. Eliminates the pain of maintaining separate rule files for each AI coding assistant across a team. Keeps all agents working from the same conventions.

rulessyncmulti-toolcursorcopilotteam-workflow
by ainova-systems Jul 15, 2026 7/10
app GitHub

claude-shopifyql-workbench: Debug and Write ShopifyQL Analytics Queries with Claude

A workbench for using Claude to write, debug, and explain ShopifyQL and Segment analytics queries. Speeds up analytics filter work for Shopify merchants and developers who need to iterate on queries quickly without memorizing ShopifyQL syntax.

shopifyshopifyqlanalyticsecommercequeries
by marsilitonga-ifb Jul 15, 2026 5/10
app GitHub

GENesis-AGI: Autonomous AI Agent with Earned Autonomy and 60+ Tools

An experimental autonomous agent framework built around Claude with 60+ tools and a self-directed cognitive cycle that decides what to do without explicit prompting. Features an "earned autonomy" model where the agent gains capabilities incrementally based on track record. An ambitious framework for fully autonomous task execution.

autonomousagenttoolscognitive-cycleearned-autonomyexperimental
by WingedGuardian Jul 15, 2026 5/10
app GitHub

sprintlens: Engineering Team Health Dashboard in One Terminal Command

A CLI tool that surfaces engineering team health metrics from a single terminal command, giving developers and managers a quick sprint snapshot without context-switching to web dashboards. Terminal-first, minimal setup.

cliteam-healthsprintengineeringmetricsterminal
by HansujaB Jul 15, 2026 5/10
app GitHub

Asana CLI: Single-Binary Task Manager for Claude Code

A single-binary Asana CLI tool designed for developers using Claude Code, Codex, and other AI coding assistants. Enables task management and project tracking directly from the terminal without needing the Asana web app. Useful for integrating project management into AI-assisted development workflows.

cliasanaproject-managementproductivity
by ggkguelensan Jul 15, 2026 6/10
app GitHub

OpenGUI: Desktop Command Center for Claude Code and Multiple AI Coding Agents

A desktop application that acts as a unified command center for Claude Code, OpenCode, Codex, and Pi. Supports multi-project AI coding sessions with streaming chat, a prompt queue, model switching, and MCP tools in a single interface. Useful for developers who run multiple AI agents across different projects simultaneously.

desktopguimulti-agentmcpproductivity
by akemmanuel Jul 15, 2026 7/10
app GitHub

claude-box: Docker Sandbox That Carries Over Your Entire Claude Code Setup

A Docker sandbox for Claude Code that feels native by preserving your global skills, plugins, MCP servers, git config, and persistent Claude sessions. Solves the common pain of a stripped environment in containers. Ideal for reproducible development or sharing a configured Claude Code environment across machines.

dockersandboxisolationmcpskillsdevcontainer
by shftwst Jul 15, 2026 8/10
app GitHub

claude-session-triage: Triage Panel for Idle Claude Code Sessions Across Projects

A zero-dependency, offline triage panel that finds every idle Claude Code session across all your projects and shows what each was waiting on. Ranks sessions so you know which to resume first. Useful for developers who run many parallel Claude sessions and lose track of which ones need attention.

session-managementproductivitymulti-projecttriagetool
by eltonylfgi-blip Jul 15, 2026 7/10
app GitHub

hol-guard: Open-Source Runtime Security for AI Agents

An open-source "antivirus" for AI agents that blocks risky tools, secret access, prompt injection, malicious packages, MCP servers, plugins, and skills at runtime. Designed to sit in front of agent tool calls and enforce security policies before execution. Addresses a real gap as AI coding agents gain more system access.

securityprompt-injectionruntime-protectionmcpagent-security
by hashgraph-online Jul 15, 2026 9/10
app GitHub

clagentic-lite: Cross-Vendor AI Coding Harness with Gated Security and Audit Trail

A cross-vendor AI coding harness with deterministic security gates. Separates work into gated Builder and Reviewer roles and maintains a full SQLite audit trail of every agent action. Runs entirely local — no server, no cloud required. An alternative to vendor-specific harnesses for teams who want vendor flexibility with strong auditability.

securityauditmulti-vendorbuilderreviewerlocal
by clagentic Jul 15, 2026 7/10
app GitHub

agentic-board: Quota-Aware Coding Agent Coordinator for Real GitHub Projects

A coordinator that pulls tasks from a real GitHub Projects board and runs coding agents against them with quota awareness and review gating. Unlike local Kanban tools, it operates directly on the GitHub Projects source of truth. Designed for teams that want to automate development tasks while keeping human review checkpoints.

github-projectsproject-managementautomationquotareview-gate
by CSalcedoDataBI Jul 15, 2026 7/10
app GitHub

CCGlance: Floating Always-On-Top Claude Code Status Panel for macOS

A floating, always-on-top panel on macOS showing Claude Code session status at a glance — no window switching required. Keeps agent state visible while you work in other apps.

macosstatus-panelalways-on-topsession-monitoringutility
by hatoya Jul 15, 2026 6/10
app GitHub

Autonomy-Engine: Repo-Agnostic Claude Code Autonomy Loop Runner

A repo-agnostic engine for running Claude Code autonomy loops against any target repository, making autonomous coding sessions portable and reusable across different projects.

autonomyautomationrepo-agnosticclaude-codeagentic
by Luke-Bradford Jul 15, 2026 6/10
app GitHub

AI Pet: macOS Desktop Pet That Reacts to Your AI Usage

A local-first SwiftUI macOS menu-bar desktop pet that reacts to your AI usage in real time — showing quota, token burn rate, cost, and work rhythm. Includes adapters for Codex and Claude Code.

macosgamificationusage-monitoringdesktop-petswiftui
by F-e-u-e-r Jul 15, 2026 6/10
app GitHub

TeleClaude: Route Telegram Topics to Isolated Claude Code Sessions

Routes Telegram topics to isolated Claude Code sessions with persistent memory, enabling conversational AI workflows triggered from a Telegram interface — useful for remote or mobile-driven coding sessions.

telegramsession-routingmemoryintegrationautomation
by contealessandrovoltalandscape881 Jul 15, 2026 6/10
app GitHub

Loushang: Multi-Model LLM Orchestration Harness in Python

An AI-native Python agent harness with multi-model orchestration, stateful sessions, tool governance, traceable delivery, and provider routing for GPT, Claude, DeepSeek, Qwen, Kimi, GLM, and MiniMax.

orchestrationmulti-modelpythonprovider-routingstateful
by zhnt Jul 15, 2026 6/10
app GitHub

TokenBar: Claude Code Usage Meter for Windows 11 Taskbar

Shows your remaining Claude Code 5-hour session capacity directly in the Windows 11 taskbar at a glance, without needing to open any app or dashboard.

windowstaskbarusage-monitoringsession-trackingclaude-code
by STEADYFLOW-Inc Jul 15, 2026 6/10
app GitHub

Aura-Code: Model-Agnostic Autonomous Coding Agent with Benchmark Harness

A model-agnostic autonomous coding agent with a reproducible benchmark harness, adaptive turn budgets, and domain-expert prompting. Works with Claude, GPT, Gemini, Ollama, and others. 1380+ tests, built by AI agents orchestrated by humans.

autonomous-codingbenchmarkingmulti-modeltestingopen-source
by milodule3-debug Jul 15, 2026 6/10
app GitHub

Code-by-Wire: Cockpit for Piloting and Monitoring Claude Code Sessions

A cockpit interface for piloting every Claude Code session and monitoring its telemetry from one centralized view — useful when running multiple parallel sessions across projects.

monitoringtelemetrysession-managementdashboardclaude-code
by luojiahai Jul 15, 2026 6/10
app Reddit

WideAwake: Prevent Mac from Sleeping During Agent Sessions

Automatically detects when your AI agents are running and prevents your Mac from sleeping, ensuring long-running autonomous sessions complete without interruption. Simple and focused utility.

macossleep-preventionautomationagent-sessionsutility
by Rare-Spinach8779 Jul 15, 2026 6/10
app Reddit

Octopodas: AI Agent Loop Detection and Observability Platform

Catches up to 6 loop types in AI agents, provides time-stamped action categorization, agent-to-agent communication through shared memory, cost prediction analysis, and automatic recovery for broken agents.

observabilityloop-detectioncost-predictionagent-communicationrecovery
by DetectiveMindless652 Jul 15, 2026 6/10
app GitHub

Rekal-CLI: Git-Anchored Intent Ledger for AI-Assisted Teams

A decentralized intent and conversation ledger that anchors AI coding context to git commits, helping teams maintain shared understanding of decisions and intent across sessions and contributors.

gitintent-trackingteamcontextdecentralized
by rekal-dev Jul 15, 2026 6/10
app GitHub

Agent-Sessions: Track Coding Agent Sessions Across Tmux Panes

A lightweight tool for tracking local coding agent sessions across tmux panes, giving you visibility into what's running where during multi-agent workflows from the terminal.

tmuxsession-managementmonitoringmulti-agentterminal
by zigai Jul 15, 2026 6/10
app GitHub

AI-Pulse: Claude Code Native Daily AI News Digest

An AI-powered daily digest for developers covering 30+ AI news sources across 7 dimensions with 3x daily updates. Built Claude Code native with zero external dependencies.

news-digestautomationclaude-code-nativedeveloper-toolsaggregation
by DaiOwen Jul 15, 2026 6/10
app GitHub

Castellyn: Desktop Control Center for Claude Code and Opencode

A Tauri v2 + Svelte 5 desktop control center for Claude Code and opencode: profiles, provider/router configuration, MCP, plugins, skills, and parallel session management. Available in Russian, English, and Chinese.

desktop-appconfigurationparallel-sessionsmcpmulti-language
by danscMax Jul 15, 2026 7/10
app GitHub

Paper-Round: Scheduled Claude Agent for Academic Paper Digests

A scheduled Claude agent that screens journal RSS feeds against your research scope, emails a daily digest, and files papers into Zotero. No API keys needed — runs entirely on a claude.ai subscription.

researchzoterorssemail-digestautomation
by LaineyLouiseWard Jul 15, 2026 7/10
app GitHub

AgentGlass: LLM Observability and Tracing with No SDK Required

Captures, inspects, replays, and analyzes every AI agent run without any SDK or code changes. A glass-box observability layer for understanding exactly what your agents do and catching unexpected behavior.

observabilitytracingdebuggingno-sdkanalytics
by vugarfamiloglu Jul 15, 2026 7/10
app GitHub

Burnie: Local Cost Analytics for Claude Code Sessions

A local cost analytics tool specifically for Claude Code sessions, tracking and visualizing what you spend across sessions to understand and optimize your usage.

cost-analyticsusage-trackinglocalclaude-code
by czoido Jul 15, 2026 7/10
app GitHub

Tokcat: AI Token Usage Monitor for macOS Menu Bar

Tracks Claude Code, Codex, Cursor, Copilot, and other AI coding agent token usage with a 2D/3D contribution-style graph in the macOS menu bar. Makes your aggregate AI usage visible at a glance.

usage-monitoringmacosmenu-barmulti-agentanalytics
by handlecusion Jul 15, 2026 7/10
app GitHub

Iapeer: Local Background Agents with Inter-Agent Messaging

Runs local background agents on Claude Code and Codex CLI that can message each other, wake on demand, and share a single memory store — enabling true multi-agent coordination without a central server.

multi-agentbackground-agentsshared-memorycoordination
by agfpd Jul 15, 2026 7/10
app GitHub

Codecast: Real-Time Session Sync Across Devices for AI Agents

Real-time sync for Claude Code, Codex, Gemini, and Cursor sessions — watch agent work from any device, share sessions with your team, and give Claude persistent memory that carries across sessions.

real-timesession-syncteammemorymulti-device
by codecast-sh Jul 15, 2026 7/10
app GitHub

Chat History: Search and Export Claude Code + Cursor Conversations

Search, inspect, and export Claude Code and Cursor conversation history. Makes past sessions easily discoverable and referenceable, supporting knowledge retention across projects.

conversation-historysearchexportclaude-codecursor
by ay-bh Jul 15, 2026 7/10
app GitHub

OpenUsage: Unified Dashboard for AI Spend Across All Providers

A single dashboard for tracking spend and usage across Claude, Cursor, OpenRouter, Copilot, Gemini, Codex, and more. See all your AI costs consolidated in one view.

usage-trackingcost-analyticsdashboardmulti-provideropen-source
by janekbaraniewski Jul 15, 2026 7/10
app Reddit

ConfigDeck: Native macOS App for Claude Code Config Management

A free, open-source native macOS app that shows all Claude Code configuration in one searchable window — skills, agents, hooks, MCP servers, settings. Every save backs up the old version automatically.

configurationmacosguiclaude-codemanagement
by Finger-Whole Jul 15, 2026 7/10
app GitHub

Router-Maestro: Multi-Provider LLM Proxy with Priority Routing

A local proxy that lets OpenAI-, Anthropic-, and Gemini-compatible clients use models from GitHub Copilot, OpenAI, Anthropic, and custom providers with priority-based routing and automatic fallback. Self-hosted, no external dependencies.

proxymodel-routingmulti-providerfallbackopenai-compatible
by MadSkittles Jul 15, 2026 7/10
app GitHub

Claude Command Center: Multi-Session Dashboard for Mac

A local dashboard for managing every Claude Code, Codex, Cursor, and other AI coding session on your Mac simultaneously. Spawn and ship sessions in parallel from one interface. Open source, MIT.

session-managementdashboardmacosmulti-agentparallel
by amirfish1 Jul 15, 2026 7/10
app GitHub

Code-Airlock: Secure Docker Sandbox for Coding Agents

Runs coding agents in a secure Docker microVM and merges their work as standard git commits, protecting the host machine from agent mistakes or runaway file changes.

securitydockersandboxisolationgit
by Screwnephropsnorvegicus769 Jul 15, 2026 7/10
app GitHub

Scribe: LLM-Managed Personal Knowledge Base from Code and Sessions

Automatically extracts knowledge from git repos, Claude Code sessions (via ccrider FTS5), and iMessage bookmarks into a cross-project, qmd-indexed knowledge base running on cron. Surfaces relevant context across projects.

knowledge-basememoryclaude-codeautomationcron
by oliver-kriska Jul 15, 2026 7/10
app GitHub

Claude Meter: Real-Time Subscription Usage Monitor for Windows

An ultra-lightweight Rust system tray app (~3 MB RAM) for monitoring Claude AI subscription usage in real time on Windows. Shows remaining capacity at a glance without leaving your editor.

usage-monitoringsubscriptionwindowsrustsystem-tray
by klivak Jul 15, 2026 7/10
app GitHub

Claudeclaw: Multi-Agent Orchestration with Persistent Memory

Orchestrates Claude Code agents with persistent memory, message routing, webhook triggers, cost tracking, and OS-level sandbox isolation for safe, coordinated multi-agent workflows.

orchestrationmulti-agentmemorywebhookscost-tracking
by geromefull794 Jul 15, 2026 7/10
app Reddit

Budget-Aware AI API Gateway for Claude Code

A gateway that creates temporary tokens with fixed budgets, preventing Claude Code from exceeding token limits even in unattended sessions. Keeps your API key off the machine running Claude Code, reducing theft risk. Useful for shared setups or when running agents autonomously.

token-budgetapi-gatewaycost-controlsecurity
by endlessroad1991 Jul 15, 2026 8/10
app GitHub

TokenScope: Open-Source Token Profiler for AI Coding Agents

Analyzes Claude Code session logs to detect repeated content and bloated tool results, showing exactly where context window budget goes with concrete fixes and estimated savings. The first open-source token profiler specifically for AI coding agents.

token-profilingcontext-windowcost-optimizationanalytics
by yaswanthme007 Jul 15, 2026 8/10
app GitHub

Agon: AI Coding Model Competition Framework

Runs multiple AI coding models simultaneously on the same task in isolated git worktrees, auto-applies the best solution, and tracks model performance with Glicko-2 ratings over time. Routes future work to the model that excels at each task type.

model-comparisonbenchmarkinggit-worktreesroutingratings
by KERNlang Jul 15, 2026 8/10
app Reddit

Physical Stream Deck Dials for Claude Code Model and Effort Control

Stream Deck dials for switching Claude Code models and reasoning effort without retyping /model or /compact. Tracks the active session ID and patches the installed VS Code extension locally. Also ships a PTY-wrapped terminal launcher that works without any patching.

stream-deckhardwaremodel-switchingdeveloper-toolsproductivity
by Alish3r Jul 15, 2026 8/10
app GitHub

LLM Local Sizing Log: Hardware Sizing from Real Agent Sessions

A platform-agnostic format and method for right-sizing local LLM hardware based on your actual agent session data. Calibrates recommendations using capability-oracle runs to ensure you get hardware that matches real workloads. Useful for teams self-hosting models to complement Claude Code workflows.

local-llmhardwaresizingagent-sessions
by afluffywaffle Jul 15, 2026 5/10
app GitHub

Gadfly: Socratic Supervision Layer for AI Coding Agents

A supervision layer that challenges AI coding agent decisions using Socratic questioning, helping catch bad assumptions before they become code. Designed to sit between your intent and the agent execution, improving reasoning quality. Useful for high-stakes codebases where unchecked agent autonomy is a risk.

supervisionsafetyagentcode-reviewreasoning
by Touchpoint-Labs Jul 15, 2026 7/10
app GitHub

AIR: Automated Code Review with Pattern Learning

Automated code review tool that verifies changes, learns from team-specific patterns over time, and accumulates shared team knowledge. Integrates with AI coding workflows to provide consistent, context-aware review feedback. Reduces review bottlenecks by automating the repetitive parts of code review.

code-reviewautomationteampattern-learning
by VorobiovD Jul 15, 2026 6/10
app GitHub

thClaws: Open-Source AI Agent Harness in Native Rust

A multi-mode AI agent harness written in Rust that serves GUI, CLI, headless, and webapp interfaces from a single binary. Supports multiple AI providers, MCP, skills, plugins, and agent teams. An interesting alternative to Electron-based approaches for users who want a lightweight, performant agent shell.

rustagent-harnessmcpmulti-providercli
by thClaws Jul 15, 2026 7/10
app GitHub

StatelessAgent: Local-First Persistent Memory for AI Coding

Provides persistent, indexed memory for AI coding workflows so context survives across sessions. Indexes notes locally and delivers relevant context at the start of new sessions, solving the cold-start problem that makes long-running projects hard. Works with Claude Code and other AI coding CLIs.

memorypersistencecontextlocal-firstsessions
by rerecoy123 Jul 15, 2026 7/10
app GitHub

Clear-Code: Visibility into Claude Code Requests and Token Use

Tracks and inspects all Claude Code requests, file reads, and token usage with clear, structured logs. Gives full visibility into what the agent is doing and how much it is costing. Helpful for debugging runaway sessions, auditing behavior, and understanding token consumption patterns.

loggingobservabilitytokensdebuggingclaude-code
by Vinniphonetic360 Jul 15, 2026 7/10
app GitHub

Core by RedPlanetHQ: Personal AI OS

An open-source personal AI operating system from the makers of Plane, designed to unify AI interactions, memory, and tooling in one place. Provides a foundation for building personal productivity workflows around AI agents. Positioned as a self-hosted alternative to proprietary AI hubs.

ai-osproductivitymemoryself-hostedagents
by RedPlanetHQ Jul 15, 2026 5/10
app GitHub

EBM Framework: Evidence-Based Medicine Research Pipeline Powered by Claude

End-to-end pipeline that takes a plain-language clinical question, finds studies, verifies each one is real via Crossref/PubMed (anti-hallucination), grades evidence with GRADE methodology, and writes the final report — all using Claude as the engine. Includes word-for-word number checking to catch LLM-fabricated citations. A rigorous example of Claude for high-stakes domain research.

medicineresearchanti-hallucinationclaudeevidence-based
by kau10082 Jul 15, 2026 5/10
app GitHub

Lumi: Beginner-Friendly Local AI Helper for Claude Code and Ollama

A beginner-friendly local AI assistant that supports Ollama, Codex, and Claude Code from a single interface. Designed to lower the barrier to entry for developers new to AI coding tools. Good onboarding layer for teams introducing AI coding to less technical members.

local-aibeginnerollamaclaude-codeassistant
by burgundit Jul 15, 2026 5/10
app GitHub

Career-Ops: AI Job Search Agent for Claude Code CLI

Open-source job search automation that scans job portals, scores listings A-F, tailors your CV for each role, and tracks applications — all runnable inside Claude Code, Codex, or Gemini CLI. Demonstrates how AI coding agents can be repurposed for non-coding automation tasks. A practical personal productivity use case for the Claude Code skill ecosystem.

job-searchautomationproductivityclaude-codecareer
by santifer Jul 15, 2026 5/10
app GitHub

ClaudePet: Pixel-Art Claude Desktop Companion for macOS

A tiny pixel-art Claude desktop pet for macOS that wanders your screen, visually reflects when Claude Code is active, and celebrates when a session completes. A fun ambient indicator that makes long coding sessions more enjoyable. No practical function — purely delightful.

macosdesktop-petclaude-codepixel-artfun
by jihoon85 Jul 15, 2026 6/10
app GitHub

My-Sim: Local Issue Tracker Integrated with Claude Code CLI

A lightweight local issue tracker designed to work alongside the Claude Code CLI. Keeps task management local and Claude-aware without needing external project management tools. Good for solo developers or small teams who want issue tracking that stays in the terminal.

issue-trackerlocalcliproductivityclaude-code
by msriver Jul 15, 2026 5/10
app GitHub

Claude Image Gen: Image Generation for Claude Code via Codex Tool

Adds image generation capability to Claude Code by borrowing the Codex CLI's built-in image_gen tool — runs on your existing ChatGPT plan with no extra API key or per-image billing. A clever bridge between two AI coding ecosystems that unlocks a capability Claude Code lacks natively. Useful for projects that need quick image prototypes alongside code.

image-generationclaude-codecodexchatgptintegration
by FernandoGomes83 Jul 15, 2026 6/10
app GitHub

Synaptic: Auditable Code Intelligence for AI Agents

Maps code dependencies, predicts change impact, selects relevant tests, and verifies refactors before they ship — all designed for AI agent consumption. Gives agents the structural understanding of a codebase they need to make safe, targeted changes. Addresses one of the core risks of agentic refactoring: unintended side effects.

code-intelligencedependenciesrefactoringtestingagents
by ColinVaughn Jul 15, 2026 8/10
app GitHub

claude-architect: Study Materials for Anthropic Claude Certified Architect Exam

Study materials, code examples, and practice scenarios for the Claude Certified Architect: Foundations (CCA-F) exam. Covers five domains: agentic architecture, MCP integration, Claude Code workflows, prompt engineering, and context management.

certificationstudy-materialsarchitectmcp
by timothywarner-org Jul 15, 2026 6/10
app GitHub

assistant: AI Chief of Staff for a Fleet of Claude Code Agents

Orchestration app that turns inbox, Slack, GitHub, calendar, and goals into a single morning brief of decisions using Claude Code agents. Python controls every gate and outbound action — the LLM only suggests and drafts, never acts autonomously. Silent by default, designed for fleet-level coordination.

orchestrationfleetmorning-briefautomation
by elitecoder Jul 15, 2026 7/10
app GitHub

claude-eats-tokens: PWA Token Tracker for Claude Code Usage

A Progressive Web App for tracking Claude Code token consumption with a food-themed interface. Runs in the browser without installation, providing a lightweight alternative to native desktop token monitors.

token-usagepwatracking
by arochab Jul 15, 2026 5/10
app GitHub

ai-memory-vault: Obsidian Vault as Persistent AI Memory — No Vector Database

ai-memory-vault provides an open-source system and Markdown templates that turn an Obsidian vault into working memory for AI assistants. Uses no vector database — just markdown files and structured templates. Gives Claude Code persistent, human-readable memory across sessions without infrastructure overhead.

memoryobsidianpersistencetemplates
by jaredrhod Jul 15, 2026 6/10
app GitHub

precept: Self-Improving Agentic Platform That Learns From Session History

A personal platform for managing agentic AI workflows that learns from session history to improve its data catalog, defined entities (rules, skills, agent personas), and processes. Aims to make AI workflows smarter over time without manual intervention.

agenticself-improvingdata-catalogpersonas
by NoaBarzelay Jul 15, 2026 6/10
app GitHub

agentic-kit: npm Package That Installs and Heals claude-flow + agentic-qe

A single npm package that makes ruflo (claude-flow) and agentic-qe reliably work on macOS, Linux, and Windows. The ak sync command detects drift, converges to a healthy state, and verifies it — uses native SQLite with no silent data loss, clean uninstall, thin and reversible.

claude-flownpminstallationtooling
by pacphi Jul 15, 2026 6/10
app Reddit

Daimon: Memory Plugin That Tags Verified vs Inferred Facts

An open-source memory plugin for Claude Code that writes session checkpoints and injects briefings on the next start. Every memory item is tagged as verbatim (traced to an exact transcript quote) or inferred (model conclusion) — letting you know exactly how reliable each recalled fact is. Includes an audit-quotes command to re-verify verbatim claims on demand.

memorypluginverificationbriefingsessionsopen-source
by Sea-Perception1619 Jul 14, 2026 8/10
app Reddit

Box: Affordable Full-VM Sandboxes for Long-Running AI Agents

A sandbox provider offering full Ubuntu VMs with desktop, Docker, and all devtools at ~5x lower cost than incumbents like E2B and Daytona. A new sandbox is just "box new" from the terminal; each VM supports moonlight/VNC, Docker, and long-running sessions. Available as a CLI, API, and SDK.

sandboxvmcloudaffordableubuntudockercli
by noodlesteak Jul 14, 2026 6/10
app Reddit

DeadSkills: Find Unused Claude Code Skills by Transcript Analysis

A zero-dependency CLI tool (npx deadskills) that reads local Claude Code and Codex transcripts, counts actual skill invocations, and reports active vs zombie (unused 90+ days) vs dead skills with estimated token cost per skill. Everything runs locally — no transcripts leave your machine.

skillstoken-usageoptimizationclitranscriptsnpx
by Longjumping-Fox4036 Jul 14, 2026 7/10
app Reddit

CodeIsland: AI Agent Task Panel in the MacBook Notch

A free, open-source macOS app (MIT) that uses the MacBook notch as a status panel for Claude Code, Codex, Gemini CLI, and Cursor. Features a configurable global hotkey for approving permission requests from any app, plus a companion iPhone/Apple Watch app for remote session monitoring.

macosnotchstatusapprovalhotkeywatchiphone
by grannyknickersniffer Jul 14, 2026 7/10
app GitHub

Poirot: Native macOS Companion for Claude Code Sessions

A native macOS app for browsing Claude Code sessions, exploring diffs, and re-running commands without opening a terminal. Provides a GUI layer over Claude Code history for post-session review and command replay.

macosguisessionsdiffscompanionreplay
by a7t-ai Jul 14, 2026 7/10
app GitHub

Szumrak: Autonomous Claude SDK Engine That Opens Reviewed PRs

An autonomous Claude Agent SDK engine that performs narrow, verifiable tasks on a target repository and opens a reviewed, labelled pull request. Features env-validated config, DRY_RUN safety mode, and command-injection-hardened git operations.

agent-sdkautonomouspr-automationdry-runsecuritygit
by JanSzewczyk Jul 14, 2026 7/10
app GitHub

Agent Context Kit: Offline CLI for Safe Agent Context Files

An offline-first CLI that generates safe AI coding agent context files, task-first workflows, repo hygiene reports, and multi-agent instruction files. Designed to produce well-scoped context without leaking sensitive data.

contextcliofflinemulti-agenthygienesafety
by Cynrath Jul 14, 2026 6/10
app GitHub

AgentSync: Sync AI Coding Agent Configs from One Source

Synchronizes configuration files for Claude Code, OpenCode, Codex, and other AI coding agents from a single canonical, committable source. Keeps agent setups consistent across machines and team members without manual copying.

configsynccodexopencodeteamcanonical
by spxrogers Jul 14, 2026 6/10
app GitHub

Rich Color-Coded Status Line for Claude Code

Adds a terminal status line to Claude Code displaying context usage, git state, costs, and rate limits in color. Installable as a plugin, surfaces key session metrics at a glance without leaving the terminal.

status-lineterminalcontextgitproductivity
by axlaser Jul 14, 2026 7/10
app GitHub

Detach: Run Claude Code Reliably in Background on macOS

Lets you run Claude Code and Codex in the background on macOS with a native dashboard, persistent tmux sessions, local checkpoints, and crash recovery support. Solves closed-lid and session-loss problems for long-running agent work.

macosbackgroundtmuxsessionsrecovery
by iltsarev Jul 14, 2026 7/10
app GitHub

ESP32 Hardware Status Display for Claude Code

Streams live Claude Code session data — context percentage, current model, and per-session status — over WiFi to a LilyGO T-Display-S3 ESP32 hardware display. Uses Claude Code hooks to push updates to the physical device.

esp32hardwarehooksstatusiotwifi
by TDMarko Jul 14, 2026 8/10
app GitHub

Claude Code Transfer: Move Sessions Between PCs

Packages Claude Code chats and project files into a portable .cctx bundle for moving between machines. Includes automatic path remapping so file references stay correct after transfer — no cloud sync required.

portabilitysessionstransferfilessync
by perereus Jul 14, 2026 6/10
app GitHub

Agent Meter: Token Usage Widget for Claude Code on Windows

A lightweight Windows system widget that shows local-first token usage and cost estimates for Codex and Claude Code sessions. Reads local logs and displays a live summary in a desktop widget with no server required.

windowswidgettoken-usagecostmonitoring
by wjh19990923 Jul 14, 2026 6/10
app GitHub

Claude Code PWA: Control Your CLI from Your Phone

An unofficial PWA client for Claude Code that connects over Tailscale, enabling multi-session chat, push notifications, file preview, and optional desktop screen sharing from a mobile browser. No cloud intermediary needed.

pwamobiletailscaleremotesessionspush-notifications
by Synforger Jul 14, 2026 7/10
app GitHub

Claude Code Voice: Replies Read Aloud with Local TTS

Makes Claude Code responses speak aloud using Kokoro, a local neural TTS engine. Entirely offline — no API key or cloud service required. Useful for hands-free coding sessions or reviewing long responses without reading.

voicettsaccessibilitylocalkokorooffline
by syymza Jul 14, 2026 7/10
app Reddit

$30 Touchscreen Physical Control Surface for Claude Code

Claudeq turns a Waveshare ESP32-S3 touchscreen into a dock beside your keyboard for driving Claude Code sessions: tap to approve permissions, see session status, and avoid alt-tabbing back to the terminal. Open-source personal project.

hardwareuxembeddedsession-management
by reddit Jul 14, 2026 7/10
app Reddit

ccshare: Multiplayer for Terminal-Based Coding Agents

Allows multiple users to share and collaborate on terminal-based Claude Code and Codex sessions in real time. Enables team coding sessions, pair programming with AI, and remote collaboration on agentic workflows from the terminal.

collaborationmulti-userterminalsession
by reddit Jul 14, 2026 7/10
app GitHub

docx-cli: Read, Edit, and Comment on .docx Files from AI Agents

CLI tool for AI agents (Claude Code, Codex) to read, edit, and add comments to .docx files with full format fidelity. Fills the gap that most coding agents can only work with plain text and markdown, not Office documents.

clidocxofficedocuments
by kklimuk Jul 14, 2026 7/10
app GitHub

Cli-launcher: Cross-Platform Desktop Launcher for 17 AI Coding CLIs

Electron + React desktop app that installs, updates, uninstalls, and launches 17 terminal AI coding agents — Claude Code, OpenCode, Gemini CLI, GitHub Copilot, Aider, and more — from a single macOS-style panel. Reduces the friction of managing multiple agent CLIs.

launchermulti-agentdesktopcli
by MadBlast0 Jul 14, 2026 7/10
app GitHub

ai-cli-utils: Unified Session Manager for Claude Code and Gemini CLI

Automation toolkit for managing Claude Code and Gemini CLI sessions: tmux session management, git worktree automation, cross-machine sync, and resilient Gemini API access. Fills operational gaps when running multiple AI coding agents across machines.

clisession-managementtmuxmulti-agent
by sergeiwallace Jul 14, 2026 7/10
app GitHub

lacquer: Go CLI + Profile Templates to Standardize Claude Code Across Projects

Go CLI that applies consistent Claude Code configuration profiles across all your projects. Write a profile once, apply it everywhere. Ensures the same CLAUDE.md conventions, settings, and hook configurations are active in every project without manual duplication.

cliconfigurationprofileproject-management
by patrickserrano Jul 14, 2026 7/10
app GitHub

claude-fleet: Raycast Extension to Spawn, Resume, and Review Claude Code Agents

Raycast extension for Claude Code: spawn new agent sessions, resume existing ones, and review agent status — all from the Raycast launcher without switching to the terminal. Reduces friction in managing multiple Claude Code sessions.

raycastlaunchersession-managementmacos
by vmc-7645 Jul 14, 2026 7/10
app GitHub

workweave/router: Model Router That Cuts Agent Costs 40-70%

Model router for agentic systems that routes every prompt to the right model in under 50ms. Analyzes query complexity and routes to cheaper models when appropriate. Drop-in endpoint change can reduce costs 40-70% with no changes to agent logic.

routercost-optimizationmodelsagent-infrastructure
by workweave Jul 14, 2026 7/10
app GitHub

king-kusaila: Voice-Operated Laptop with Claude Code

A complete Hyprland-based Linux setup where Claude Code handles software tasks via end-to-end voice missions — system-wide dictation converts speech to text, which is passed to a Claude Code agent. The entire development workflow is driven by voice.

voiceaccessibilitylinuxautomation
by kabylesystem Jul 14, 2026 7/10
app GitHub

srpopo: Run Claude Code Sessions in Parallel from a Kanban Board

Local desktop app that orchestrates multiple Claude Code sessions across git repos in parallel, managed from a Kanban board view. Each card is an agent session; you can assign tasks, monitor progress, and review output without leaving the UI.

orchestrationkanbanparallelsession-management
by PauloLimaHQ Jul 14, 2026 7/10
app GitHub

mind: Brain-Like Memory for Coding Agents with Spreading-Activation Recall

One Python file, zero dependencies, offline memory system for any coding agent. Implements spreading-activation recall (concepts activate related concepts), Ebbinghaus forgetting curves, and deterministic dream consolidation (periodic memory compression). Supports English and Arabic.

memorycognitiveofflineagent-infrastructure
by Da7-Tech Jul 14, 2026 7/10
app GitHub

claude-tools: Pause, Resume, Edit, and Audit Claude Code Cron Jobs

Manage Claude Code cron jobs (e.g., /loop) without losing state. Pause a running job, edit its parameters, resume, and review the full audit trail of past runs — all without canceling the session or losing progress.

cronsession-managementloopautomation
by thepictishbeast Jul 14, 2026 7/10
app GitHub

claude-proxy: Rust Gateway to Use Claude Code with Multiple LLM Backends

Single-binary Rust gateway that lets Claude Code connect to ChatGPT, OpenAI, GitHub Copilot, Gemini, OpenRouter, or custom backends. Includes OAuth, smart model routing, virtual 1M context window, and a TUI for observability. Drop-in proxy for the Claude API surface.

proxymulti-modelrustapi
by MorseWayne Jul 14, 2026 7/10
app GitHub

cc-transcript: Grep Every Claude Code Session You've Ever Run

CLI tool that creates a searchable store of all your Claude Code session transcripts. Full-text search, timeline view, and filter by date or project. Lets you find past solutions, recall how you solved a problem, or audit what an agent did.

transcriptssearchhistorysession-management
by yasyf Jul 14, 2026 7/10
app GitHub

claude-code-nix-sandbox: Nix-Based Sandboxed Claude Code Sessions

Pure Nix machinery for sandboxed Claude Code sessions with Chromium support. Three backends: bubblewrap (lightweight), systemd-nspawn (intermediate), and QEMU VM (full isolation). Declarative sandbox definitions composable with existing NixOS and Home Manager configs.

sandboxnixsecurityisolation
by jhhuh Jul 14, 2026 7/10
app GitHub

deva: Docker-First Launcher for Claude Code, Codex, Gemini, and Grok

Docker-based launcher where each AI coding agent runs in its own isolated container with explicit file mounts and isolated auth. The container is the sandbox; mounts define what the agent can access. Supports Claude Code, Codex, Gemini, and Grok.

dockersandboxlauncherisolation
by thevibeworks Jul 14, 2026 7/10
app GitHub

Usage4Claude: Real-Time Claude/Codex Usage Limits in macOS Menu Bar

macOS menu bar app monitoring Claude and Codex subscription usage in real time. Tracks 5-hour, 7-day, extra usage, 7-day Opus, and 7-day Sonnet quotas simultaneously. Shows pace and remaining allocation at a glance without opening the browser.

usagemonitoringmacosmenu-bar
by f-is-h Jul 14, 2026 7/10
app GitHub

notebook-intelligence: Claude Code and MCP Support in JupyterLab

JupyterLab extension that adds Claude Code, GitHub Copilot, Ollama, and OpenAI-compatible LLM support. Includes MCP integration, skills, plugins, and notebook-aware agents. Brings the Claude Code experience to data science and research workflows in Jupyter.

jupyterlabjupytermcpdata-science
by plmbr Jul 14, 2026 7/10
app GitHub

claude-settings-editor: GUI Editor for Claude Code settings.json

Standalone HTML app (Alpine.js + Tailwind CSS) for editing Claude Code's settings.json visually. Provides a structured form interface instead of hand-editing JSON. No server required — open the HTML file directly in your browser.

settingsguiconfigurationtool
by mrspot-dev Jul 14, 2026 7/10
app GitHub

langfuse-relay: Agent-Native Local Observability Platform

Single-process observability platform for AI coding agents: captures LLM traces via a built-in proxy, ingests OTLP, stores in SQLite, and provides a Langfuse-style dashboard. Monitors Claude Code, Codex, OpenClaw, opencode, and Hermes. Zero containers required.

observabilitymonitoringtracingdashboard
by HongguangLi Jul 14, 2026 7/10
app GitHub

aegisdb: Fast Single-Binary C Database for AI Agent Long-Term Memory

Lightweight C database compiled to a single binary, designed to give AI agents durable, searchable long-term memory. Includes a Claude Code integration. Optimized for fast recall and storage of agent work artifacts without PostgreSQL overhead.

memorydatabaseself-hostedclaude-code
by d4n-larsson Jul 14, 2026 7/10
app GitHub

pixcode: Self-Hosted AI Coding Agent Control Plane

Self-hosted control plane for multiple AI coding agents. Manages Claude Code, Codex, Gemini CLI, Cursor, Qwen, and OpenCode in one workspace with chat, file management, shell access, Git, orchestration, Telegram integration, MCP, and API automation.

orchestrationself-hostedmulti-agentcontrol-plane
by alicomert Jul 14, 2026 7/10
app GitHub

codelight: Multi-Agent Dashboard for Claude Code with Physical Screen Support

Remote dashboard for Claude Code, Copilot, and Codex — approve permissions, answer agent questions, and monitor token usage from a GeekMagic screen, Android widget, GNOME Shell extension, or VS Code panel. Designed for monitoring agents without being at your primary screen.

dashboardmonitoringmulti-agentpermissions
by henrikekblad Jul 14, 2026 7/10
app GitHub

agi-orchestrator: Local Autopilot for Claude Code Driven by a Local LLM

Local autopilot that drives Claude Code interactive sessions unattended, using a local LLM as the stand-in for human input. Subscription-safe — no API key required. The local LLM decides when to approve, skip, or intervene based on configurable rules.

orchestrationautopilotlocal-llmautomation
by Pandaismyname1 Jul 14, 2026 7/10
app GitHub

vibevac: macOS Utility to Reclaim Storage from AI Coding Workspaces

Local macOS utility that safely reclaims disk space from AI coding workspaces and git worktrees by removing rebuildable artifacts (node_modules, build outputs, etc.) while preserving actual source files. Designed for the storage accumulation that comes from running many parallel agent sessions.

storagecleanupmacosworktree
by TargiX Jul 14, 2026 7/10
app GitHub

csess: Searchable Store for All Your Claude Code Sessions

Creates a searchable, portable store of Claude Code sessions with full-text search, AI-generated titles, tags, fuzzy find, and the ability to resume any session in any folder. Solves the problem of sessions being scattered and difficult to find later.

sessionssearcharchiveproductivity
by yexela Jul 14, 2026 7/10
app GitHub

pixroom: LLM Context Optimizer That Cuts Repeated Tool Output

Open-source LLM context optimizer for coding agents. Detects and compresses repeated tool output (file reads, search results, shell output) while preserving exact data. Publishes measurable token savings per session.

contexttoken-optimizationtool-outputefficiency
by CodePalAI Jul 14, 2026 7/10
app GitHub

CC: Rebuild Claude Code CLI Source Maps into Runnable TypeScript

Reconstructs the Claude Code CLI from its source maps into runnable TypeScript, making the implementation available for study, debugging, and local modification. Useful for understanding Claude Code's architecture and building extensions.

source-mapstypescriptstudydebugging
by Montesplenic117 Jul 14, 2026 7/10
app GitHub

claude-lens-v2026-hub: Local Dashboard for Claude Code Session Monitoring

Local web dashboard that tracks Claude Code activity in real time: session data, token spend, cache performance, and tool usage. Gives a persistent view into what your agents are doing and how efficiently they're using the context window.

monitoringdashboardtokenssessions
by krystynaacrid635 Jul 14, 2026 6/10
app GitHub

humhum: Desktop Jellyfish Pet That Voice-Narrates Claude Code Events

Tauri + React + Rust desktop companion app displayed as an animated jellyfish that voice-narrates Claude Code, Codex, and Gemini CLI events and confirms permission prompts by voice. Adds ambient awareness of agent activity without staring at the terminal.

appvoiceuxnotifications
by edible999999999-jpg Jul 14, 2026 6/10
app GitHub

claudelint: Linter for Claude Code Projects

A static analysis tool that validates CLAUDE.md files, skills, settings, hooks, MCP servers, and plugins in Claude Code projects. Catches misconfigurations before they cause problems. Useful for teams maintaining consistent project structure.

linterCLAUDE.mdvalidationhooksmcpskills
by pdugan20 Jul 13, 2026 8/10
app GitHub

Ronin: Provider-Agnostic Terminal Coding Agent

A masterless, terminal-native coding agent that works like Claude Code but supports Claude, Gemini, Cerebras, Groq, and Ollama. Includes evals, memory, security hardening, 200+ plugins, and MCP support. MIT licensed.

coding-agentterminalprovider-agnosticmcppluginsollama
by rohithkandula19 Jul 13, 2026 6/10
app Reddit

compact-me-lots: Auto-Compact Idle Claude Code Sessions Before Cache Expires

A CLI wrapper that detects when you walk away from a Claude Code session and auto-compacts it before the prompt cache expires. Injects a save-state prompt, runs /compact, then restores any in-progress typing. Available via npx.

compactioncacheidlewrappercliproductivity
by Ntev3nclosebaby Jul 13, 2026 7/10
app GitHub

Ritual: Multi-LLM TUI Where Claude Code Implements and Codex Reviews

An eldritch-themed TUI that runs Claude Code and Codex in a loop: Claude implements, Codex adversarially reviews each iteration, and every loop is grounded in a ./check.sh script. A fast, opinionated harness for multi-model code review workflows.

tuimulti-llmcode-reviewcodexworkflowadversarial
by 2Tricky4u Jul 13, 2026 8/10
app GitHub

wb-chronicler: Claude Code Turns WorldBox Saves into Tolkien-Style Chronicles

An Angular app that uses Claude Code to transform WorldBox game save files into narrative prose chapters, rendered in a parchment-themed reader. A creative showcase of using Claude Code as a narrative generation engine from structured game data.

creativeworldboxnarrativegameangular
by Jbz797 Jul 13, 2026 6/10
app GitHub

headroom: Live Usage Dashboard for Claude and Codex Across Accounts

A real-time dashboard that tracks and rotates Claude and Codex usage across multiple accounts without spending any tokens — reads live quota data only. Useful for power users managing multiple subscriptions or team accounts.

usagedashboardquotamonitoringcodex
by domanski-ai Jul 13, 2026 6/10
app GitHub

coop: Isolated VM Environment for Claude Code and Codex by Trail of Bits

An isolated virtual machine environment for running Claude Code and Codex safely, from Trail of Bits (a leading security research firm). Designed for running AI coding agents with proper sandboxing and containment.

securitysandboxvmisolationcodextrail-of-bits
by trailofbits Jul 13, 2026 8/10
app GitHub

switchboard: Firewall and Password Manager for AI Coding Agents

A security tool that acts as a firewall and credential manager specifically for AI coding agents. Controls what network access agents have and manages secrets they need — addresses a real gap in agentic security.

securityfirewallsecretscredentialsagent-safety
by wkoverfield Jul 13, 2026 7/10
app GitHub

claude-session-suite: Plugin Trio for Claude Code Session Lifecycle

Three Claude Code plugins covering the full session lifecycle: remote spawning (claude-remote), cache keepalive (claude-session-keeper), and cross-machine session teleportation (claude-session-teleport). Published as a plugin marketplace bundle.

pluginsessionkeepaliveremoteteleport
by superbereza Jul 13, 2026 7/10
app GitHub

agentic-metric: Local Usage Monitor TUI for Claude Code and Codex

A local-only, privacy-first usage monitor for Claude Code and Codex CLI sessions. Provides a live TUI dashboard with per-agent and per-model cost breakdowns and usage heatmaps. Nothing leaves your machine.

monitoringusagetuidashboardcodexcost
by xihuai18 Jul 13, 2026 7/10
app GitHub

SigmaLink: Electron Workspace for Orchestrating 5 CLI Coding Agents

An Electron desktop app that runs Claude Code, Codex, Gemini, Kimi, and OpenCode in isolated Git worktrees side by side. Includes a Sigma Assistant orchestrator that resumes Claude sessions across restarts and observes pane lifecycle via a mailbox back-channel.

electronorchestrationworktreemulti-agentdesktopcodex
by s1gmamale1 Jul 13, 2026 7/10
app GitHub

governed-second-brain-plugin: Local-First Team Brain with SHA-256 Audit Trail

A Claude Code + Cowork plugin that turns your own files into cited memory (qmd:// URIs) with a tamper-evident, SHA-256 hash-chained audit trail. Local-first, no daemon or network. Supports both personal and team modes.

pluginmemoryaudit-trailteamlocal-firstknowledge-base
by jeremylongshore Jul 13, 2026 6/10
app GitHub

keel: Claude Code Plugin for Product Decision Moments

A Claude Code plugin designed for product builders who direct AI rather than write code. Keel intervenes at decision points — should we build this, which architecture, what are the failure costs — rather than at code style moments. Opinionated about separating strategy from implementation.

pluginproductdecisionarchitecturestrategy
by EdytaKucharska Jul 13, 2026 6/10
app GitHub

Linear-Example: Claude Code Agents Driven from Linear Tickets

A CRUD app built end-to-end by a team of Claude Code agents driven from Linear tickets, with remote agents implementing, testing, and gating every PR on GitHub Actions. Includes a detailed case study with per-feature costs served by the app itself.

linearmulti-agentgithub-actionscase-studycost-analysis
by dperez4787 Jul 13, 2026 8/10
app GitHub

Spock: Use Grok Subscription as Anthropic-API-Compatible Proxy

A local proxy that exposes your Grok subscription as an Anthropic-API-compatible endpoint, letting you use Claude Code CLI and VSCodium without an xAI API key. Useful for mixing model subscriptions in your workflow.

proxygrokapi-compatiblesubscription
by satindergrewal Jul 13, 2026 7/10
app GitHub

Chatologist: Export and Analyze AI Chat Histories

A local-first tool that exports AI chat histories into labeled datasets to analyze usage, value, and human judgment. Useful for understanding patterns in your Claude Code sessions and generating evidence about AI productivity.

analyticschat-historydatasetslocal-first
by julianaantic4587 Jul 13, 2026 5/10
app GitHub

Claude Memory Visual Manager (claude-memery)

A visual management interface for Claude's memory system. Helps users browse, edit, and organize Claude's memory entries through a GUI rather than raw files.

memoryvisualizationmanagementgui
by jr0713 Jul 13, 2026 5/10
app GitHub

Swapdex: Safe Multi-Account Switcher for Claude Code and Codex

A switcher (not a rotator) for managing multiple Claude Code and Codex login accounts locally and safely. Useful for developers managing personal and work accounts or testing different subscription tiers.

account-managementswitchermulti-account
by youdie006 Jul 13, 2026 6/10
app GitHub

Crow Central Agency: Multi-Instance Claude Code Manager

A multi-instance Claude Code manager with a bundled web UI for orchestrating multiple Claude Code agents from one place. Simplifies running parallel agent sessions across different projects.

multi-agentorchestrationweb-uimanagement
by hmmroger Jul 13, 2026 8/10
app GitHub

Causal-Repair: Make Small Models Fix Bugs Like a Frontier Model

A Claude Code repair harness that makes small, self-hostable coding models fix bugs with frontier-model quality. Gates require machine-checked evidence that a patch restored the documented contract, not just passing visible tests.

bug-fixrepair-harnesssmall-modelsverificationtesting
by idpcom Jul 13, 2026 8/10
app GitHub

LightCode: One Window for All AI Coding Agents

A unified terminal that runs Claude Code, Codex, OpenCode, Gemini, Antigravity, Cursor, and Copilot side-by-side in any layout. Combines terminal and chat for multi-agent parallel development.

multi-agentterminalunifiedproductivity
by SDSLeon Jul 13, 2026 7/10
app GitHub

Claude Code Status on MacBook Touch Bar

Displays live Claude Code usage status on the MacBook Pro Touch Bar using MTMR and ccusage. A convenient way to monitor rate limits and usage without switching windows.

touch-barmacosstatususage-monitoring
by korrio Jul 13, 2026 6/10
app GitHub

ClaudeCodePortable: Self-Contained Portable Distribution

A self-contained, portable distribution of Claude Code and other AI coding tools for Windows, Linux, and Mac with multi-profile support, a session picker, bootstrap scripts, and Windows Explorer integration. No installation required.

portablewindowsdistributionmulti-profile
by Hawkynt Jul 13, 2026 7/10
app GitHub

Claude Code Quota Statusline: Fuel Gauge for Pro/Max

A zero-dependency, single-file fuel gauge showing how much of your 5-hour and weekly Claude Code quota remains, when it resets, and how full your context is. Prevents rate-limit surprises.

quotarate-limitsstatuslinemonitoring
by ilcristofer Jul 13, 2026 7/10
app GitHub

Roamcode: Remote Claude Code Access from Phone or Browser

A self-hosted server and installable PWA that runs Claude Code remotely from your phone or any browser, using your Claude subscription without an API key. Enables fully remote AI coding sessions.

remotepwaself-hostedmobilesubscription
by burakgon Jul 13, 2026 9/10
app GitHub

CCProxy: Use Cursor IDE with Claude Pro/Max Subscription

A one-command self-hosted bridge that connects Cursor IDE's agent and chat features to Claude via OAuth, without needing a per-token API key. Lets Claude Pro/Max subscribers use Cursor with their existing subscription.

cursorproxyoauthsubscriptionbridge
by HatriGt Jul 13, 2026 7/10
app GitHub

Kaeru: Cognitive Memory for LLM Agents

A local-first cognitive memory system for LLM agents that can be shared across a team through the cloud. Bridges individual agent memory with team-level knowledge sharing.

memoryagentsteamlocal-firstknowledge
by LamantinAI Jul 13, 2026 5/10
app GitHub

Claude Code Hermit: Always-On AI Assistant

Transforms Claude Code into an always-on AI assistant that stays ready for continuous use. Useful for developers who want persistent Claude Code availability without manual session management.

always-onpersistentassistantautomation
by gtapps Jul 13, 2026 6/10
app GitHub

Claudit: AI-Powered Smart Contract Security Audit Tool

Search and analyze 20,000+ smart contract security findings using Claude Code and Codex CLI. Provides AI-powered audit capabilities for blockchain developers.

smart-contractssecurityauditblockchaincodex
by recchan13 Jul 13, 2026 5/10
app GitHub

Claude Usage Bar: Real-Time macOS Menu Bar App

Track your Claude API usage in real time with a macOS menu bar app showing hourly and weekly stats plus detailed breakdowns. Convenient for monitoring consumption without leaving your workflow.

usagemonitoringmacosmenu-barapi
by omkargundle Jul 13, 2026 6/10
app GitHub

GlanceTerm: Terminal for Running Parallel AI Coding Agents

A macOS terminal built for running Claude Code, Codex, Gemini CLI, and opencode in parallel. A live status sidebar shows which session is working, done, or waiting for input, so you never miss an agent blocked on your response.

parallelmulti-agentterminalstatusmacos
by jessemaxh Jul 13, 2026 8/10
app Reddit

Relay-AI: Use Any Model with Claude Code, Codex, and Gemini CLI

A local proxy and app launcher that points Claude Code, Codex CLI, Gemini CLI, and Antigravity at any model — including free ones from OpenRouter, Ollama, or LM Studio. Also supports Claude Code with ChatGPT Plus/Pro accounts.

proxymodel-switchingopenrouterollamamulti-model
by KobyStam Jul 13, 2026 7/10
app GitHub

Rayline: Open-Source Local Router for Coding Agents

An open-source local router that connects Claude Code to both cloud and on-device models. Enables flexible model routing without vendor lock-in.

routinglocal-modelson-devicemodel-selection
by rayline-ai Jul 13, 2026 7/10
app GitHub

Repo-Forensics: Offline Security Scanner for AI-Agent Repos

An offline security scanner for AI-agent repositories, skills, plugins, and MCP servers. Helps audit third-party agent tooling for security issues before installation.

securityscannerofflineauditmcp-servers
by alexgreensh Jul 13, 2026 7/10
app GitHub

Pupsik: Claude Code Workspace Toolkit

A Claude Code workspace toolkit providing persistent memory, multi-account inbox MCPs, rule discipline, and auto-capture knowledge base. Bundles several workspace enhancements into one MIT-licensed package.

workspacememorymcpknowledge-basetoolkit
by mishalyalin Jul 13, 2026 7/10
app GitHub

AI Container: Sandboxed Devcontainer for Claude Code Auto-Approve

A sandboxed devcontainer for running Claude Code, Codex, and OpenCode in bypass/auto-approve mode safely. Provides an isolated environment for autonomous agent operations.

sandboxdevcontainerauto-approveisolationsecurity
by stefanoginella Jul 13, 2026 6/10
app GitHub

AI Berkshire: Value Investing Research Framework for Claude Code

A value investing research framework for Claude Code and Codex implementing Buffett, Munger, Duan Yongping, and Li Lu methodologies with multi-agent adversarial analysis.

investingfinanceresearchmulti-agentadversarial
by xbtlin Jul 13, 2026 5/10
app GitHub

C9s: Zero-Config Terminal Dashboard for Claude Code

A zero-config terminal dashboard for Claude Code that tracks all sessions, lets you switch context instantly, and ensures you never lose track of what's running across multiple projects.

dashboardterminalsession-managementmulti-session
by StefanoGuerrini Jul 13, 2026 7/10
app GitHub

CCStory: Claude Code Usage Recap with Narrative

A narrative companion to ccusage: while ccusage shows the bill, ccstory tells the story of what happened in your Claude Code sessions. Adds human-readable context to raw usage data.

usagenarrativeccusagerecapanalytics
by atomchung Jul 13, 2026 6/10
app GitHub

Headsup: Glanceable Claude Code State in Terminal Tabs

Colors terminal tabs white (idle), blue (working), or orange (waiting) to show Claude Code and Codex state at a glance. Includes a live status bar with Anthropic usage limits, window save/restore, and twelve companion skills.

terminalstatustabsmacositerm2wezterm
by wasulajr Jul 13, 2026 7/10
app GitHub

Claude-Swap: Multi-Account Switcher with Rate-Limit Rotation

Switch between multiple Claude Code accounts with automatic rate-limit rotation, a usage dashboard, and parallel sessions. Goes beyond simple account switching to actively manage rate limits across accounts.

account-managementrate-limitsrotationparalleldashboard
by realiti4 Jul 13, 2026 7/10
app GitHub

Weaver-Next: Local-First Semantic Canvas for Agent Collaboration

A local-first semantic canvas where you and your coding agent can branch ideas, switch views, and review every AI change. Provides a visual workspace for human-agent collaboration.

canvasvisualcollaborationbranchinglocal-first
by guangtouwangba Jul 13, 2026 6/10
app GitHub

CC-Cleanline: Minimalist Claude Code Status Line

A clean, minimalist status line script for Claude Code with git integration and intelligent context monitoring. Keeps your terminal statusline informative without clutter.

statuslinegitcontext-monitoringminimalist
by heysash Jul 13, 2026 6/10
app GitHub

Grok-Delegate: Hand Work from Grok Build to Claude Code

A Grok Build plugin that hands work to local Claude Code or Codex as a background task. Enables Grok to delegate implementation to Claude Code without leaving the Grok interface.

grokdelegationbackground-taskintegration
by arthurkatcher Jul 13, 2026 5/10
app GitHub

Tokibean: Claude Code Desktop Pet with Token Monitor

A pixel mascot desktop app (macOS/Windows/Linux, Tauri 2) that animates based on what Claude Code is doing in real time, plus a live token usage monitor showing 5-hour window %, weekly limit, and reset countdown.

desktop-pettoken-monitoringtauriusagevisual
by ZGhey Jul 13, 2026 7/10
app GitHub

CC-Studio: Browse and Edit Claude Code Config in Browser

Browse and edit your Claude Code configuration (~/.claude) in the browser via a single npx command. Provides a GUI for managing settings, hooks, and other Claude Code config files.

configguibrowsersettingsmanagement
by deepakkumardewani Jul 13, 2026 7/10
app GitHub

Herdr: Agent Multiplexer for the Terminal

A terminal-based agent multiplexer for running and managing multiple AI coding agent sessions. Provides a unified interface for orchestrating parallel agent work.

multiplexerterminalmulti-agentorchestration
by ogulcancelik Jul 13, 2026 6/10
app GitHub

Human: The AI Software Factory

An AI software factory pipeline where tickets, docs, designs, and analytics go in and shipped code comes out. A secure pipeline from idea to code review with Claude on the line and human approval on the floor.

factorypipelineticketsmulti-agentapproval
by gethuman-sh Jul 13, 2026 6/10
app GitHub

Scriba: Local-First Usage Tracking for Claude Code and Codex

Fast, batteries-included local-first usage tracking for Claude Code and Codex. Provides detailed usage analytics without requiring external services or network calls.

usage-trackinganalyticslocal-firstcodex
by agensfield Jul 13, 2026 7/10
app GitHub

Sanctuary Framework: Open-Source Security for AI Agents

Kernel-enforced egress control for AI agents on macOS and Linux, with keys only the operator holds and tamper-evident audit. One command protects Claude Code, Cursor, or any MCP harness with no vendor in the path.

securityegress-controlkernelauditopen-source
by eriknewton Jul 13, 2026 8/10
app GitHub

Build Studio: Mission Control for Multi-Agent Claude Code Workflows

Mission control for multi-agent Claude Code workflows, enabling you to run an AI product team across your projects. Provides centralized management for complex multi-agent development operations.

multi-agentmission-controlproduct-teamorchestration
by My-Next-Studio Jul 13, 2026 8/10
app GitHub

Lorekeeper: Self-Improving Memory System for AI Agents

A memory framework for AI agents that builds and refines its own knowledge over time. Designed to enhance agent capabilities with persistent, contextual memory that evolves with use. Useful for Claude Code workflows that need long-term context across sessions.

memoryagentscontextpersistence
by Jessinra Jul 13, 2026 5/10
app GitHub

TokenUse: Rust TUI and Desktop App for AI Coding Tool Token and Cost Tracking

A native Rust application offering both a terminal UI and desktop GUI for monitoring token and cost usage across AI coding tools including Claude Code. Provides a lightweight, fast interface for real-time usage visibility. Useful for developers who want to track spend and efficiency without leaving the terminal.

token-usagecost-trackingrusttuidesktop-appclaude-code
by russmckendrick Jul 13, 2026 7/10
app GitHub

CC-Remote: Run Claude Code Securely in Docker Sandboxes on Your VPS

A self-hosted platform that runs Claude Code inside isolated Docker containers on a VPS, with a web-based multi-session manager for spinning up instances on demand. Features GitHub OAuth for access control, automatic repo cloning, and Git identity mapping per session. Ideal for teams or individuals wanting secure, remote Claude Code access without local machine constraints.

dockervpsremotesecurityself-hostedmulti-sessiongithub-oauth
by sgomez Jul 13, 2026 9/10
app GitHub

MLX-Serve: Native Apple Silicon LLM Inference Server with Anthropic API Compatibility

A native LLM inference server for Apple Silicon with no Python dependency, offering both OpenAI and Anthropic API compatibility out of the box. Includes MLX Core, a macOS app with chat interface, agent mode, and tool calling support. Claude Code users can point it at a local model using the same API they already use.

apple-siliconlocal-inferencemlxanthropic-apimacostool-calling
by ddalcu Jul 13, 2026 6/10
app GitHub

Claude Code Router: Route Sessions to Any OpenAI/Anthropic-Compatible Model

A local gateway that intercepts Claude Code sessions and routes them to any OpenAI-compatible or Anthropic-compatible model endpoint, including local models. Supports switching models within the same session with visible compatibility behavior. Useful for cost optimization or experimenting with alternative models.

routingmodelsopenai-compatiblelocal-modelsgateway
by hishamkaram Jul 13, 2026 7/10
app GitHub

Session Indexer: Semantic Search Over Your Claude Code Session History

Indexes Claude Code JSONL session transcripts into SQLite per-project for semantic retrieval. Uses bge-m3 embeddings via Ollama for vector similarity search, with FTS5 full-text search as a fallback. Lets you find past solutions, decisions, and context across all your Claude Code sessions.

searchembeddingssqlitesessionsollamafts5
by valpere Jul 13, 2026 8/10
app Reddit

Don't Die on Me Now — Prevent macOS Sleep During Agent Runs

macOS app that prevents your Mac from sleeping while AI agents are working. Built for developers who run agents on the go. Available on GitHub as a community contribution.

macosproductivityagentssleep
by Chance_Confection_37 Jul 13, 2026 7/10
app GitHub

Vallum — Security Boundary Proxy for AI Coding Agents

Single Rust binary that sits between AI coding agents and your shell. Redacts secrets, neutralizes prompt injection, wraps untrusted terminal output, and audits every command. Useful for running agents in shared or less-trusted environments.

securityrustproxyprompt-injectionshell
by kahramanemir Jul 13, 2026 8/10
app GitHub

Alera — Native ADE for Running Coding Agents in Parallel

Native desktop application (Flutter + Rust + Ghostty) for running CLI coding agents like Claude Code, Aider, and Copilot in parallel using Git worktrees. Designed as a performance-first Agentic Development Environment.

worktreesparallelagenticideflutterrust
by leynier Jul 13, 2026 8/10
app GitHub

AI Tabs — Manage Multiple AI CLI Tools in VS Code

VS Code extension for running multiple AI command-line tools (Claude Code, Codex, etc.) in separate tabs to reduce context switching. Designed for macOS developer workflows involving several AI agents.

vscodeterminalworkflowmacos
by theabhishekrishnan-star Jul 13, 2026 6/10
app GitHub

Tandem — Pair Coding Agents with Nontechnical Stakeholders

Lets a nontechnical stakeholder write directly into a coding agent's prompt while the developer runs it. Bridges the gap between technical and nontechnical contributors in AI-assisted development.

collaborationstakeholderpair-programmingux
by mherzog4 Jul 13, 2026 6/10
app Reddit

Ginsu — Use Claude Code to Drive a Codex Worker in a Terminal

CLI wrapper that makes Claude Code the message bus for a Codex worker running in a watchable terminal window. Claude plans and orchestrates while Codex executes edits; replies flow back automatically and sessions persist. MIT-licensed.

multi-agentcodexterminalorchestrationmit
by AccomplishedLab3697 Jul 13, 2026 8/10
app GitHub

Claude Status Bar — macOS Menu Bar Monitor for Claude Code

macOS menu bar app that shows real-time indicators for active Claude Code tasks, pending permissions, and elapsed time. Keeps you aware of agent activity without switching windows.

macosmenu-barmonitoringstatus
by peaceinitiativemenhadenoil263 Jul 13, 2026 7/10
app GitHub

Backthread — Capture the Why Behind AI-Coded Changes

Tracks not just what AI coding agents ship but why each change was made, turning the commit history into a queryable living view of how your codebase works. Bridges the gap between AI-generated diffs and human understanding.

documentationcode-historyai-developmentknowledge
by backthread Jul 13, 2026 7/10
app GitHub

Usage Monitor — macOS Menu Bar Claude Usage Gauges

macOS menu bar app that displays Claude usage limits as battery-style gauges for at-a-glance monitoring. A quick way to track how much of your subscription quota remains.

macosmenu-barusagelimits
by jackfieldman Jul 13, 2026 7/10
app GitHub

Binggupack — Local-First Personal Memory Engine for AI Work

Stores decisions, mistakes, preferences, and rules accumulated from AI work sessions — but only what you explicitly approve. Surfaces approved memories before the next task. PC-local with no auto-save.

memorylocal-firstknowledgepersonal
by darkjokee-arch Jul 13, 2026 6/10
app GitHub

Muxel — GPUI-Native Terminal Multiplexer for Coding Agents

Terminal multiplexer built with GPUI specifically for running multiple coding agents side by side. Native performance with a UI framework designed for modern developer tools.

terminalmultiplexergpuimulti-agent
by ProjectHax Jul 13, 2026 6/10
app GitHub

Mac YOLO Safeguards — OS-Level Limits for AI Agent Loops

Adds runaway-kill, timeout, and resource limit guardrails at the OS level for coding agents (Claude Code, Cursor, Codex) running in YOLO mode on macOS. Prevents agents from burning tokens or freezing your machine.

safetymacosyolo-moderesource-limitsguardrails
by IgorGanapolsky Jul 13, 2026 7/10
app GitHub

CCTeam — Self-Hosted Mission Control for Claude Code and Codex

Run a team of always-on background coding agents (Claude Code, Codex) and drive them from Telegram, Lark, or a web interface. Self-hosted with 24/7 agent availability.

multi-agenttelegramself-hostedmission-control
by firstintent Jul 13, 2026 7/10
app GitHub

Claude Code Recap — Browse and Resume Past Sessions Across Projects

CLI tool that lists all recent Claude Code sessions across your projects, showing project path, summary, git branch, model, and turn count with a ready-to-paste resume command. Can reopen a whole working set in terminal tabs. No network or telemetry.

sessionshistoryproductivityresumecli
by noluyorAbi Jul 13, 2026 8/10
app GitHub

Curriculos AI — Local-First Job Application Automation

AI-powered interview maximizer with a mechanical truthfulness guardrail for local job application automation. Built end-to-end with AI-assisted development using Claude Code.

job-searchinterviewautomationlocal-first
by rafacardias Jul 13, 2026 5/10
app GitHub

Clawd on Desk — Pixel Desktop Pet That Watches Coding Agents

Pixel art desktop pet that monitors Claude Code, Codex, Cursor, and other AI coding agents so you do not have to constantly check on them. Lightweight ambient awareness for agent status.

desktop-petmonitoringfunambient
by rullerzhou-afk Jul 13, 2026 5/10
app GitHub

Dinotty — Multi-Device Terminal Server for AI Coding Agents

Self-hosted terminal server with server-side VTE, session persistence, file browser, web preview, and a plugin system. Gives AI coding agents a stable, persistent terminal environment accessible from multiple devices.

terminal-servermulti-deviceself-hostedsession-persistence
by xichan96 Jul 13, 2026 7/10
app GitHub

clauster: Self-Hosted Web UI for Managing Claude Code on a Remote Host

clauster is a homelab-friendly web UI that lets you spawn and manage Claude Code remote-control bridges from any browser or phone. It provides start/stop controls, permission mode switching, a CLAUDE.md editor, git clone support, live log tailing, and cost tracking — with loopback-by-default security and no telemetry. Ideal for running Claude Code on a home server and accessing it remotely.

homelabself-hostedremoteweb-uiclaude-code
by schubydoo Jul 12, 2026 8/10
app GitHub

agent-deck: TUI Session Manager for Claude Code and Other AI Agents

agent-deck is a terminal user interface (TUI) that unifies session management across multiple AI coding agents including Claude Code, Gemini, OpenCode, and Codex. It provides a single pane of glass for launching, switching, and monitoring multiple agent sessions simultaneously. Useful for developers who juggle several AI coding tools and want a consistent terminal-based workflow.

tuisession-managerterminalmulti-agent
by asheshgoplani Jul 12, 2026 7/10
app GitHub

sshepherd: Zero-Knowledge SSH Ops CLI for Claude Code Agents

sshepherd lets Claude Code and other AI agents perform SSH operations — server health checks, Docker/systemd control, read-only Postgres introspection, and declarative deploys — without the agent ever seeing passwords, keys, hostnames, or ports. Secrets are kept entirely outside the agent context, making it safe to delegate infrastructure tasks to an AI coding agent. A practical tool for devops workflows that involve AI assistance.

sshdevopssecurityzero-knowledgeclaude-code
by Antheurus Jul 12, 2026 8/10
app GitHub

ClaudePortable: Backup and Restore Claude Code and Desktop State

ClaudePortable packages your Claude Desktop, Cowork projects, and Claude Code state into a single ZIP file for backup or cloud sync. It makes it easy to migrate between machines or restore your full Claude environment after a reinstall. A handy utility for users who want portable, recoverable Claude setups.

backupportabilityclaude-codeclaude-desktopmigration
by Carliemajuscular804 Jul 12, 2026 7/10
app GitHub

galley: Local-First Task Runner with Supervised Execution for Claude Code

galley is a task runner designed for Claude Code, Codex, and GLM that emphasizes supervised execution and clean handoffs to pull requests. It keeps tasks local-first while providing structured workflow management for AI coding sessions. A good fit for developers who want a controlled, auditable way to manage AI agent tasks.

task-runnersupervisedlocal-firstpr-handoffclaude-code
by shinpr Jul 12, 2026 7/10
app GitHub

conch: Hands-Free Voice Loop for Claude Code Sessions

conch adds a voice interface to Claude Code — sessions speak when they finish and you talk back using your microphone. It uses local whisper.cpp for speech-to-text with session-aware routing, enabling completely hands-free coding workflows without any cloud dependencies. A creative way to keep your hands on the keyboard while still directing your AI coding sessions.

voicewhisperhands-freespeech-to-textclaude-code
by stupart Jul 12, 2026 8/10
app GitHub

claude-codex-queue: Auto-Queue Claude Code Sessions After Usage Limits

claude-codex-queue queues Claude Code and Codex App tasks and automatically continues them after usage limits reset, preserving settings and prompt order. It is a practical solution for power users who frequently hit rate limits and want uninterrupted workflow continuity. Handles both Claude Code and Codex App tasks in the same queue.

rate-limitsqueueautomationclaude-codecontinuity
by ravhello Jul 12, 2026 7/10
app GitHub

constant: Live-Switch Between Claude Code, Codex, and OpenCode Mid-Thread

constant maintains one conversation thread while letting you switch between Codex, Claude Code, and OpenCode agent runtimes at any point mid-session. It keeps a durable record of every exchange so context is never lost when moving between agents. Useful for users who want to leverage different agent strengths without losing conversational continuity.

multi-agentruntime-switchingcodexclaude-codeconversation
by kennykankush Jul 12, 2026 6/10
app GitHub

tron: Deterministic Supervisor That Builds Software from Specs

Tron is a single-agent interface that manages a fleet of underlying agents to build software from specification documents. You talk to one agent and it coordinates the work across the fleet. Useful for structured, spec-driven development workflows.

multi-agentorchestrationspec-drivenautonomous
by 4242labs Jul 12, 2026 7/10
app GitHub

caliper: Local-First Eval Harness for Claude Code and Codex

Caliper is an evaluation harness for comparing AI coding agents — Claude Code, Codex, Hermes, and Pi skills. Runs locally, useful for benchmarking changes to prompts, skills, or agents before deploying them.

evalbenchmarktestingskillscomparison
by edonadei Jul 12, 2026 7/10
app Reddit

skyline-run: Fly Through Your GitHub Contribution Graph as a 3D Game

A web game where each day you committed becomes a building and busy days become skyscrapers. Type any GitHub username and pilot a plane through your contribution history. Built with Claude Fable during "quota panic" — works on desktop and mobile with tilt controls.

gamegithubvisualizationfablevibe-coding
by Clear_Reserve_8089 Jul 12, 2026 5/10
app Reddit

tokenbill: CLI to Itemize Where Your Claude Code Tokens Go

A zero-config CLI that reads your local Claude Code session logs and produces an itemized breakdown of token usage. Runs 100% locally with no configuration needed. Useful for understanding which operations consume your subscription budget.

token-usageanalyticsbudgetclisubscription
by Awacer Jul 12, 2026 6/10
app Reddit

Claude Commander: Multi-Account Manager with Zero-Context-Loss Failover

A local-first Tauri desktop app (Rust + React) that manages multiple Claude accounts as one resource pool. Features live 5-hour usage tracking, automatic failover that moves sessions to another account when a limit is hit, auto-wake on reset, and an Operator → Workers delegation model. Apache 2.0, no telemetry.

multi-accountfailoverusage-limitstauridesktoporchestration
by rohanbeingsocial Jul 12, 2026 8/10
app GitHub

ai-router-switch: Self-Hosted Claude Code Proxy with Automatic Failover

A transparent self-hosted proxy for Claude Code that switches between Claude and MiniMax with automatic failover, context compression, and cross-model verification. Single endpoint, zero IDE restarts needed when switching models.

proxyfailoverroutingminimaxcontext-compression
by eroslifestyle Jul 12, 2026 6/10
app GitHub

stuff: Parametric 3D-Printable Designs Authored with Claude Code

A collection of parametric 3D-printable designs created with Claude Code, paired with a Next.js + WASM web UI for live parameter sliders and STL export. A concrete example of using Claude Code for hardware/CAD workflows.

3d-printingcadparametricnextjswasmhardware
by SeanOC Jul 12, 2026 5/10
app GitHub

PyCostAudit: Real-Time LLM Cost Tracking Across File Formats and Operations

Real-time LLM cost tracking that measures file format cost differences (36x variance), operation type variance (55x), data warehouse query costs (100x-1000x+), and SaaS MCP inefficiency (10x-100x). Claims to be the only tool tracking actual spending patterns rather than raw token counts.

costtrackingoptimizationllmanalyticsmcp
by Mullassery Jul 12, 2026 7/10
app Reddit

I'm going to really miss fable

TLDR: Opus is surprisingly frustrating compared to Fable When talking to Opus 4.8 xhigh using ultracode, I feel like I am in a Monty Python skit. I primarily use Fable for adverdsarial review of a ...

pythonreview
by Plus_Opening_4462 Jul 12, 2026 5/10
app GitHub

PageIndex RAG: Vectorless RAG Using Reasoning-Based Retrieval

Implements RAG without embeddings or a vector store by using reasoning-based retrieval and answer generation. An interesting alternative approach for codebases or setups where vector infrastructure is unavailable.

ragretrievalreasoningno-embeddings
by Deafened-vascularstructure846 Jul 12, 2026 6/10
app GitHub

Jira Dashboard: Self-Hosted AI Coding Kanban with Per-Ticket Worktrees

A self-hosted end-to-end AI coding kanban with no companion daemon, no cloud account, and no agent lock-in. Goes from a one-line idea to a reviewed PR with per-ticket git worktrees, interactive clarification, and live agent streaming.

kanbanworktreeself-hostedprworkflowproject-management
by Cutuy Jul 12, 2026 8/10
app GitHub

Leo: Claude Code Agents as Persistent Personal Assistants with Telegram

CLI tool that sets up and manages Claude Code agents as persistent, proactive personal assistants with Telegram integration and cron scheduling. Agents survive session restarts and can send proactive notifications via Telegram.

apptelegrampersistentcronpersonal-assistant
by blackpaw-studio Jul 12, 2026 7/10
app GitHub

Project Forge: Autonomous Idea Generator with 3-Axis Scoring

Autonomous project idea generator scoring on feasibility (build), fundability (sell), and ambition (frontier) axes. Uses LLM-first generation with 5 modes × 12 personas across 19 categories, with human-gated promotion to GitHub. Runs at ~$2-3/mo on Haiku 4.5 or free via Claude Code CLI.

appideationscoringbrainstormingautomation
by rayketcham-lab Jul 12, 2026 7/10
app GitHub

NIMbus: Proxy Anthropic API Requests to NVIDIA NIM Endpoint

A lightweight FastAPI proxy that translates Anthropic API requests to NVIDIA NIM's OpenAI-compatible endpoint. Useful for running Claude Code-style workflows against locally-hosted NVIDIA AI models.

proxynvidianimlocalapi
by cyberofficial Jul 12, 2026 6/10
app GitHub

Lucarne: Mobile Control Bridge for Local AI Agents via Telegram

Stop babysitting local AI agents — Lucarne sends notifications and lets you approve/resume Codex, Pi, Grok, or Claude Code sessions from anywhere via Telegram, WeChat, or Feishu. Zero-intrusion: no hooks, no skills, no MCP required.

appmobiletelegramnotificationsapprovalremote
by tuchg Jul 12, 2026 7/10
app GitHub

CC Reminder Pi: Physical Claude Code Status Light on Raspberry Pi Zero W

Builds a physical status light and usage gauge for Claude Code using a Pi Zero W, WS2812 LED ring, 3D-printed case, and web UI. A fun hardware project that makes Claude Code session state visible in the physical environment.

appraspberry-pihardwarestatusledmonitor
by silpdev Jul 12, 2026 7/10
app GitHub

HereAssistant: Telegram Bot Bridging Claude Code, Codex, and Gemini CLI

A Telegram bot that bridges Claude Code, Codex, and Gemini CLI agents with privacy-first design — projects are private by default and CRM sync is explicit opt-in. Enables mobile management of multiple AI coding agents.

apptelegrammobilemulti-agentprivacy
by Creative-Agency-Here Jul 12, 2026 7/10
app Reddit

AI Account Hub v1.1: Windows App for Managing Multiple AI Coding Accounts

Windows application for organizing multiple AI coding accounts, switching between them, tracking usage limits, and seeing when accounts will reset. Adds a system tray widget, custom notifications for limit warnings, and usage statistics comparing models, token categories, and task counts.

appwindowsaccount-managementusagestatistics
by Batty25111 Jul 12, 2026 7/10
app GitHub

TangleClaw: AI Coding Session Orchestrator with Persistent tmux Sessions

AI coding session orchestrator with persistent tmux sessions, multi-engine management, methodology enforcement, and mobile access for Claude Code, Codex, Gemini CLI, Aider, and OpenClaw. Keeps sessions alive across disconnects and coordinates work across agents.

apptmuxorchestratorpersistentmulti-enginemobile
by Jason-Vaughan Jul 12, 2026 7/10
app GitHub

Agent Skills Hub: Discover and Compare Open-Source Agent Skills

Discover and compare open-source Agent Skills, tools, and MCP servers with quality scoring, trending analysis, and automated GitHub sync. A searchable registry for finding the best skills in the ecosystem.

appregistrydiscoveryskillsmcp
by zhuyansen Jul 12, 2026 7/10
app GitHub

Claude Code Model Rotator: Connect Claude Code to Ollama and OpenRouter

Dynamic proxy that connects Claude Code to local Ollama models and OpenRouter, bypassing ecosystem locks and enabling use of free or self-hosted APIs. Useful for developers who want to experiment with alternative models within Claude Code workflows.

proxyollamaopenroutermodelsself-hosted
by tullextraterrestrial3175 Jul 12, 2026 6/10
app GitHub

Vidura: Local Counselor That Reads Claude Code Sessions for Friction Analysis

A local tool that reads your Claude Code sessions and tells you the truth about where friction occurs — headed toward a menu-bar companion that acts on its own advice. Helps developers understand patterns in how they work with Claude Code.

appanalyticssessionsfrictionimprovementself-reflection
by mannasdev Jul 12, 2026 7/10
app GitHub

Model Usage CLI: Analyze AI Usage and Costs Across All Local TUI Tools

Zero-config CLI for analyzing AI model usage and costs across all local TUI tools including pi, Claude Code, Codex, Gemini CLI, OpenCode, and more. Aggregates usage data into comparable reports without any configuration.

appusageanalyticscostmulti-toolcli
by evanlong-me Jul 12, 2026 7/10
app GitHub

ClaudeCodeStatusLine: Real-Time Token Usage and Rate Limits in Status Line

Displays real-time Claude Code model info, token usage, and rate limits in a compact status line without affecting performance or token counts. A lightweight monitoring widget for developers who want live session metrics.

appstatus-linemonitoringtokensrate-limits
by Scorpiolover Jul 12, 2026 7/10
app GitHub

Build My Own Harness: Production-Grade Python LLM Agent Harness

Production-grade Python LLM agent harness and framework-design case study covering tool loop, MCP, sandbox, and sub-agents in 17 phases over 23 days. A detailed learning-by-building guide for agent harness architecture.

appharnesspythonmcpagentstutorial
by maisieyang Jul 12, 2026 7/10
app GitHub

ccmux: Track All AI Coding Agents in tmux and Jump to What Needs You

Tracks all AI coding agents (Claude Code, Codex, Cursor, etc.) in tmux and lets you jump instantly to whichever one needs attention. A lightweight tmux-based multiplexer built specifically for managing multiple concurrent AI coding sessions.

apptmuxmonitoringmulti-agentnavigation
by epilande Jul 12, 2026 7/10
app GitHub

Claude for Word Desktop: AI Writing Assistant in Microsoft Word

Integrates Claude AI directly into Microsoft Word desktop to write, edit, and summarize documents without leaving the application. Provides a native Word add-in experience for AI-assisted document work.

appwordmicrosoftintegrationwriting
by fatinzark-stack Jul 12, 2026 5/10
app GitHub

Stacklit: One-Command Codebase Indexer for AI Agents

Indexes codebases for AI agents with a single command, building a local map of your repository with no server requirements or setup. Useful for giving agents quick codebase orientation without uploading code externally.

indexingcodebasecontextlocal
by royals7272 Jul 12, 2026 6/10
app GitHub

Engram: Universal Context Spine for AI Coding Tools

Connects your codebase to AI coding tools through a universal context spine that maintains shared project understanding across agents and sessions. Acts as a persistent context layer bridging multiple AI tools against a single codebase.

contextcodebaseintegrationmemory
by Republicofhaitigoodstory6175 Jul 12, 2026 6/10
app GitHub

XaresAICoder: Browser-Based AI Dev Environment with Multiple AI Assistants

Professional browser-based AI development environment integrating VS Code (code-server) with multiple AI coding assistants for enhanced productivity. Provides a self-hosted workspace where you can run different AI tools alongside VS Code in a browser.

idebrowservscodemulti-modelself-hosted
by DG1001 Jul 12, 2026 6/10
app GitHub

Dario: Use Claude Pro/Max Subscription in Cursor, Cline, and Aider

Routes traffic from third-party AI tools (Cursor, Cline, Aider, Agent SDK) through a local endpoint that replays Claude Code's wire protocol, so requests are billed against your subscription pool instead of per-token API pricing.

subscriptionproxycursorclinecost
by askalf Jul 12, 2026 7/10
app GitHub

KittyClaw: Kanban Board for AI Agents with API-Driven Management

A kanban board for managing projects with tickets, columns, labels, and activity tracking, specifically designed to be driven by AI agents via its API. Enables agents to create, move, and close tickets programmatically as part of their workflow.

kanbanproject-managementapiagents
by Ekioo Jul 12, 2026 6/10
app GitHub

forge-kit: Codebase-Aware Governance Tool Installer for Claude Code

forge-kit reads your codebase and installs adapted governance tools including ticket gates, code reviewers, and security auditors — tailored to what it finds, not generic defaults. Built specifically for Claude Code, it aims to add structured governance to AI-assisted development without the usual manual configuration.

governancecode-reviewsecurityautomation
by agigante80 Jul 11, 2026 7/10
app GitHub

hippocampus: Personal Second Brain Built on Claude Code and Obsidian

hippocampus integrates Claude Code with Obsidian to build a personal second brain. Uses Claude Code as the intelligence layer on top of an Obsidian vault, enabling AI-assisted capture, recall, and reasoning across your personal knowledge base.

second-brainobsidianknowledge-managementmemory
by Sturlese Jul 11, 2026 6/10
app GitHub

workspace.nvim: Multi-Repo Neovim Workspace with Claude Code Sessions Browsable and Resumable

workspace.nvim gives Neovim a unified workspace across all your repos with Claude Code wired directly into the editor. Supports named workspaces, multi-repo source control, and browsing or resuming past Claude Code sessions from within the editor — built on vim.pack without requiring lazy.nvim or neo-tree.

neovimeditor-integrationsession-managementmulti-repo
by kriuchkov Jul 11, 2026 7/10
app GitHub

agent-teams-ai: Multi-Agent Kanban with Claude, Codex, and 75+ LLM Providers

agent-teams-ai treats AI agents as a team: agents handle tasks autonomously, message each other, and review each other work, while you watch a kanban board and issue high-level commands. Supports Claude Code, Codex CLI, OpenCode, and 75+ LLM providers including free models.

multi-agentkanbanorchestrationteam-ai
by 777genius Jul 11, 2026 7/10
app GitHub

cognitive-core: Self-Hosted Docker Stack for Multi-LLM Agent Rooms

cognitive-core is a self-hosted Docker stack that creates shared rooms where Claude Code, ChatGPT, and any other LLM can collaborate. MIT licensed, it provides local infrastructure for running multi-model agent conversations without cloud services.

self-hosteddockermulti-modelcollaboration
by mocartlex-wq Jul 11, 2026 6/10
app GitHub

athenaeum: Open-Source Knowledge Management Pipeline with Tiered Compilation

athenaeum is an open-source knowledge management pipeline with passive recall, append-only intake, tiered compilation, and configurable schemas. Designed as an AI-readable knowledge store with nightly consolidation passes similar to how LLMs process training data.

knowledge-managementmemorypipelineopen-source
by Kromatic-Innovation Jul 11, 2026 5/10
app GitHub

CodexBar: Claude Code and Codex Usage Stats Without Login

CodexBar is a menu bar app that shows usage statistics for both OpenAI Codex and Claude Code without requiring you to log in to any web dashboard. Provides quick at-a-glance visibility into AI coding session consumption directly from your menu bar.

usage-statsmenu-barmonitoringproductivity
by steipete Jul 11, 2026 6/10
app GitHub

Prismor: Runtime Firewall for AI Agents — Stops Dangerous Commands Before Execution

Prismor is a runtime firewall that intercepts tool calls before they run, catching dangerous commands, secret leaks, and prompt injection attempts. Works with Claude Code, Codex, and other framework SDKs as a pre-execution safety layer for both attended and unattended sessions.

securityfirewallprompt-injectionsafetyruntime
by PrismorSec Jul 11, 2026 8/10
app GitHub

claude-control: Remote-Controllable Claude Code Sessions Across Projects

claude-control enables dispatching and controlling Claude Code sessions for many projects from a single always-on session on macOS. Useful for managing long-running or parallel Claude Code sessions without switching contexts manually.

remote-controlmacossession-managementautomation
by dewil Jul 11, 2026 8/10
app GitHub

sh-guard: Shell Command Risk Classifier for AI Coding Agents

sh-guard uses AST analysis and risk scoring to classify shell commands before AI coding agents execute them. Helps catch dangerous operations at the shell execution boundary, providing a safety layer for unattended agent runs.

securityshellrisk-scoringast-analysis
by ambassadorial-vinegarworm656 Jul 11, 2026 7/10
app Reddit

Building a Personal AI Memory OS with 14 Digital Streams Using Claude Code

A developer built a personal SaaS (Sillage + Mogwai) using Claude Code without prior coding experience, aggregating 14 digital streams including screen, audio, Slack, Gmail, calendar, GitHub, and Apple Health. An AI agent named Mogwai lives in this memory and proactively sends morning briefings and meeting prep via iMessage.

personal-aimemoryautomationproductivityno-code
by LateList1487 Jul 11, 2026 5/10
app GitHub

codex-sidecar: Safe Isolated Execution for Code Reviews and Risk Checks

codex-sidecar provides safe sidecar execution for code reviews, codebase exploration, risk checks, and isolated worktree fixes. Runs alongside AI coding agents as a sandboxed companion for operations that need isolation from the main workspace.

sidecarsafetycode-reviewworktreeisolation
by kitepon-rgb Jul 11, 2026 6/10
app GitHub

Harness: Desktop Coding Agent with iPhone Remote and Multi-Model Chat

The Harness family is a single repo covering a desktop coding agent (any model), an iPhone app that remotely controls your computer agents, and a ChatGPT-style chat client supporting OpenRouter and on-device MLX. Aims to cover the full personal AI coding stack across desktop and mobile.

desktop-agentiosmulti-modelremote-control
by TheRealJadenKwek Jul 11, 2026 6/10
app Reddit

unsnooze: Auto-Resume Claude Code Sessions After Usage Limit Resets

unsnooze monitors Claude Code sessions in tmux and automatically resumes them when the usage limit resets, reading the reset time from the banner and pressing Enter at the right moment. If the pane is closed, it reopens the session. Supports Claude Code, Codex CLI, VS Code extension, desktop app, and experimental Grok.

usage-limitstmuxautomationproductivity
by saaransh_28 Jul 11, 2026 7/10
app GitHub

openbook: Open-Source Report Formats for Long-Horizon Agent Runs

openbook provides open-source report formats designed to make long-horizon agent work readable by humans. It structures agent output into legible summaries suited for reviewing what AI agents actually accomplished across extended sessions. Useful when you need accountability and clarity from autonomous agent work.

reportingagent-outputreadabilitylong-horizon
by mirror-factory Jul 11, 2026 7/10
app GitHub

check-cc: Claude Account Environment Detection and Risk Analysis Tool

A web-based tool that analyzes your Claude environment and account risk before registering, subscribing to Claude Pro, or using Claude Code. Helps detect conditions that might lead to account bans or API access failures. Particularly useful for users in regions with access restrictions.

account-healthdiagnosticsclaude-code
by yacuo Jul 11, 2026 5/10
app GitHub

clawd-deck: Claude Code Control Room for Stream Deck — Session Board, Usage Gauges, Activity Heatmap

A Rust-powered Stream Deck integration that turns your physical Stream Deck into a Claude Code control room. Displays an animated session board with live session states, usage gauges tracking token consumption, and an activity heatmap. Designed for developers who want hardware-level monitoring without switching to a browser.

stream-decksession-monitoringhardwareuirust
by ToniAlmirano Jul 11, 2026 8/10
app Reddit

Fleet Deck: Local Mission Control Board for All Claude Code Sessions with Conflict Radar

A local dashboard at 127.0.0.1:4711 that tracks every Claude Code session with callsigns and a state column (queued→working→verifying→needs-you→idle→offline) driven by hook telemetry. Features a conflict radar for detecting when two sessions edit the same file, a needs-you rail to approve permission prompts from the board, inter-session messaging, session spawning, and a live xterm.js terminal in the browser.

session-monitoringmulti-agentconflict-detectionhooksdashboard
by lacion Jul 11, 2026 9/10
app GitHub

pocket-command-system: Telegram-Based Command and Control for Claude Code Worker Fleets

A system for managing fleets of Claude Code AI worker machines from your phone via Telegram, featuring a real-time dashboard, automated auditor governance, and bulk deployment capabilities. Supports coordinating multiple PCs running Claude Code workers with centralized oversight.

telegramfleet-managementmobiledashboardgovernance
by SUNWOONGKYU Jul 11, 2026 5/10
app GitHub

Semantica CLI: AI Code Provenance and Attribution Across Git History

A CLI tool that makes AI code contributions visible — tracking provenance, attribution, and semantic lineage across commits, pull requests, and repositories. Useful for teams that want to audit how much of their codebase was AI-generated and trace the origin of AI-written changes.

gitprovenanceattributionauditai-codecli
by semanticash Jul 11, 2026 6/10
app GitHub

AgentNap: Reclaim RAM Leaked by Claude Code and MCP Servers on Mac

A Mac utility that monitors and reclaims memory leaked by Claude Code, Codex, and MCP servers during idle periods. Takes an advisor-first approach — it suggests rather than kills — so it never interrupts active work. Addresses a common issue where long-running Claude Code sessions gradually consume more RAM.

macosmemoryperformancemcputility
by nguyenngocduyphuc Jul 11, 2026 7/10
app GitHub

Claude Feedback Rings: Context Rot and Rate-Limit Monitor for Claude Code

A proactive monitor that tracks context window degradation and rate limits during Claude Code sessions. Alerts you before hitting limits that cause incomplete responses or context loss, helping maintain session quality over long coding sessions.

contextmonitoringrate-limitsutility
by YoniYon00 Jul 11, 2026 5/10
app Reddit

I built PackMind, a local second brain for Claude Code

I built PackMind to solve a problem I kept having with Claude Code, useful project context, decisions, and previous fixes disappearing between sessions. PackMind adds persistent project memory, loc...

mcphookworkflowgit
by Dizzy_Basil6892 Jul 11, 2026 9/10
app Reddit

Token consumption: Fable vs. Sol Ultra.

This isn't intended to be a technical analysis of token consumption, but rather the practical experience of a heavy user on top-tier subscriptions (the $200 GPT Pro plan and the $200 Claude plan). ...

workflowconfig
by Admirable_Garbage208 Jul 11, 2026 8/10
app GitHub

sshq: Agent-Native SSH Multiplexing CLI

An SSH multiplexing CLI designed for AI agent use, enabling agents to manage multiple SSH connections efficiently as part of automation workflows.

sshmultiplexingcliautomationremote
by shayuc137 Jul 11, 2026 7/10
app GitHub

temper: Typed Maintenance Surface for the Claude Code Harness

Declares a contract for the Claude Code harness and gates on conformance — described as 'the Rust of agentic harnesses'. Ensures the harness behaves predictably over time.

harnesscontractstypedconformancemaintenance
by duct-tape-and-markdown Jul 11, 2026 7/10
app GitHub

the-wire: Autonomous AI Newsroom Run by Claude Code Agents

Claude Code agents research, write, edit, and fact-check a weekly journal autonomously. A real-world example of multi-agent content production pipelines.

autonomousnewsroommulti-agentcontent-generationfact-checking
by albertogrande Jul 11, 2026 7/10
app GitHub

5dive: Run a Company of AI Agents on a Server You Own

Spin up named agents on an org chart with a shared backlog, let them hand off work and ping your phone only when a human must decide. MIT licensed, self-hosted.

multi-agentself-hostedorg-chartautonomousnotification
by 5dive-ai Jul 11, 2026 7/10
app GitHub

box: Self-Hosted Claude Code in Your Pocket

Runs real Claude Code and Codex sessions on your own server, driven from your phone with a native chat UI, voice, files, skills, and always-on availability.

self-hostedmobilephonechat-uivoicealways-on
by incidentfox Jul 11, 2026 7/10
app GitHub

TokenTracker: Track Token Usage Across 25 AI Coding Tools

Local-first, zero-config dashboard tracking usage for Claude Code, Codex, Cursor, Gemini, Kiro, and 20+ more tools. Includes macOS menu bar app and desktop widgets.

token-trackingusagedashboardlocal-firstmenu-bar
by mm7894215 Jul 11, 2026 7/10
app Reddit

Snitch: Deterministic Prose Claim Verifier for AI Coding Agent Transcripts

Watches agent transcript files, extracts claims using deterministic regex, and cross-references them against tool calls, shell output, filesystem, and git. Flags when agent words do not match evidence — no LLM, fully local, macOS menu bar app.

verificationclaimstranscriptsauditlocaldeterministic
by Mrsomud007 Jul 11, 2026 8/10
app Reddit

familiar: Kitty Terminal Overlays for Reviewing Claude Code Diffs and Sessions

Three full-screen overlays for the kitty terminal: review (two-pane diff with line-comment feedback loop), session (jump between all Claude Code sessions with live status), and log (git history browser). Pure Python stdlib.

terminalkittydiff-reviewsession-managementgit-history
by deno_by Jul 11, 2026 8/10
app GitHub

claude-tap: Intercept and Inspect Coding Agent API Traffic

Traces API calls from Claude Code, Codex CLI, Gemini CLI, Cursor CLI, OpenCode, and others in a local trace viewer. Essential for debugging agent behaviors and auditing model calls.

debuggingapi-tracingobservabilitycodexgeminilocal
by liaohch3 Jul 11, 2026 8/10
app GitHub

lectern: One Engine for Claude Code, Antigravity, and OpenCode

Shared brain, a Conductor that routes each task to the best model, and one session history across desktop, terminal, and CLI. Local-first, Apache-2.0 licensed.

multi-agentroutingshared-brainsessionlocal-first
by ShrimpScript Jul 11, 2026 8/10
app GitHub

claude-pace: Execution-Policy Layer for Claude Code

Adapts exploration, subagents, scope, and validation to available usage signals, context pressure, and task size. Complements usage monitors to keep Claude Code sessions productive.

usagepolicysubagentscontext-managementadaptive
by ablhub Jul 11, 2026 8/10
app GitHub

claude-governor: Budget-Aware Agent Loop for Claude Code

The model sees its own 5h/7d quota and context budget every turn, economizes under pressure, checkpoints durably, and never loses subagent work to a usage-limit cutoff.

budgetusage-limitsquotacheckpointingsubagents
by prathameshkadam130404 Jul 11, 2026 8/10
app GitHub

token-goat: Token Burn Reducer for Claude Code and Other AI Coding Tools

Reduces token consumption for Claude Code, Codex, Gemini CLI, and more with surgical read hints, PDF/Office/CSV/markdown file interception, 160+ filter rules, compact manifest injection, and image shrinking.

token-optimizationcost-savingfile-interceptioncaching
by DFKHelper Jul 11, 2026 8/10
app GitHub

agentfdr: Flight Data Recorder for Local Coding Agents

Dissect why Claude Code looped, drifted, or burned tokens — zero instrumentation needed, fully local-first. Like a black box for your AI coding sessions.

debuggingobservabilitytoken-burnlocal-first
by kamihork Jul 11, 2026 8/10
app GitHub

claude-observatory: Per-Edit Keep/Undo for Claude Code Without Git

Surgical, git-free review of Claude Code changes directly in the terminal, VS Code, and JetBrains. Includes live dashboards: a Timeline change feed and edit/token stats with plan-usage bars, at zero extra tokens.

reviewundoterminalvscodejetbrainsdashboard
by cell-observatory Jul 11, 2026 9/10
app GitHub

code-airlock: Run Claude Code Unattended Inside a Disposable MicroVM

Runs Claude Code or another coding agent inside a disposable microVM (via firecracker or similar), with all changes committed to git so you can review everything from your host. Provides true isolation for autonomous coding tasks.

sandboxvmisolationsecurityautonomous
by Trivo25 Jul 11, 2026 9/10
app GitHub

smithers: Agent Workflows With Full Observability and Time Travel

Watch every step of a Claude Code, Codex, or Gemini agent live, then rewind, fork, and replay any run. Provides complete observability into agent execution history for debugging and auditing.

observabilityreplaytime-traveldebuggingaudit
by smithersai Jul 11, 2026 9/10
app GitHub

artgraph: Deterministic Spec-to-Code Context Graph for AI Coding Agents

artgraph links requirements, documentation, code, and tests in a single deterministic graph, giving AI coding agents structured context when translating specs to code. Aims to eliminate the guesswork of what files are relevant at each coding step. Useful for larger codebases where context relevance is hard to maintain.

contextspecgraphcoding-agentsdeterministic
by mori-shin-x Jul 10, 2026 6/10
app GitHub

clampdown: Secure Container Sandboxes for AI Coding Agents

Clampdown confines AI coding agents inside secure containers that limit filesystem access and control network communication, reducing blast radius of agent mistakes. Designed for running Claude Code and similar agents in isolated environments without risking host system exposure. A practical security layer for teams running agents on sensitive codebases.

securitysandboxcontainerisolationfilesystem
by D8k4 Jul 10, 2026 8/10
app GitHub

claude-multi-instance: Local Dashboard for Parallel Claude Code Sessions via tmux

A local web dashboard that runs multiple Claude Code sessions simultaneously, each backed by a persistent tmux terminal that survives browser refreshes and disconnects. Sessions are managed centrally and can be monitored from a single UI. Ideal for running independent workstreams on the same machine without context switching.

tmuxparallelmulti-sessiondashboardclaude-code
by icarloscornejo Jul 10, 2026 8/10
app Reddit

Claude Code Desktop Now Has a Built-In Sandboxed Browser

Official announcement: Claude Code's desktop app gained a sandboxed in-app browser that lets Claude pull up docs, designs, or any external site, then read, click through, and interact with it the same way it does with a local build. Sessions are configurable for persistence. Update to the latest desktop app to enable.

desktopbrowserfeatureofficialClaude Code
by ClaudeOfficial Jul 10, 2026 8/10
app GitHub

Corporate LLM Gateway: Sanitize Claude Code Traffic Before It Leaves Your Network

A corporate LLM gateway that sits between developer Claude Code instances and Anthropic/OpenAI APIs, sanitizing outbound traffic before it crosses the corporate boundary. Addresses data leakage, PII scrubbing, and policy enforcement for enterprise deployments.

enterprisesecuritygatewayproxydata-loss-prevention
by jLAM-ERR Jul 10, 2026 7/10
app GitHub

Image Token Compression: Proxy That Cuts Agent Input Tokens ~39% via Pixel Rendering

A transparent Anthropic/OpenAI proxy that compresses AI agent context (system prompt, tool docs, tool output, history) by rendering it to pixels before sending. Achieves ~39% fewer input tokens on real runs while keeping tool calls and multi-turn interactions fully intact.

tokensoptimizationproxycompressionefficiency
by NatBrian Jul 10, 2026 7/10
app GitHub

Orcy: Pod-Based Autonomous AI Agent Coordination System

A multi-agent coordination system where agents form a pod, create missions, claim tasks, and work together autonomously. Agents negotiate work division in shared habitats and report results back to the group.

multi-agentcoordinationautonomousorchestration
by waterworkshq Jul 10, 2026 6/10
app GitHub

Forktty: Linux-Native Workspace for Coding Agents with Git Worktrees and MCP

A Linux-native workspace environment for AI coding agents featuring Ghostty terminal integration, git worktree management, local MCP/socket automation, team orchestration, and prompt-aware notifications. Designed to reduce friction in multi-agent local development.

Linuxworkspacegit-worktreesMCPorchestrationGhostty
by Lucenx9 Jul 10, 2026 7/10
app GitHub

CoderEval (UiPath): Sandboxed Framework for Evaluating AI Coding Agents

A comprehensive framework from UiPath for evaluating AI coding agents and their skills. Features sandboxed execution for reproducibility and data-driven analysis to compare agent performance across tasks and skill configurations.

evaluationbenchmarkingsandboxingagentstesting
by UiPath Jul 10, 2026 6/10
app GitHub

clauzz-cli: Named Claude Code Session Manager with One-Keypress Resume

A CLI workspace context manager for AI coding agents that lets you name Claude Code sessions and resume them with a single keypress. Carries context across sessions to maintain continuity on long-running projects.

CLIsession-managementcontextworkflow
by ghulammuzz Jul 10, 2026 6/10
app Reddit

Meshwire: Cross-Machine AI Agent Collaboration via A2A Protocol

Meshwire is a Claude Code plugin enabling AI agents on different machines to communicate and divide work using the A2A protocol. Claude Code on Linux, ChatGPT on Mac, and Copilot on Windows can all exchange messages and tasks in real time. Install via `/plugin marketplace add husker/meshwire` in Claude Code.

multi-agentA2Acollaborationplugincross-platform
by broccoflower Jul 10, 2026 8/10
app Reddit

Interesting "cyber-security" test

We've all seen (and some of us have posted) posts over the past month or so about "I wasn't even doing anything wrong and I got banned!" with no data to back it up. A half-glass of tequila and a br...

skilltestingreview
by medialantern Jul 10, 2026 5/10
app GitHub

ctx: Search Your Local Coding Agent History

A CLI tool that indexes and searches the conversation history already stored on your machine from coding agents like Claude Code. Lets you find past solutions, decisions, and code snippets without re-asking the AI. A practical productivity tool for developers who accumulate substantial session history.

searchhistorytranscriptsproductivityclisessions
by ctxrs Jul 9, 2026 7/10
app GitHub

vocal-composer: Real-Time Speech-to-Text for Claude Code and Cowork

Adds voice-first input to Claude Code and Cowork via real-time speech-to-text in 2026. Allows developers to dictate prompts, instructions, and code descriptions instead of typing. Integrates directly with Claude Code's workflow for a hands-free coding experience.

speech-to-textvoiceaccessibilityproductivitycowork
by naveenkumarnavin Jul 9, 2026 6/10
app Reddit

Automated agents via interactive mode or headless mode?

Hi 🙂 I am building a system for my personal use that lets me create GitHub Issues, label them, and start agents on them based on their labels. It is important to note that I am not using the GitHub...

mcphookgit
by kanye-supremacy Jul 9, 2026 9/10
app Reddit

Do I need an Architect?

I have been working with Claude for a while now and have developed a few applications, two of which are in production. We now have an opportunity to work on a product for a client. I am confident t...

skillreview
by NCatoffice Jul 9, 2026 6/10
app GitHub

Claude Canvas: TUI Toolkit for Interactive Terminal Interfaces

A TUI toolkit designed for Claude Code that lets you spawn interactive terminal interfaces for emails, calendars, and other integrations. Enables rich in-terminal UI without leaving the Claude Code environment.

TUIterminaltoolkitClaude Code
by All-zzz Jul 8, 2026 6/10
app Reddit

ccp 0.5.1: YAML-Based Filter System for Command Compression

ccp compresses Claude Code command output to reduce context usage. v0.5.1 adds a YAML-based filter system with layered overrides for repo-specific rules, team defaults, and domain-specific filters (e.g. logs). Built with 200+ sample cases for validation.

compressioncontextCLIworkflow
by SuppieRK Jul 8, 2026 6/10
app GitHub

cc-releases: Automated Mirror of Claude Code Offline Installers

An automated GitHub Actions mirror that tracks new Claude Code releases, verifies SHA256 checksums, and publishes verified offline installers as GitHub Releases. Useful for air-gapped environments or reliable offline installation.

installerofflinereleasesClaude Code
by nancheung Jul 8, 2026 5/10
app Reddit

Crystl: Tabbed Terminal App for Claude Code with Git Worktree Shards

A Mac terminal app built for Claude Code multi-agent workflows. Features tabbed Gems (projects), isolated git-worktree-backed Shards for parallel agents, and Formations for saving/restoring session collections. Includes a screen-edge dock for monitoring agent age and status.

terminalworktreesmulti-agentmacOS
by TheLastDiviner Jul 8, 2026 7/10
app Reddit

tail-claude-hud: Status Line Showing Permission Requests from Transcripts

A Claude Code status line that parses transcript files incrementally to surface information stdin alone can't provide: pending permission requests, tool calls in-flight, file change summaries. Renders in under 20ms and complements existing usage/cost indicators.

status-linetranscriptspermissionsmonitoring
by snow_schwartz Jul 8, 2026 7/10
app GitHub

frex: Claude Code Plugin to Extract Video Frames for Analysis

A Claude Code plugin that extracts frames from video files, making them available for visual analysis and UI debugging. Useful for video-to-code workflows and debugging visual regressions.

videopluginvisual-analysisClaude Code
by ahrGNUts Jul 8, 2026 5/10
app Reddit

CAP: Claude Code Status Line Installable via /plugin install

A usage status line for Claude Code that installs with a single /plugin install command — no npm, curl, or jq needed. Shows rate limit, session usage, and plan info directly in the terminal status line with minimal friction setup.

status-linepluginusagerate-limit
by WhichInsurance2571 Jul 8, 2026 7/10
app Reddit

Jannal: MCP Request Inspector and Selective Tool Loader

A local proxy that makes MCP token overhead visible (like Chrome DevTools for MCP) and enables selective loading of only the tools needed for each request. Addresses the problem of MCP tool definitions consuming 30-40% of context before any real work starts.

MCPcontexttoken-optimizationproxy
by Turbulent_Echo_7333 Jul 8, 2026 8/10
app Reddit

AgentDock: VS Code Kanban Board for Managing Claude Code Sessions

A VS Code extension that gives you a kanban-style board for all running Claude Code agent sessions. One-click create/resume/rename, status indicators (thinking/idle/crashed), and grouped task management for the chaos of running many parallel agents.

VS Codemulti-agentsession-managementkanban
by Dangerous-Sherbert15 Jul 8, 2026 7/10
app GitHub

ccsm: Claude Code Session Manager with Tagging and Search

A CLI and TUI tool for managing Claude Code sessions with tagging, search, and resume capabilities. Makes it easy to find and continue past sessions without losing context.

session-managementTUICLItagging
by sageraii Jul 8, 2026 6/10
app GitHub

Titan-Memory: Agent Memory with Safety Guardrails and Drift Protection

A memory system for AI agents that goes beyond storage: includes safety guardrails, circuit-breakers, semantic adapters, and drift protection. Built-in safety features make it suitable for running agents autonomously.

memoryagentssafetysemantic-search
by TC407-api Jul 8, 2026 6/10
app Reddit

Claude Voice Tunnel: Voice Dictation for Remote Claude Code via SSH

A client/server script that enables Claude Code voice dictation (/voice) over SSH connections. Solves the problem of losing voice input when running Claude Code in isolated remote environments.

voiceSSHremotedictation
by Huge-Albatross9284 Jul 8, 2026 6/10
app Reddit

company-os: Remote Claude Code for Company-Wide Coordination

An open-source system that runs company operations through Claude Code agents, addressing the problem of company knowledge scattered in Slack and heads. Multi-agent coordination across AssemblyAI, Anthropic, and other APIs. MIT license, no paid tiers.

companyremotemulti-agentorchestration
by buryhuang Jul 8, 2026 5/10
app GitHub

pentest-kit: Penetration Testing Framework for Claude Code

A tool-orchestrated penetration testing framework for Claude Code combining DAST, SAST, and SCA in a hardened Docker container. Automates security testing workflows with Claude Code as the orchestrator.

securitypentestDockerSAST
by nunenuh Jul 8, 2026 6/10
app Reddit

workspace-map: BM25F Natural-Language Code Indexer for Claude Code

A local code indexer that understands natural-language queries across multiple repos. BM25F search with symbol extraction for Dart, Python, JS, Shell — incremental delta updates (~200ms) and optional Haiku reranking. Reduces exploratory grep spirals that burn context.

code-searchBM25indexercontext-optimization
by EveyVendetta Jul 8, 2026 8/10
app GitHub

code-review-graph: Local Knowledge Graph for Claude Code Reviews

Builds a persistent local knowledge graph of your codebase so Claude reads only relevant files during reviews. Claims 6.8x fewer tokens on code reviews and up to 49x on daily coding tasks by eliminating blind file exploration.

code-reviewknowledge-graphtoken-optimizationcontext
by tirth8205 Jul 8, 2026 8/10
app GitHub

claudewrapper: Control Claude Code via Linear Tickets

Connects Claude Code, GitHub, and Linear.app so Linear tickets become remote control commands for Claude Code sessions. Create a ticket with instructions, and Claude picks it up and executes — bridging project management with AI coding agents.

LinearGitHubremote-controlproject-management
by yoogie27 Jul 8, 2026 6/10
app GitHub

DEV-MEMORY-LEDGER: Local-First Codebase Memory for AI Agents

A local-first memory system that captures lessons and recalls them in your IDE, with project health tracking. Stores what worked, what failed, and why — reducing repeated mistakes across sessions.

memorylocal-firstIDElessons
by senaiverse Jul 8, 2026 6/10
app Reddit

Mengram: Auto-Save and Auto-Recall Memory Layer Using Claude Code Hooks

An open-source memory layer that automatically saves and recalls context using Claude Code hooks — no manual saves or MCP config. SessionStart loads profile, every prompt searches past sessions for relevant context, PostToolUse extracts and saves new knowledge in background.

memoryhooksautomationcontext
by No_Advertising2536 Jul 8, 2026 7/10
app GitHub

agentlytics: Unified Dashboard for AI Session Data from 16 Editors

A local dashboard that unifies AI session analytics from 16 different editors including Claude Code, showing models used, costs, tools, and usage metrics in one place. Ingests OpenTelemetry data.

analyticsdashboardmonitoringOpenTelemetry
by EUTUOKRL Jul 8, 2026 6/10
app Reddit

claude-code-insights: Local Dashboard for Sessions, Config, and Agents

A local open-source dashboard providing session insights for Claude Code and UI-based configuration management for agents, skills, and hooks. Eliminates the need to constantly check the developer platform for usage info.

dashboardmonitoringconfigurationsessions
by Upper-Marionberry208 Jul 8, 2026 7/10
app GitHub

claude-code-codex-bridge: Keep Claude Code and Codex Config in Sync

Automatically bridges your local Claude Code setup into Codex so both agents stay equally effective. Syncs configuration, settings, and patterns between the two tools without manual duplication.

Codexsyncconfigurationmulti-agent
by vladolaru Jul 8, 2026 5/10
app Reddit

ServerCC: iOS App for Claude Code via SSH with Mobile Optimizations

An iOS app that connects to your machine via SSH and presents Claude Code's native terminal interface with mobile-specific optimizations. Unlike mobile terminal apps, preserves the full TUI experience while adding mobile-friendly input handling.

iOSSSHmobileterminal
by ctrlaltdeletel Jul 8, 2026 7/10
app Reddit

claudewatch: Themed, Configurable Status Line for Claude Code

A Claude Code status line with 10 built-in themes (Dracula, Catppuccin, Nord, Tokyo Night, Gruvbox, etc.) and per-segment toggle via TOML config. Shows model, plan, context window, 5h/7d usage limits, session cost, working directory, and git branch with auto plan detection.

status-linethemesconfigurationmonitoring
by bat_man0802 Jul 8, 2026 6/10
app GitHub

chainlink: CLI Issue Tracker Designed for AI Agents

A lightweight CLI issue tracker built specifically for AI agent workflows, enabling agents to create, update, and track issues as part of their work loop. Provides structured task persistence across sessions.

issue-trackingCLIagentsworkflow
by dollspace-gay Jul 8, 2026 6/10
app GitHub

tokentap: Native macOS Menu Bar App for Claude Session Usage

A native macOS menu bar app that monitors Claude Pro/Max session and weekly usage in real-time. Keeps usage visible without interrupting workflow or requiring switching to the terminal.

macOSusage-monitoringmenu-barClaude Code
by sebasrodriguez Jul 8, 2026 6/10
app Reddit

App for Generating Realistic Relational Test Databases for Claude

A tool born from needing realistic relational test databases for apps built with Claude Code — Claude works for small datasets but struggles with larger datasets that maintain foreign key integrity. Automates production of consistent multi-table test data.

testingdatabasetest-dataworkflow
by coolreddy Jul 8, 2026 5/10
app GitHub

Claude Code Discord Bridge: Full Session Mirroring with Permission Approval

Control Claude Code from your phone via Discord with full session mirroring, bidirectional messaging, and permission approval — all from mobile. Alternative to the built-in Channels feature with richer session control.

Discordmobileremote-controlsessions
by chrismdemian Jul 8, 2026 6/10
app GitHub

gob: Process Manager for AI Agents and Humans

A process manager designed for AI agent workflows, managing long-running agent processes with restart policies, logging, and coordination between human and agent tasks.

process-managementagentsworkflow
by juanibiapina Jul 8, 2026 5/10
app Reddit

Claude Resume Statusline: Never Lose a Claude Code Session ID Again

A pure-bash statusline tool that persistently displays the current `claude --resume SESSION_ID` at the bottom of every Claude Code session. Logs all sessions to ~/.claude/session-log.txt so past sessions are always recoverable. One-command install, no dependencies, MIT licensed.

statuslinesessionresumebashcliproductivity
by AIDevUK Mar 19, 2026 8/10
app Reddit

RuntimeUse: Open-Source Framework to Run Claude Code Agents in Cloud Sandboxes

RuntimeUse solves the infrastructure challenge of deploying Claude Code agents in isolated cloud sandboxes (E2B, Modal, Vercel, Daytona, etc.) for production use. Run `npx -y runtimeuse@latest --agent claude` inside a sandbox to get a Claude Code agent with a Python client for task invocation, file exchange, and mid-flight cancellation. Open-sourced from building Lark, an AI-native QA system.

sandboxcloudinfrastructureagentproductione2bmodal
by Mysterious-Rock7154 Mar 19, 2026 8/10
app GitHub

claude-code-changelog: Track Prompts, Feature Flags, and Metadata of Claude Code Releases

A GitHub repository that tracks the internal prompts, feature flags, and release metadata of Claude Code over time. Useful for developers and researchers who want to monitor changes in Claude Code's behavior, capabilities, and configuration across versions.

changelogrelease-trackingpromptsfeature-flagsresearch
by marckrenn Mar 19, 2026 8/10
app Reddit

NorcsiAgent: Real-Time Agent Activity Dashboard Built with Claude CLI

NorcsiAgent is a real-time dashboard showing what AI agents are doing, with animated cards for each agent displaying current thoughts, tool calls, and completions. Built using Claude CLI, it supports sending commands to individual agents while they run concurrently. A practical monitoring tool for multi-agent workflows.

dashboardmonitoringmulti-agentreal-timeagents
by According_Turnip5206 Mar 19, 2026 6/10
app GitHub

temine: Terminal Orchestrator for Multiple AI Agents with Real-Time Status

Temine is a terminal UI for managing and organizing multiple AI agent CLI sessions simultaneously. Provides real-time status, notifications, and process control for parallel agent execution from a single terminal window. Useful for developers running concurrent Claude Code or other CLI agent sessions.

terminalorchestratormulti-agentreal-timecli
by abdousamb2002 Mar 19, 2026 6/10
app Reddit

Codeset: Repo-Aware Context Layer That Makes Haiku Perform Like Opus

Codeset provides Claude Code agents with structured repo context — file change history, inter-file dependencies, and implicit project knowledge — surfaced at session start. This context reportedly brings Haiku up to Opus-level output on coding tasks. Addresses the cold-start problem where agents begin sessions with no knowledge of the codebase.

contextrepo-knowledgetoken-efficiencyperformanceagents
by Nfsaavedra Mar 19, 2026 7/10
app Reddit

Domscribe: Maps Every DOM Node to Its Exact Source File and Line for Claude Code

Domscribe is a build-time dev tool that maps every DOM element to its exact source file and line number, giving Claude Code precise targets for frontend edits. Eliminates the file searching and guessing Claude normally does for UI fixes. Particularly valuable for complex component hierarchies where DOM-to-source mapping is not obvious.

frontenddomsource-mapdevtoolsclaude-code
by NarratorTD Mar 19, 2026 7/10
app Reddit

dangerously: One-Command Docker Sandbox for --dangerously-skip-permissions

An npm package that spins up an isolated Docker container and launches Claude Code inside it with --dangerously-skip-permissions, so the powerful no-prompt mode is safe to use without manual container setup. File system changes stay contained to the project directory. Install globally with npm install -g dangerously.

dockersandboxdangerously-skip-permissionssecuritynpmisolation
by Daily__Progress Mar 19, 2026 7/10
app GitHub

AgentHub: Multi-Agent Terminal Manager With Self-Improving System Blueprint

A multi-agent terminal manager for Claude Code that lets you run parallel AI agents side-by-side with a structured architecture designed for self-improvement. Includes a battle-tested organizational blueprint for coordinating agent teams directly from the terminal.

multi-agentterminalparallelself-improvingarchitecture
by qwertzuiop151 Mar 19, 2026 7/10
app Reddit

Patchcord: Async Coordination Layer for Claude Code Across Machines

Patchcord solves the coordination bottleneck in multi-agent Claude Code workflows: a persistent inbox shown in the status line, automatic inbox checks each conversation turn, one-click skill setup from a web UI, and /loop 5m integration for unattended remote runs. Agents can message each other directly instead of routing everything through a human. Built entirely with Claude Code; open source at github.com/ppravdin/patchcord and available as a hosted service at patchcord.dev.

multi-agentasynccoordinationinboxremotelooppatchcord
by ppravdin Mar 19, 2026 8/10
app GitHub

claude-cost-optimizer: Toolkit for Reducing Claude Code API Costs

A complete setup for reducing Claude Code API costs combining several tools: opusplan for planning with Opus before switching to cheaper models, claudetop for session monitoring, gstack for automation, GitNexus for GitHub intelligence, Handy for voice-to-text, and GitHub Copilot integration. Practical toolkit for API billing users.

costoptimizationapimonitoringtoolkit
by GauravRatnawat Mar 19, 2026 8/10
app GitHub

claw-recall: Store and Search Agent Conversations for Memory Persistence

claw-recall stores and indexes AI agent conversations so they can be searched and retrieved to recover lost context. Works in multi-agent workflows where context frequently resets. Provides a searchable conversation archive that agents can query to resume prior work.

memorysearchconversationpersistencemulti-agent
by ken12ken Mar 19, 2026 7/10
app GitHub

Discord Rich Presence Client for Claude Code Activity Tracking

A Discord Rich Presence client that displays your current Claude Code activity — active file, project name, and session state — directly in your Discord profile status. Lightweight integration for developers who want to share or log their Claude Code session context in Discord.

discordrich-presencestatusactivityintegration
by StealthyLabsHQ Mar 19, 2026 6/10
app GitHub

ai_session_tools: Recover Files and Context from Past Claude Sessions

A tool for finding and recovering data and code files from Claude Code sessions — both humans and Claude itself can use it to pick up where a previous session left off. Useful when a session ends unexpectedly or when you need to trace what was generated in a prior run.

sessionrecoverycontextfilescontinuity
by ahundt Mar 19, 2026 7/10
app Reddit

LAP: Compiled API Specs to Stop Claude Agent Hallucinations

LAP (Live API Protocol) provides compiled, versioned API specs that prevent Claude agents from hallucinating endpoints or parameters. The update adds automatic staleness detection on session start, a diff command showing exactly what changed, and a pin command to freeze specs. Addresses one of the most common sources of agent errors in API-heavy projects.

apispechallucinationagentversioning
by Big_Status_2433 Mar 19, 2026 8/10
app Reddit

ccoverage: Audit Which Parts of Your Claude Code Config Are Actually Used

ccoverage compares your Claude Code config (CLAUDE.md files, skills, MCP servers, hooks) against your actual session histories to show which parts are actively used vs. just adding noise. Helps clean up accumulated configuration bloat and understand what is genuinely helping. Great for optimizing token usage.

configauditoptimizationclaude.mdtoken
by SZQGG Mar 19, 2026 8/10
app GitHub

beacon: CI/CD Deploy Status Monitor with Telegram Notifications

beacon is a CLI tool that monitors CI/CD deploy status after a git push and sends Telegram notifications when deployments complete or fail. Lets you step away after pushing without manually polling your CI dashboard. Simple and lightweight notification layer for deployment workflows.

ci-cddeploymentnotificationtelegrammonitoring
by Blysspeak Mar 19, 2026 5/10
app GitHub

rdf: Governance Framework with Convention Enforcement for Claude Code

rdf is a governance-driven AI development framework that adds convention enforcement, quality gates, and domain expertise plugins to Claude Code, Gemini CLI, and Codex. Helps teams enforce coding standards and quality rules automatically during AI-assisted development. Uses a rule-based approach to keep AI output consistent with team norms.

governanceconventionsqualityframeworkenforcement
by rfxn Mar 19, 2026 7/10
app GitHub

Plamen: Autonomous Web3 Security Audit Agent for Claude Code

Plamen is an autonomous Web3 security audit agent built for Claude Code that automatically scans smart contracts and blockchain code for vulnerabilities. Useful for Solidity developers who want automated security review in their Claude Code workflow.

securityweb3solidityauditsmart-contract
by PlamenTSV Mar 19, 2026 6/10
app Reddit

Local Dev Project Catalog with AI Summaries for ~/dev/ Folder

A local knowledge base crawler that catalogs all dev projects in your ~/dev/ folder with AI-generated summaries. Helps find the right version of a project or feature across dozens of accumulated experiments and iterations. Also supports local LLMs for offline/private environments.

knowledge-baselocalcatalogsearchprojects
by tribat Mar 19, 2026 7/10
app GitHub

hipocampus: Drop-in Memory Harness with 3-Tier Storage and Search

hipocampus is a drop-in memory harness for AI agents featuring 3-tier memory architecture, a compaction tree, and hybrid search. Set up with one command and works with Claude Code and OpenClaw. Addresses the lack of built-in persistent memory by providing a structured memory layer.

memorypersistencesearchagent3-tier
by kevin-hs-sohn Mar 19, 2026 8/10
app GitHub

Claude-Debussy: Multi-Phase Claude CLI Sessions with State Persistence

Claude-Debussy is a Python wrapper for multi-phase Claude CLI sessions with compliance verification, state persistence between phases, and real-time streaming output. Useful for complex workflows that require multiple sequential Claude invocations with shared state. Provides structured orchestration over raw CLI calls.

orchestrationsessionstateclistreaming
by matt-grain Mar 19, 2026 6/10
app Reddit

Node9: Local Permission Proxy for Safe Autonomous Claude Code

Node9 is a local-first open-source proxy that acts as a deterministic permission layer for Claude Code agents. Instead of approving every ls and grep, you define what commands are safe vs. risky, and Node9 enforces those rules automatically. Reduces verification fatigue while still blocking destructive commands.

permissionsproxysafetyautonomousautomation
by WhichCardiologist800 Mar 19, 2026 7/10
app Reddit

MiniClaw: Persistent Memory and Task Brain for OpenClaw Agents

MiniClaw is an open-source cognitive architecture layer on top of OpenClaw that adds persistent memory, an autonomous task brain, and the ability to file its own GitHub issues when it finds problems. Addresses the stateless agent problem where context resets every session. Gives agents continuity across sessions.

memorypersistenceagentcognitive-architecturecontext
by ryanb082 Mar 19, 2026 7/10
app GitHub

Flavian: Claude Code Framework for WordPress Block Theme Dev

Flavian is a Claude Code-integrated WordPress development framework with Full Site Editing (FSE) block theme tools, automated security auditing, and Figma-to-WordPress conversion pipelines. Designed for WordPress developers who want to use Claude Code for theme development with proper conventions and tooling.

wordpressframeworkblock-themefigmasecurity
by PMDevSolutions Mar 19, 2026 7/10
app Reddit

sift: Deduplicate Test Failures Before Sending to AI Agents

sift is a CLI tool that groups repeated test failures by root cause before passing them to an AI agent. Instead of paying for the same error 125 times across failing tests, the agent sees each unique failure once. Reduces debugging cost by up to 60% and speeds up the fix loop.

testingdebuggingclitokenefficiency
by Opening-Cry-5030 Mar 19, 2026 7/10
app GitHub

upstream-agents: Run AI Coding Agents in Isolated GitHub Sandboxes

upstream-agents provides isolated sandbox environments connected to your GitHub repositories for running AI coding agents. Keeps agent-generated code changes contained until review. Good for teams wanting safer autonomous coding without risk of direct repo pollution.

sandboxgithubisolationagentsafety
by jamesmurdza Mar 19, 2026 7/10
app Reddit

Edgee: Context Compression Proxy to Extend Claude Code Sessions

Edgee is a proxy that sits between Claude Code and the Anthropic API, compressing context by stripping redundant instructions and deduplicating conversation before forwarding. Reported to extend Pro sessions by 26.5%. Built with Claude Code itself, it operates transparently without changing Claude behavior.

tokencompressionproxycontextrate-limit
by Sea_Woodpecker256 Mar 19, 2026 7/10
app GitHub

baton-dx: One Manifest for AI Coding Config Across 14 Tools

baton-dx is a CLI package manager for AI coding tool configuration — write one manifest and it syncs your settings, rules, and skills across 14 tools including Claude Code, Cursor, Codex, and more. Eliminates duplicating configuration between different AI coding environments. Great for teams maintaining consistent AI tooling setups.

configpackage-managermulti-toolclaude-codecursor
by baton-dx Mar 19, 2026 8/10
app Reddit

Deploy AI Agent Teams to Claude Code and 6 Other Platforms

Describes itself as the Terraform for AI agents — define your agent team configuration once and deploy it to Claude Code plus six other platforms. Treats multi-agent setups as infrastructure-as-code with a single declarative manifest. Useful for teams standardizing agent definitions across environments.

multi-agentdeploymentinfrastructureclaude-codeorchestration
by EducationVarious7849 Mar 19, 2026 7/10
app GitHub

Autonomous AI Documentation Compiler Built with Claude Code Agents

A demo project showing how Claude Code agents can autonomously build a documentation compiler without human intervention. The project tracks the full live build process and showcases fully automated remote agent experiments. Useful reference for anyone building CI/CD pipelines around Claude Code.

agentdocumentationautomationclaude-code
by kimwwk Mar 19, 2026 5/10
app GitHub

Claude Code Organizer: Drag-and-Drop Manager for Memories, Skills, MCP Servers, and Hooks

A GUI tool to organize all your Claude Code memories, skills, MCP servers, and hooks in one place. Displays items in a scope hierarchy view and lets you move them between scopes via drag-and-drop. Addresses the pain of manually managing scattered Claude Code configuration across project, user, and global scopes.

claude-codeguiorganizationskillsmcphooks
by mcpware Mar 19, 2026 8/10
app GitHub

StitchFlow: AI-Powered Product Brief to Tailwind UI Converter

Converts product briefs into Stitch UI screens, variants, Tailwind-friendly HTML, and screenshots. Works across Claude Code, Codex, OpenClaw, GitHub Copilot, and Gemini CLI. Useful for teams that want to rapidly prototype UIs from written specifications using AI agents.

uitailwindprototypingmulti-agent
by yshishenya Mar 19, 2026 5/10
app Reddit

Argus: GitHub App That Scores Your CLAUDE.md File on Every PR

A GitHub App that reviews CLAUDE.md files and posts a score as a PR check. Built with Claude Code, it evaluates files for missing scope boundaries and other common failures. Most CLAUDE.md files fail two checks: no explicit scope limits and no rollback instructions. The repo includes the scoring standard.

claude-mdgithub-appci-cdquality
by StudentEmpty3717 Mar 19, 2026 8/10
app Reddit

Custom Reverse-Proxy API Gateway to Reduce Claude API Costs for Developer Tools

A custom reverse-proxy API gateway specifically for Anthropic models, built to pool traffic from Cursor and Claude Code CLI. Targets the large context window costs of Opus and Sonnet by batching and routing requests efficiently. Includes setup details for self-hosting the proxy.

api-gatewaycost-optimizationproxycursor
by NefariousnessSharp61 Mar 19, 2026 6/10
app Reddit

Claude Code Usage Dashboard with OpenTelemetry Integration

An in-development dashboard for tracking Claude Code usage metrics via OpenTelemetry. The plan: connect OTel from Claude Code, visualize session stats, token usage, and task patterns in a polished UI. Looking for early feedback on the feature set. Interesting for teams wanting usage insights beyond what the CLI provides.

dashboardopentelemetrymonitoringusage
by DryZookeepergame8644 Mar 19, 2026 5/10
app Reddit

Clash of Agents: MMA Arena for Autonomous AI Agents Built with Claude Code

An experiment in competitive agent behavior: AI agents register, pick a fighting discipline, and compete in an MMA arena with real social consequences. Built with Claude Code. An interesting case study in multi-agent competitive environments and emergent agent strategies.

multi-agentcompetitiveexperimentapp
by AbjectFinance7879 Mar 19, 2026 5/10
app GitHub

CatClaw: Multi-Channel AI Gateway with Discord, Telegram, TUI, and Claude Code Backend

A personal AI assistant gateway powered by Claude Code supporting Discord, Telegram, and a TUI interface. Features multi-agent support, session management, tool approval flows, and a memory system. A self-hostable alternative to commercial AI chat products with full agent capabilities.

gatewaydiscordtelegramtuimemory
by CatiesGames Mar 19, 2026 7/10
app GitHub

cmux-claude-pro: Status Pills, Progress Bars, and Sidebar Logs for Claude Code in tmux

The definitive Claude Code + tmux/cmux integration. Adds status pills, progress bars, sidebar logs, desktop notifications, git integration, and subagent tracking to your terminal. A polished upgrade for developers running Claude Code sessions in multiplexed terminals.

tmuxterminaluimonitoringsubagents
by yigitkonur Mar 19, 2026 8/10
app GitHub

ModelWeaver: Route Agent Roles to Different LLM Providers with Automatic Fallback

A multi-provider model routing proxy for Claude Code that routes agent roles — planning, coding, research — to different LLM providers. Supports automatic fallback, SSE streaming, and zero-config setup via `npx modelweaver init`. Useful for cost optimization and mixing model strengths.

routingmulti-providerllmcost-optimization
by kianwoon Mar 19, 2026 8/10
app Reddit

Operations Manager With No Dev Background Builds $55K ERP Integration With Claude Code for $400

A non-developer operations manager built a production ERP integration tool covering 4 countries in 17 days: 9,500 lines of Python/FastAPI, 61 modules, 43 API endpoints, and 7 cross-system document transfer pipelines — all for ~$400 in Claude Code costs. A compelling real-world case study for the value of AI-assisted development.

case-studyfastapierpno-codeproductivity
by tombarto Mar 19, 2026 7/10
app GitHub

CQS: Code Intelligence and RAG for AI Agents — 90.9% Recall@1, GPU-Accelerated

A code intelligence and RAG system for AI agents featuring semantic search, call graphs, impact analysis, type dependency mapping, and smart context assembly. Achieves 90.9% Recall@1 and 0.951 NDCG@10 with local ML and optional GPU acceleration. Addresses the problem of agents reading whole files just to find one function.

ragcode-intelligencesemantic-searchgpu
by jamie8johnson Mar 19, 2026 8/10
app Reddit

Membase: Persistent Memory Layer for Claude That Works Across All AI Tools

Membase is an external memory layer that persists context across Claude sessions and other AI tools. Addresses the common pain point of losing all session context when a conversation ends. Works as a cross-tool "external brain" rather than being tied to a single assistant.

memorypersistencecross-toolcontext
by Time-Dot-1808 Mar 19, 2026 6/10
app GitHub

AI Consultants: 12-Model Parallel Deliberation System with Claude Code Skill Support

Queries 12 AI models (Gemini, Codex, Claude, Mistral, Ollama, etc.) in parallel as "consultants" with unique personas. Features confidence scoring, multi-agent debate, weighted synthesis, and preset configurations. The self-exclusion feature prevents the hosting model from also being a consultant. Compatible with agentskills.io.

multi-modeldeliberationdebateconsensus
by matteoscurati Mar 19, 2026 7/10
app GitHub

auto-yes: Auto-Respond to Claude Code and Other AI CLI Prompts via PTY Proxy

A cross-platform Python tool that automatically responds to confirmation prompts from Claude Code, Cursor Agent, Gemini, Codex, and 10+ other AI CLIs via a PTY proxy. Zero dependencies. Prevents overnight AI agent loops from blocking on a single "y/n" prompt.

automationptyunattendedovernight-agents
by host452b Mar 19, 2026 7/10
app Reddit

CLI Tool to Track Which Localhost Ports Your AI Agent Dev Servers Are Using

A CLI utility that shows which localhost ports are occupied by AI agent dev servers, distinguishing between Docker containers, npm dev servers, and orphaned processes. Solves the frustration of port conflicts when running multiple Claude Code instances simultaneously.

cliportsmulti-agentdevops
by Professional_Pop_240 Mar 19, 2026 6/10
app Reddit

Platform to Connect Claude Code Builders and Browse Live Sessions Worldwide

A small web app that connects Claude Code builders globally, letting them share what they're currently building in real time. Built in a few hours using Claude Code itself. Addresses the isolation of solo vibe-coding by creating a lightweight social layer around it.

communitysocialreal-timeapp
by JCodesMore Mar 19, 2026 5/10
app GitHub

Seite: AI-Native Static Site Generator with MCP Server and Claude Code Integration

An AI-native static site generator with a built-in MCP server and Claude Code integration, powered by sub-second Rust builds. Designed so Claude Code can generate, preview, and deploy site content natively through MCP tools. An interesting alternative to post-hoc AI integration with existing SSGs.

static-sitemcprustai-native
by seite-sh Mar 19, 2026 7/10
app Reddit

claude-ide-bridge: Give Claude Full Access to Your Code Editor via MCP

An open source MCP-based bridge giving Claude full, persistent access to your code editor state — open files, selections, cursor positions, and diagnostics. Eliminates "contextual cliffs" where Claude loses awareness of what you're looking at. Built with Claude Code for Claude Code workflows.

mcpideeditorcontext
by wesh-k Mar 19, 2026 7/10
app Reddit

Anima: Neuroplastic Memory System for Claude with Temporal Decay and Reinforcement

Anima models AI memory after biological neural plasticity — memories are reinforced when they keep mattering and decay over time when they don't. Rather than storing everything equally, it builds a selective, evolving memory that mirrors how humans actually remember. An experimental approach to long-term AI context.

memoryneuroplastictemporal-decaycontext
by Future_Shopping_8438 Mar 19, 2026 6/10
app GitHub

WIDEMem AI: Memory Layer with Importance Scoring, Temporal Decay, and Hierarchical Context

A next-generation AI memory layer with importance scoring, temporal decay, hierarchical memory organization, and YMYL (Your Money or Your Life) prioritization for high-stakes information. Goes beyond simple persistent memory to simulate how relevant different memories should be over time.

memoryimportance-scoringtemporal-decayhierarchical
by remete618 Mar 19, 2026 7/10
app GitHub

Agent Harness: Turn Any Repository into a Governed Workspace for AI Coding Agents

A tool that converts any existing repository into a structured, agent-readable workspace with governance controls. Sets up the scaffolding for AI coding agents to navigate, understand, and modify a codebase within defined boundaries. A lightweight alternative to full custom agent infrastructure.

governanceworkspacerepositoryagent-setup
by zuoyui Mar 19, 2026 7/10
app GitHub

vim-claude-code: Claude CLI Integration for Vim

A Vim plugin that integrates the Claude CLI directly into Vim, enabling AI-powered coding workflows without leaving the editor. Useful for developers committed to Vim who want Claude Code capabilities without switching to a different editor.

vimeditorintegrationcli
by rishi-opensource Mar 19, 2026 6/10
app Reddit

Open Source Desktop App: Worktree Manager Wrapping Claude Code for Maximum Productivity

An open-source desktop app that wraps Claude Code with a worktree manager. Features include run/setup scripts, complete worktree isolation, git diff and operations, and "Connections" — a feature that lets you link repositories in a virtual folder that the agent sees as one. Targets developers running complex multi-repo workflows.

worktreedesktop-appgitmulti-repo
by moropex2 Mar 19, 2026 7/10
app Reddit

Pair-Programming 22K Lines of C With Claude to Fix Context-Window Token Inefficiency

After watching Claude burn 84K tokens reading an 8,000-line file to find a single function, the author pair-programmed ~22K lines of C with Claude Opus 4.6 to build a tool that addresses this specific inefficiency. A detailed account of the development process and the technical solution.

token-optimizationcpair-programmingcontext-window
by pbishop41 Mar 19, 2026 8/10
app GitHub

HolySheep CLI: Configure Multiple AI Coding Tools With One Command

A CLI tool that configures popular AI coding assistants (including Claude Code) using the HolySheep API for streamlined setup. One command to bootstrap configurations across tools, reducing the time spent manually configuring each AI assistant.

cliconfigurationsetupmulti-tool
by taty-aguilar Mar 19, 2026 5/10
app GitHub

Thalamus: Use Your Cursor Subscription to Run Claude Code Without an Anthropic Key

A bridge that routes Claude Code API calls through a Cursor subscription, eliminating the need for a separate Anthropic API key. Zero-dependency setup. Useful for developers who already have a Cursor subscription and want to experiment with Claude Code without additional billing.

cursorproxysubscriptioncost-saving
by lmoudamir Mar 19, 2026 6/10
app GitHub

Sebastian: Interactive Mermaid Diagram Preview and Annotation for Claude Code

An interactive Mermaid diagram preview tool for Claude Code. Click nodes or edges in the browser, leave comments, and watch Claude iterate on the diagram in real time. Bridges the gap between Claude's text output and visual diagram feedback loops.

mermaiddiagramsvisualizationinteractive
by micnoy Mar 19, 2026 8/10
app GitHub

Delvop: Engineering Command Center for Terminal AI Coding Agents

An engineering command center for terminal-based AI coding agents. Provides a unified control surface for managing, monitoring, and directing Claude Code and other terminal agents from a single interface.

command-centerterminalmonitoringorchestration
by delvop-dev Mar 19, 2026 6/10
app GitHub

Overwatchr: Native macOS Menu Bar Monitor for Terminal AI Agents

A native macOS menu bar app that acts as an "attention layer" for terminal AI agents. Shows agent activity status, alerts when agents need input, and provides quick controls — all without leaving the current app. Designed for developers who run Claude Code in background terminals.

macosmenu-barmonitoringnotifications
by atiti Mar 19, 2026 7/10
app GitHub

claude-lens: Claude Code Quota Pace Tracker for Your Statusline

A lightweight statusline widget for Claude Code that tracks how fast you are burning through your quota and warns if the pace is too high. Written in pure Bash and jq with no external dependencies — drop it into any terminal statusline setup. Helps prevent hitting rate limits mid-session by giving you a real-time consumption pace indicator.

quotastatuslinemonitoringbashproductivity
by Astro-Han Mar 19, 2026 7/10
app Reddit

Claude Code burning 100% usage in Max in 3 minutes, need help.

Hi everyone, I’m currently using Claude Code to build a geospatial map of my clients in Europe to identify new territory opportunities. I’m on the Max plan (90€/month), but I’ve hit a wall: whether...

workflow
by Sufficient_Name2639 Mar 19, 2026 7/10
app Reddit

Those of you actually using Haiku regularly: what am I missing?

I'm a heavy Claude user: Code, chat, Cowork, the whole stack. Opus and Sonnet are my daily drivers for pretty much everything, from agentic coding sessions to document work to automation planning. ...

workflowautomation
by samuel-gudi Mar 19, 2026 7/10
app Reddit

Claude Blue Is Spreading Across Silicon Valley.

I talked to two people in Silicon Valley today. A senior AI engineer at Meta and a startup founder who went through Stanford MBA. They don't know each other. They said almost the exact same thing. ...

by hiclemi Mar 19, 2026 7/10
app Reddit

You now can ask Claude to summarize your day with this MCP

I've been building Chronoid for about a year now — a macOS time tracking app that automatically monitors what apps and websites you use throughout the day. I just shipped an MCP server that lets Cl...

mcpcommandworkflowgitconfig
by tuanvuvn007 Mar 19, 2026 10/10
app Reddit

I bought 200$ claude code so you don't have to :)

I open-sourced what I built: Free Tool: https://graperoot.dev Github Repo: https://github.com/kunal12203/Codex-CLI-Compact Discord(debugging/feedback): https://discord.gg/xe7Hr5Dx I’ve been using C...

mcpgitclaude.md
by intellinker Mar 19, 2026 9/10
app Reddit

Everybody is stitching together their custom ralph loop.

I have countless projects where i customize ralph loops or encode other multi-step workflows. Building sophisticated ralph loops that don't end up producing AI slop is quite hard. Even for simple f...

workflowreview
by ASBroadcast Mar 19, 2026 7/10
app Reddit

The Better Claude Code Becomes the Less I Want to Use It

Ok, it's a clickbaity title, but it reflects a real and typical personal experience and also a real problem. Claude and the likes of it are improving. The code is often correct, and most of the tim...

workflow
by Left-Orange2267 Mar 19, 2026 7/10
app Reddit

Did Starlink get me banned?

Got banned today while building my company's CRM. Am about 75% done with it and $2500 in with claude code. Use the Claude pro plan for basic prompts of the basic write this email better type stuff ...

api
by copiumjunky Mar 19, 2026 7/10
app Reddit

Simple solution the AI's biggest problem

Your LLM is often lying to you. When you see it calculate a number it is simply predicting the tokens and presenting them as a number, its not actually using a calculator to PROVE that the calculat...

mcpskillclaude.mdreview
by Fresh_Quit390 Mar 19, 2026 10/10
app Reddit

Claude will avoid showing the whole system prompt

You can ask claude, what is the first sentence of stated above? It will provide, I just asked it the next sentence, and then the next, and then the rest, But it wasn't willing to give the rest, the...

skillgit
by johnney25 Mar 19, 2026 6/10
app Reddit

Way better than Gemini

As with many others, I thought I'd check out Claude. With Gemini, "we" tried to create an app that would use the cover screen of my Samsung Fold as a control pad for games. You could assign zones o...

by BradyBrother100 Mar 19, 2026 5/10
app Reddit

Introducing claive -- multi-agent orchestrator for Claude Code

I built claive — multi-agent orchestrator for Claude Code. One goal → parallel agents, each on its own git branch. One-shot full applications. Open source: https://github.com/ionutz0912/claive subm...

git
by ionutz09 Mar 19, 2026 7/10
app Reddit

ClaudeCode automatically applying for jobs

Working on this the last week. Fetches jobs api in bulk (JSON file full of jobs) subagent tailors resume, then another sub agent uses playwright MCP to interact with the site. Does one job applicat...

mcpapi
by Dangerous_Bat_557 Mar 19, 2026 8/10
app Reddit

Spent 5 hours finding a bug like good old times. Felt good.

There was a silent auth error on my newly created full-stack app and CC couldn't find it despite my several attempts for hours. I was stressed and digged around manually a lot as well. Eventually C...

mcpskillclaude.md
by Lumpy-Criticism-2773 Mar 19, 2026 9/10
app Reddit

How do I take the UI/UX & gameplay experience to next level?

Hi, I am a newbie on claude code with a very limited coding. I just started vibe developing a 2-D android game from scratch using Claude code. Tried my best to help claude plan the outcome first, g...

mcpskillapi
by casualcynicist Mar 19, 2026 9/10
app Reddit

green field Enterprise possible?

Is it possible to build a full enterprise app vibe coded with Claude code max? My cousin's company is using an agency in London to build a multi platform app. Mobile, desktop. All on Claude code. T...

workflow
by bramburn Mar 19, 2026 7/10
app Reddit

This is what happened when I gave Claude access to my Windsurf

One of the most frustrating aspects of AI-assisted coding is the "context cliff." After spending time building context with an AI, you often find yourself re-explaining everything in subsequent ses...

mcpskillcommandgitreview
by wesh-k Mar 19, 2026 10/10
app Reddit

Tips for secondary models or workflows?

After abandoning Antigravity I've finally landed on Claude Code for my after hours coding as well. But the Pro subscription runs out pretty fast, and I'm having trouble justifying paying 100$ "just...

hookworkflow
by Outreact Mar 19, 2026 8/10
app GitHub

Molten: Liquid Terminal for AI Coding Agents

A terminal that lets you dock, split, merge, and reshape panes dynamically for managing multiple AI coding agent sessions. Designed around the multi-agent workflow rather than adapted from general terminal tools.

terminaluimulti-agentworkspaceproductivity
by glowElephant Mar 19, 2026 7/10
app Reddit

Queue System for Managing 10+ Claude Terminals Without Going Insane

A unified queue for all Claude Code agent sessions showing what is blocked, erroring, or needs attention. Eliminates the chaos of having dozens of terminal windows with no way to track status at a glance.

terminalqueuemanagementparallelui
by imu- Mar 19, 2026 8/10
app Reddit

claude-remote: Control Claude Code from Your Phone via Discord

Mirrors your Claude Code terminal session to a Discord channel so you can read output, approve tool calls, and send commands from your phone. Solves the problem of starting long tasks and having no way to monitor them remotely.

remotediscordmobilemonitoringcli
by dooooobyy Mar 19, 2026 7/10
app GitHub

crmy: Agent-First Open Source CRM with 80+ MCP Tools

An open-source CRM built with a Context Engine for agent-human GTM coordination. MCP-native with 80+ tools, full CLI, REST API, and web UI. Works with any PostgreSQL database.

crmmcpapppostgresqlgtm
by crmy-ai Mar 19, 2026 8/10
app GitHub

howlalert: Claude Code Usage Monitor with Push Notifications

Monitor your Claude Code spending and get push notifications on macOS, iOS, and watchOS when you hit thresholds. Built to keep API costs visible across all Apple devices. Useful for anyone running long autonomous sessions.

monitoringusagenotificationsmacosios
by MrDemonWolf Mar 19, 2026 7/10
app Reddit

skills-hub.ai: Free Catalog of 2,400+ AI Agent Skills

A platform built entirely with Claude Code that catalogs AI agent skills from Anthropic, Google, Microsoft, and 59 other companies. Includes backend, frontend, CLI, MCP server, and a sync engine that pulls skills automatically.

skillscatalogdiscoverymcpindex
by Doggggoo Mar 19, 2026 8/10
app Reddit

Browser Extension: Point-and-Click Visual Editing for Claude Code

A Chrome extension that lets you hover over any live webpage element and send it straight to Claude Code. Eliminates the inspect-element-copy-selector-paste-into-AI loop by creating a direct visual bridge.

browserextensionvisualcsschrome
by ddotdev Mar 19, 2026 8/10
app GitHub

SWE-Squad: Self-Healing Autonomous Engineering Agents via Claude Code + A2A

A multi-agent autonomous software engineering team powered by Claude Code and the A2A protocol. Agents self-heal and self-diagnose, forming a collaborative development team that can iterate on code without human intervention.

multi-agentautonomousa2aself-healingsoftware-engineering
by ArtemisAI Mar 17, 2026 7/10
app GitHub

jean: AI Git Task Manager for Worktrees and Merge Conflict Resolution

An AI assistant that automates Git tasks, simplifies worktree management, and resolves merge conflicts. Manages the full Git workflow so developers can focus on code rather than branch and merge mechanics.

gitworktreemerge-conflictsautomationai-assistant
by princeanthony-IT Mar 17, 2026 6/10
app GitHub

agtx: Multi-Session AI Coding Terminal Manager for Claude and Others

Autonomously orchestrates Claude Code, Codex, Gemini, OpenCode, and more in a multi-session terminal manager. Coordinates multiple AI coding agents across parallel sessions from a single interface.

multi-agentterminalorchestrationcodexgemini
by fynnfluegge Mar 17, 2026 6/10
app Reddit

Step-by-Step: Terminal UI Dev Pipeline via Specialized Claude Agents

A terminal UI that turns feature requests into structured multi-agent pipelines: planning pass, implementation, tests, review, and PR — instead of one big blob of changes. Addresses the lack of structure in raw Claude Code sessions.

pipelinemulti-agentterminaltuiplanningworkflow
by MustfOk Mar 17, 2026 7/10
app Reddit

Real-Time Claude Code Session Viewer: App, Web, and TUI Interfaces

A tool to watch Claude Code sessions in real time across app, web, and TUI interfaces. Addresses the absence of built-in session visibility — handles JSONL logs with real-time streaming for debugging and research sessions.

monitoringreal-timetuiweblogssessions
by Delexw Mar 17, 2026 7/10
app Reddit

Claude Usage: Free Open-Source macOS Menu Bar App for Token Monitoring

A lightweight macOS menu bar app built with Claude Code that shows Claude usage stats without keeping claude.ai open in a browser. Lets you track usage at a glance directly from the system menu bar.

macosmenu-barusage-trackingopen-sourceapp
by Efficient-Slip2707 Mar 17, 2026 6/10
app GitHub

cc-plugin-eval: Automate Evaluation of Claude Code Plugin Components

A tool to automate evaluation of Claude Code plugin components — ensuring skills, agents, commands, and hooks trigger accurately. Useful for testing and validating plugins before deployment.

testingpluginsevaluationskillshooks
by imbflool Mar 17, 2026 7/10
app GitHub

tangerine-dev: Agent Control Center for AI Coding Tools Built with Tauri

A cross-platform Agent Control Center for AI coding tools (Claude Code, Codex, Cursor) built with Tauri v2 (Rust + JS). Provides a unified management interface for running and monitoring multiple AI coding agents.

desktoptauricontrol-centermulti-agentui
by PoooL09 Mar 17, 2026 7/10
app Reddit

h5i: AI-Aware Git for Codebases Written by AI Agents

h5i (high-five) is a Rust-based next-generation Git designed for AI-generated code. It tracks AI authorship, provides context-aware diffs, and adds metadata relevant to agentic codebases.

gitai-awarerusttoolingversioning
by Living_Impression_37 Mar 17, 2026 7/10
app GitHub

ClaudeOS: Persistent Nix VM for Claude Code with Expandable UI

ClaudeOS provides a persistent Nix virtual machine environment for Claude Code to operate in, with a clean expandable UI. Gives Claude a stable, reproducible execution environment isolated from the host system.

nixvmsandboxenvironmentui
by aventre-labs Mar 17, 2026 8/10
app GitHub

cclint: Static Linter for Claude Code Agents, Commands, and Skills

A linter specifically for Claude Code plugin artifacts — validates agent definitions, command structure, and skill files for quality and correctness. Useful for teams maintaining large Claude Code plugin repositories.

lintervalidationskillsagentscommands
by dotcommander Mar 17, 2026 8/10
app GitHub

agentfiles: GUI for Managing Claude Code and Codex Workflow Files

A GUI for discovering, understanding, and managing AI agent workflows stored in ~/.claude/, ~/.codex/, and project config directories. Provides a visual interface for all your agent definitions, skills, and configurations.

guimanagementskillsworkflowdesktop
by ohing504 Mar 17, 2026 8/10
app Reddit

Real-Time Context Window and Usage Limit Statusline for Claude Code

A statusline integration that shows your Claude Code context window depth and usage limit utilization in real time. Helps avoid surprise rate limits and context compaction by providing continuous visibility into consumption.

statuslinecontext-windowusagemonitoringui
by kalos-kagatos Mar 17, 2026 8/10
app GitHub

claude-peak: macOS Menu Bar App for Monitoring Claude Max Usage

A macOS menu bar application that monitors your Claude Max usage in real time, featuring an animated flame indicator and detailed usage insights. Helps Max plan subscribers track consumption before hitting limits.

macosmenu-barusagemonitoringclaude-max
by Fortugenic Mar 17, 2026 7/10
app GitHub

agtop: top-Style TUI for Monitoring AI Coding Agent Sessions

A terminal-based monitoring tool (in the style of Unix top) for watching multiple AI coding agent sessions in real time. Shows session activity, resource usage, and status across concurrent Claude Code instances.

tuimonitoringsessionsterminalmulti-agent
by ldegio Mar 17, 2026 8/10
app Reddit

claudewho: CLI Tool for Managing Multiple Claude Code Accounts

A small CLI tool for switching between multiple Claude Code accounts quickly — useful for developers with personal and work subscriptions or teams sharing Claude Max seats.

cliaccountsmanagementclaude-maxtool
by nickmzz Mar 17, 2026 7/10
app Reddit

Prompt Firewall: Local Proxy to Intercept and Audit Claude Code LLM Requests

An open-source local proxy and firewall for intercepting outbound LLM requests from Claude Code. Provides visibility into what prompts are being sent, enables request filtering, and creates an audit log of all AI interactions.

securityproxyfirewallaudittransparency
by Huge-Ad6985 Mar 17, 2026 8/10
app Reddit

Windows-Native Agent Teams Backend for Claude Code — No WSL Needed

Claude Code agent teams spawns teammates in tmux panes, which does not work on Windows without WSL. This project provides a native Windows backend for agent teams, making parallel agent workflows work on Windows CMD/PowerShell.

windowsagent-teamsnativeparallelcompatibility
by SeaLeague3329 Mar 17, 2026 8/10
app Reddit

ccnotifs: Claude Code Notifications System for macOS

A macOS notifications system for Claude Code that alerts you when agents need attention, finish tasks, or encounter errors. Built to address the anxiety of not knowing if background agents are actually making progress.

macosnotificationsmonitoringagentsui
by AnevRS Mar 17, 2026 7/10
app Reddit

Railguard: Granular Permission Control — A Safer --dangerously-skip-permissions

Railguard provides a middle ground between full manual approval and --dangerously-skip-permissions. Define specific tool patterns that can run freely while still requiring approval for sensitive operations like network calls or file deletion.

securitypermissionsautomationcontrolsafety
by rumm25 Mar 17, 2026 9/10
app Reddit

seite: Static Site Generator with Native Claude Code Agent Integration

A static site generator where `seite init` generates a CLAUDE.md context file containing your entire site schema. Running `seite agent "write a post about..."` spawns Claude Code with full site context pre-loaded, enabling the agent to generate, update, and manage content without manual context injection.

static-siteCLAUDE.mdcontentagentintegration
by Illustrious_Top5966 Mar 16, 2026 7/10
app Reddit

Noren: Writing Voice Extraction and Generation Built With Claude Code

Noren analyzes your existing writing (tweets, blog posts, essays) to extract sentence rhythm, rhetorical moves, punctuation habits, and word preferences — then generates new text that genuinely sounds like you wrote it. Built across 4 codebases in a 16-hour Claude Code session using prompt caching.

writingvoicegenerationprompt-cachingbuild-in-public
by Unlikely_Big_8152 Mar 16, 2026 6/10
app Reddit

OpenMem: Persistent Neuro-Symbolic Memory Layer for LLM Agents

Addresses LLM agent statelessness using hyperdimensional computing to create a persistent memory layer. Prevents context window overload on long projects and enables genuine long-term reasoning across sessions — not just context stuffing.

memorypersistenceneuro-symbolichyperdimensionalstateless
by Arkay_92 Mar 16, 2026 5/10
app Reddit

claude2x.com: Claude Usage Rate Limit Checker

A minimal web tool for checking your Claude 2x (rate-limited) usage status, with a Discord bot DM notification command when limits reset. Open source at github.com/k33bs/claude2x.

usagerate-limitsmonitoringdiscordtool
by _k33bs_ Mar 16, 2026 5/10
app Reddit

OpenLobster: Self-Hosted AI Assistant in Go with MCP and Graph Memory

A Go rewrite of OpenClaw — single binary, 200ms cold start, 30MB RAM. Features graph-based memory (Neo4j or local GML), full multi-user RBAC, MCP integration with OAuth 2.1, and an encrypted secrets backend. Claude Code was a named collaborator in the rewrite.

self-hostedgomcpmemorygraphoauth
by neirth Mar 16, 2026 7/10
app GitHub

claude-code-studio: Full Web Workspace for Claude Code CLI

A comprehensive web UI for Claude Code CLI combining chat, Kanban task board, task scheduling, multi-agent orchestration, MCP server management, skills, and remote access via Web, SSH, and Telegram. Brings full project management into a single browser-based workspace.

web-uiworkspacekanbanmulti-agentmcpremotetelegram
by Lexus2016 Mar 16, 2026 9/10
app GitHub

codeledger: Token-Level Cost Intelligence Plugin for Claude Code

A Claude Code plugin providing per-project, per-agent, and per-skill token usage tracking with a local dashboard. Helps teams understand exactly where tokens are being spent across different skills and agent sessions.

token-trackingcostdashboardanalyticsplugin
by bhvbhushan Mar 16, 2026 7/10
app GitHub

ean-agentos: Persistent Memory for AI Coding Agents

Gives Claude Code and other coding agents (Gemini CLI, Codex CLI, Kimi CLI) persistent memory across sessions — the agent remembers how it solved bugs before and reuses that knowledge. Targets the "start from scratch every session" problem common to all stateless coding agents.

memorypersistencecross-sessionagentsdebugging
by eanai-ro Mar 16, 2026 7/10
app Reddit

Pompeii: Multiplayer Claude Code — Shared Agent Sessions for Teams

A collaborative workspace where teams share a single Claude Code session in real time — all members see the same agent context, reducing the overhead of constantly re-describing context to each teammate. Works with Claude Code, Codex, and Cursor. Addresses the core team pain of "lugging context around."

collaborationteammultiplayershared-contextreal-time
by Semantic_meaning Mar 16, 2026 8/10
app Reddit

Root Cause: Session Title Corruption in Claude Code VS Code Extension

A detailed investigation into why Claude Code session titles get corrupted, wrong, or disappear in the VS Code extension. The root cause: the extension does a raw string search for "customTitle" in the last 64KB of .jsonl files, causing 20+ distinct failure modes from title eviction, cross-session contamination, and overwrite on resume. Proposed fix: store titles in a separate lightweight index file.

vscodeextensionbugsessionsarchitecture
by BlindSpottedLeopard Mar 16, 2026 8/10
app GitHub

gleisner: Supply Chain Security for Claude Code Sessions

A security tool that sandboxes Claude Code sessions, attests every action, and verifies provenance of changes. Aims to bring software supply chain security practices to AI-assisted coding workflows.

securitysupply-chainsandboxprovenanceattestation
by lexicone42 Mar 16, 2026 7/10
app Reddit

Claudoscope: Native macOS app for tracking Claude Code token usage and costs per session

A local-first native macOS app (and menu bar widget) that reads ~/.claude JSONL files to provide cost estimates and token breakdowns per session and project. Also serves as a config browser for all your skills, MCPs, hooks, and settings in one place. No telemetry, no accounts — everything stays on your machine. Especially useful for Enterprise users where the API does not expose per-project costs.

appmacosanalyticscost-trackingopen-sourcedashboardtokens
by kenthesaint Mar 16, 2026 9/10
app X

Terminal CRM with Claude Code: auto-updates from emails and builds a knowledge graph

A CRM that runs in your terminal and integrates with Claude Code. It automatically updates contact records from email threads, builds a knowledge graph of relationships, and ships with built-in agent skills and recipes. Described as doing more than $300/month Salesforce plans at a fraction of the cost.

appCRMterminalemailknowledge-graphagents
by @EmilyJolieVee Mar 16, 2026 5/10
app Reddit

DepVault: Git-like CLI for secrets management built with Claude Code

An open-source platform for managing .env and secret files using git-style commands (push/pull/ci pull/scan). Solves the pain of manually syncing secrets across local, teammate, and CI/CD environments. Features AES-256-GCM encryption, secret leak detection in git history, one-time sharing links, and environment version history. Built in 3 weeks with Claude Code.

devopssecretsclisecurityappopen-sourceenv
by Born-Cause-8086 Mar 16, 2026 7/10
app Reddit

Clui CC: Open-source native macOS overlay UI for Claude Code

A floating native macOS overlay that wraps Claude Code in a proper UI without replacing the underlying agent. Features include persistent chat history, file/image attachments via drag and drop, a built-in skills marketplace, model picker, local slash commands, and optional auto-approve flows. Uses your existing Claude Code auth with no API keys or telemetry.

appmacosuioverlayopen-sourceproductivityskills-marketplace
by Significant-Ad-9553 Mar 16, 2026 8/10
app GitHub

claude-code-bot: Run Claude Code via Telegram or Discord Using Max Subscription

A multi-platform bot (Telegram + Discord) that routes messages to Claude Code CLI subprocesses running on your local machine. Notably, it uses your Claude Max subscription rather than API keys, so there are no per-token charges. Self-hostable and open source.

bottelegramdiscordmax-subscriptionremote-access
by fitz123 Mar 16, 2026 7/10
app Reddit

Too many Claude code terminals.. How do you keep them organised..

Hello, not sure if this has been asked before. I’m currently juggling about 5 projects at the same time (don’t ask why 😅). Each project usually ends up with its own terminal window with multiple ta...

by MysteriousArachnid67 Mar 16, 2026 7/10
app Reddit

Claude Code to local AI success or failure?

I’ve been using Claude Code to help me with app development, brainstorming and development of frameworks for additional apps and business plans, and other tools for my personal work and side hustle...

testing
by AndyBuildsThings Mar 16, 2026 7/10
app Reddit

Working With Claude Be Like

Sometimes Claude just... ships the entire thing. You say "step by step" and it comes back with 5 file edits, a rebuild, and a working feature. No back and forth, no debugging. Just done. But here's...

review
by Valo-AI Mar 16, 2026 5/10
app Reddit

Question about capitalization of first letter of tool name

All of a sudden, I'm getting an error when I open a project directory in Claude Code. It told me that one tool I have in my permission file does not have the first letter capitalized. So I went to ...

mcpapi
by specific_account_ Mar 16, 2026 7/10
app Reddit

Made a tool to overcome issues I faced

Hey guys! Been using claude for a while and the difference between a conversation with good context vs no context is insane. but actually writing a proper system prompt or AGENTS.md that covers you...

by Fragrant_Strategy_46 Mar 16, 2026 7/10
app Reddit

PocketBot: Local AI Agent Running 24/7 in Your iOS Background

An iOS app that runs an AI agent locally on-device 24/7 in the background, supporting BYOK (bring your own key) for models like Opus 4.6. Currently in beta with a cap of 1,000 users. Aims to make continuous AI-assisted automation available without a desktop computer.

ioslocalbackgroundbyokmobile24-7
by Least-Orange8487 Mar 16, 2026 7/10
app GitHub

semantic-diff: AI-Powered Rust CLI That Semantically Groups Git Diffs Using Claude

A Rust command-line tool that uses Claude and GitHub Copilot to semantically understand and group git diffs instead of showing raw line changes. Features a fast ratatui terminal UI for reviewing semantically-related changes together. Helps with code review by surfacing logical groupings in commits.

gitdiffsemanticrustcode-reviewratatui
by alankyshum Mar 16, 2026 8/10
app GitHub

claude-inspector: Electron Desktop App to Visualize Claude Code's Prompt Mechanism

An Electron-based desktop application that visualizes the internal prompt structure and mechanism used by Claude Code. Helps developers understand what context, system prompts, and tool definitions Claude Code is working with. Useful for debugging agent behavior and optimizing prompts.

visualizationpromptselectrondebugginginternals
by kangraemin Mar 16, 2026 8/10
app GitHub

claude-sync: Sync Claude Code Configuration Across Machines via rsync Over SSH

A utility for synchronizing Claude Code configuration files — plugins, agents, skills, and settings — across multiple computers using rsync over SSH with three-way conflict detection. Solves the pain of maintaining consistent Claude Code setups across desktop, laptop, and server.

syncconfigrsyncsshmulti-machineconflict-detection
by baptisterajaut Mar 16, 2026 7/10
app GitHub

clave: macOS Desktop App for Managing Multiple Claude Code Sessions

A native macOS application specifically designed for managing multiple simultaneous Claude Code sessions from one interface. Provides session overview, status monitoring, and switching between projects without terminal juggling. Designed for heavy Claude Code users running parallel workstreams.

macossession-managermulti-sessionparalleldesktop
by codika-io Mar 16, 2026 7/10
app GitHub

diagram-engine: Generate Professional Diagrams from Natural Language with Layout Engine

A diagram generation engine that takes natural language descriptions and produces professional diagrams with proper arrow routing, collision detection, typography, and visual validation. Goes beyond simple ASCII diagrams to produce presentation-quality outputs automatically.

diagramsnatural-languagelayoutvisualizationgeneration
by TomasB2BC Mar 16, 2026 7/10
app GitHub

claude-supervisor: Spin Up Parallel Claude Code Agents in Isolated Git Worktrees

A tool for launching multiple Claude Code agent instances, each in its own isolated git worktree, from a single command. Manages the lifecycle of parallel agent sessions without manual worktree setup. Designed for running several independent tasks on the same codebase simultaneously.

parallel-agentsworktreesisolationsupervisormulti-agent
by allexcd Mar 16, 2026 8/10
app GitHub

ccm: Automatic Model Routing for Claude Code with Smart Plan/Execution Switching and 429 Fallback

Automatically routes between different Claude models based on task phase — using Opus for planning and Sonnet for execution — and falls back gracefully when hitting 429 rate limits. Reduces cost and latency without manual model switching. Works transparently within existing Claude Code sessions.

model-routingrate-limitscost-optimizationopussonnet
by Always-Friday Mar 16, 2026 8/10
app GitHub

factoryfloor: AI-Powered macOS Development Workspace with Git Worktrees and Claude Code Sessions

A native macOS app that creates a unified AI development workspace combining git worktrees, Claude Code sessions, and local dev servers in one interface. Manage multiple parallel agent workflows from a single app. Reduces the terminal-juggling overhead of running concurrent Claude Code instances.

macosworkspaceworktreesparallel-agentsdev-servers
by alltuner Mar 16, 2026 8/10
app GitHub

AgentDash: Visual Dashboard for Structured Workflow Phases in Claude Code Projects

A visual dashboard that overlays structured workflow phases onto Claude Code projects, making the agent's progress through design, implementation, and testing stages visible and trackable. Helps teams understand where agents are in a workflow and when to intervene.

dashboardworkflowvisualizationphasesmonitoring
by avital-iamagent Mar 16, 2026 7/10
app GitHub

vakt: Sync All Your AI Coding CLI Configs Once Across All Devices and the Cloud

A configuration management tool for AI coding CLIs that lets you configure once and sync everywhere — local machines, cloud environments, and team members. Handles key rotation in one place with full audit logging of all configuration changes. Works across Claude Code, Codex, Cursor, and others.

configsyncmulti-devicekey-rotationaudit
by tn819 Mar 16, 2026 7/10
app GitHub

claude-agent-sdk-laravel: Build AI Agents in Laravel with Claude Code Capabilities

A Laravel package that brings Claude Code agent capabilities — file handling, command execution, code editing, and web search — into PHP applications. Enables building Claude-powered automation pipelines within existing Laravel backends. Simplifies integrating agentic workflows without leaving the PHP ecosystem.

laravelphpagent-sdkintegration
by cbt4free Mar 16, 2026 6/10
app GitHub

rlm-rs: Rust CLI for Processing Documents 100x Larger Than Context Windows via Recursive LLM

Implements the Recursive Language Model (RLM) pattern as a Rust CLI for Claude Code, enabling processing of documents far exceeding context limits. Uses intelligent chunking, SQLite persistence for intermediate results, and recursive sub-LLM orchestration to maintain coherence across passes.

rustcontext-windowrecursivechunkinglarge-documents
by zircote Mar 16, 2026 8/10
app GitHub

ccpocket: Mobile Client for Claude Code and Codex — Control Coding Agents from Your Phone

A mobile application that bridges to Claude Code and Codex sessions via WebSocket, allowing you to monitor agent progress, send instructions, and review output from your phone. Works with both Anthropic and OpenAI agentic coding tools. Designed for keeping tabs on long-running autonomous sessions.

mobileremote-controlwebsocketcodexmonitoring
by K9i-0 Mar 16, 2026 8/10
app GitHub

clens: Capture and Analyze Claude Code Sessions Locally Without External Dependencies

Records every tool call, decision, and reasoning step during Claude Code sessions for offline analysis. Runs entirely locally with no external services or API calls needed. Useful for debugging agent behavior, auditing session activity, and building reproducible workflows.

session-captureanalysisdebugginglocal
by edobreque Mar 16, 2026 7/10
app GitHub

termopus: Control Claude Code from Your Phone with Self-Hosted End-to-End Encryption

A Flutter-based mobile app that lets you monitor and control Claude Code sessions from your phone over an encrypted connection. Self-hosted with no cloud dependency — your commands and outputs stay private. Cross-platform with iOS and Android support.

mobileremote-controlflutterself-hostedencryption
by Jandel18 Mar 16, 2026 8/10
app Reddit

DevGlobe: Open-Source Live Globe Showing Active Claude Code Users Worldwide

DevGlobe is a free, open-source Claude Code plugin that makes you appear on a live globe while you code, so you can see and connect with other Claude Code users worldwide. Features a leaderboard, project showcase, anonymous mode (random city in your country by default), and privacy-first design where no code or personal data is sent to the backend.

communityglobelivepluginopen-sourcesocial
by Fair-Independent-623 Mar 16, 2026 6/10
app Reddit

ReadingIsFun: ePub Reader with Claude Code Agent Integration for Side-by-Side Reading

ReadingIsFun is an ePub reader built with coding agent integration. It uses your existing CLI subscription (Claude Code, Copilot, Codex, Gemini) to let your AI agent read technical books alongside you, enabling real-time discussion, note-taking, and code generation from the content.

epubreaderintegrationbookslearningapp
by arbayi Mar 16, 2026 6/10
app GitHub

cc-streak: Claude Code Activity Streak Counter with Burnout Warnings

cc-streak tracks your Claude Code usage history and shows your current streak, longest streak, and burnout warnings. A lightweight tool for staying consistently productive without overdoing it.

streakactivityburnouttrackingproductivityapp
by yurukusa Mar 16, 2026 6/10
app GitHub

cc-ghost-log: Review Git Commits Claude Code Made on Autonomous Ghost Days

cc-ghost-log surfaces git commits from Ghost Days — days when Claude Code ran autonomously without you present. It gives you a clean, navigable log of what your AI agent did while you were away, making it easy to review autonomous changes and maintain oversight of unattended sessions.

gitauditautonomouslogreviewaccountability
by yurukusa Mar 16, 2026 7/10
app GitHub

clsh: Access Your Terminal and Claude Code Agent from Any Device

clsh enables remote access to your terminal and Claude Code agent sessions from any device — phone, tablet, or desktop. Useful for monitoring and interacting with long-running autonomous sessions while away from your development machine.

remotemobileterminalaccessautonomousapp
by my-claude-utils Mar 16, 2026 7/10
app Reddit

claude-autocontinue: Chrome Extension to Auto-Continue Past Claude's Tool-Use Limit

claude-autocontinue is a Chrome extension that automatically clicks Continue when Claude hits the 20-tool-use limit on claude.ai. Works across all open tabs including background tabs, includes a Minimize tokens mode that asks Claude to summarize state before resuming, and supports configurable max continuations (1-999 or unlimited).

chrome-extensiontool-uselimitautomationproductivityclaude-ai
by timothy22000 Mar 16, 2026 7/10
app Reddit

SkillJury: Review and Discovery Site for 4,274+ AI Agent Skills with Security Scoring

SkillJury indexes over 4,274 skills across 23 AI agents including Claude Code, Codex, Cursor, and Cline. Each skill includes security scoring via SNYK and Socket checks plus community reviews so you can evaluate trust before installation. A curation layer for the fragmented skill ecosystem.

skillsdiscoverysecurityreviewscommunitymarketplace
by p3psiman007 Mar 16, 2026 7/10
app Reddit

Caliber: Auto-Generate CLAUDE.md and MCP Recommendations for Your Project

Caliber is an open-source tool that continuously scans your project and generates CLAUDE.md, .cursor/rules, and recommended MCPs tailored to your tech stack. It collects community-curated skills and config snippets to give your Claude agents the optimal configuration. MIT-licensed, runs locally using your own API key.

claude.mdconfigmcpautomationsetupopen-source
by Substantial-Cost-429 Mar 16, 2026 8/10
app Reddit

Kangentic: Visual Kanban Orchestration Layer for Parallel Claude Code Sessions

Kangentic is a free, open-source desktop app that adds visual Kanban-style orchestration on top of Claude Code. Drag tasks between columns to spawn, suspend, and resume sessions — each with their own git worktree for conflict-free parallel work. Supports live tool call tracking, configurable concurrency, session persistence across restarts, and runs the native Claude Code CLI directly with no modifications to your setup.

kanbanorchestrationparallelgit-worktreessessionsappdesktop
by vORP Mar 16, 2026 8/10
app GitHub

SubFrame: Terminal-First IDE for Claude Code with Persistent Context and Agent Monitoring

SubFrame is an open-source terminal IDE that wraps Claude Code with persistent context via AGENTS.md, auto-generated codebase maps, and task injection hooks. It provides session management, live agent monitoring with tool call tracking, per-task git worktrees for conflict-free parallel work, and full session persistence across restarts. Eliminates the cold-start context loss problem on every new session.

ideterminalcontextpersistencemonitoringgit-worktreesapp
by Codename-11 Mar 16, 2026 9/10
app Reddit

Detach: Mobile UI for managing Claude Code from your phone

Hey guys, about two months ago I started this side-project for "asynchronous coding" where I can prompt Claude Code from my mobile on train rides, get a notification when it's done and then review ...

workflowgitdockerreview
by misterolupo Mar 15, 2026 8/10
app Reddit

Is there something wrong with Claude Code?

For the last couple days, I've seen a very weird behaviour when interacting with Claude Code: all user requests appear to freeze before receiving less than 1000 tokens back - you can see how time c...

apiconfig
by youwilldienext Mar 15, 2026 7/10
app Reddit

How I structure Claude Code projects (CLAUDE.md, Skills, MCP)

I’ve been using Claude Code more seriously over the past months, and a few workflow shifts made a big difference for me. The first one was starting in plan mode instead of execution. When I write t...

mcpskillcommandworkflowgitautomation
by SilverConsistent9222 Mar 15, 2026 10/10
app Reddit

Problems w ChatGPT memory export

Did anyone else find that ‘memory’ ChatGPT export gave was highly disappointing using the prompt Anthropic had and that people were spreading around a couple weeks ago? I did it on my ChatGPT enter...

skillclaude.md
by Ok_Road_8727 Mar 15, 2026 9/10
app Reddit

I built a proxy that fixes Claude Code's scroll-jumping on Windows

Every time Claude Code streams a long response, my terminal would jump to the top and I'd lose my place. Scrolling back up just meant getting yanked away again on the next update. It's been the mos...

gitconfigreview
by Cursed3DPrints Mar 15, 2026 7/10
app Reddit

Claude Code Reverse-Engineered a 13-Year-Old Game Binary in 24 Hours

A developer used Claude Code (Opus, high reasoning) to reverse-engineer the Disney Infinity 1.0 binary with no symbols, source code, or prior RE docs. Claude traced the call graph, identified all 13 validation sites blocking character cross-playset access, and generated 17 binary patches — a restriction the modding community had failed to crack for over a decade. Completed in under 24 hours.

appreverse engineeringbinary patchinggame moddingx86 assembly
by CelebrationFew1755 Mar 15, 2026 7/10
app Reddit

No one cares what you built

The rise of coding agents and their rapidly evolving ubiquity is genuinely a great thing. One of the best aspects about knowing coding has always been the ability to quickly whip up a script or sma...

mcpskillworkflowapiclaude.md
by KickLassChewGum Mar 15, 2026 10/10
app Reddit

Claude vs aintigravity vs glm

Hi everyone, I’m currently paying about $20/month for Antigravity, but honestly I’m not very satisfied. The main issue for me is bugs and instability. Sometimes it works well, but other times thing...

workflowapigit
by Classic-Luck-2170 Mar 15, 2026 7/10
app Reddit

I built a tool to bootstrap Claude Code projects (open source)

Hi everyone, I've been experimenting with AI-assisted development using Claude, and I noticed that starting a new project always involved repeating the same setup steps. So I built a small tool cal...

workflowgit
by GravityDevilLucifero Mar 15, 2026 7/10
app Reddit

I vibe coded a tmux integrated Claude Code session manager

Hi all, I vibe coded naviClaude for personal use to manage all Claude Code session across all of my tmux sessions, and I wanted to share it in case other people have similar workflow. At my job, I ...

workflowgitconfigreview
by tomhalo Mar 15, 2026 7/10
app Reddit

Good structure for Claude to give yourself health advice?

I’m trying to set up Claude as a thought partner for health issues. I’ve connected all my health records through a third party app. I’m wondering if anybody has come up with a good architecture for...

skill
by Prudent-Lab-2655 Mar 15, 2026 6/10
app Reddit

Some Claude workflow options I've tried, what's your recommendation?

I find that claude's normal planning tools are just super reckless, you say do X and it goes into these wild coding session to produce thousands lines of code, half of it is based on a random decis...

skillworkflowgittestingreview
by _fboy41 Mar 15, 2026 7/10
app Reddit

Sharing my Claude Code-d media ranking app

Pretty crazy (for me at least) milestone that I wanted to share with someone but I just hit 500 installs on my Claude Code-d media ranking Android app, Curate! I initially started building my app C...

skillreview
by slashx14 Mar 15, 2026 9/10
app Reddit

Let's see those Claude Code CLI Workspace Setups!

https://preview.redd.it/2lpe5hwgh2pg1.png?width=3833&format=png&auto=webp&s=6969c284829e314243a1ea341231537a7071b040 Deployed into a Windows env. I did some work on my setup today based on some thi...

review
by Admirably_Named Mar 15, 2026 7/10
app Reddit

Create an agentic agent as good as CC

I’ve used Claude Code for six months and I’m very happy with it. I tried building my own agentic workflows and orchestrator, but ran into many problems. When I used Claude Code as the orchestrator,...

workflow
by shanumas Mar 15, 2026 7/10
app Reddit

BTW: Claude can submit your apps to the App Store for you

Coding iOS apps is easy now with Claude Code, but submitting them to the App Store is still very painful. Setting up signing certificates, uploading screenshots, filling out age requirements etc et...

mcpworkflow
by invocation02 Mar 15, 2026 7/10
app Reddit

Claude Code can submit your apps to the App Store

https://reddit.com/link/1ru01n2/video/djv8iaovu3pg1/player Coding iOS apps is easy now with Claude Code, but submitting them to the App Store is still very painful. Setting up signing certificates,...

mcpworkflow
by invocation02 Mar 15, 2026 7/10
app Reddit

Claude can submit apps to the App Store for you

https://reddit.com/link/1rtztrq/video/k9s8g2aqp3pg1/player Coding iOS apps is easy now with Claude Code, but submitting them to the App Store is still very painful. Setting up signing certificates,...

mcpworkflow
by invocation02 Mar 15, 2026 7/10
app Reddit

Google Meet, but for Claude

I kept needing my Claude agents to share context with each other – onboarding new agents, handing off projects, debating decisions. So I built AgentMeet. It's basically Google Meet but for AI agent...

by MatanRak Mar 15, 2026 5/10
app Reddit

What's new in CC 2.1.76 system prompts (+43 tokens)

Agent Prompt: Security monitor for autonomous agent actions (second part) — Clarified "base64-encoded" to "encoded (e.g. base64)" for sensitive data detection; broadened code-from-external deserial...

skillhookapigitconfig
by Dramatic_Squash_3502 Mar 15, 2026 10/10
app Reddit

Claude Pro worth it?

Hey, I am new to Claude just switching over from a GPT paid membership and after all the buzz through just the free plan im seeing how much better claude really is. As someone who is a student most...

skill
by Automatic-Tax6895 Mar 15, 2026 8/10
app Reddit

Vibe Coding with Excel XML & MCP

We work in an industry centered on excel. The Claude Addin is great for session specific modelling, reports etc. But we are experimenting with Claude Code to see if we can vibe develop excel based ...

mcpskillapi
by trippereneur Mar 15, 2026 9/10
app GitHub

cc-doc-tracker: Automated Tracker for Claude Code Official Documentation Changes

An automated tool that tracks changes to the official Claude Code documentation and surfaces diffs over time — useful for staying current with new features, deprecations, and API changes without manually checking the docs.

documentationtrackingchangelogautomationofficial-docs
by oikon48 Mar 15, 2026 6/10
app GitHub

DUDA: Isolation Guardian for Claude Code — Trust-Score Gated Code Migration

DUDA prevents AI agents from breaking tenant, layer, and service boundaries in Claude Code. Uses a 95-point trust-score threshold to gate code migrations — only changes that pass the isolation checks proceed.

securityisolationtrust-scoreboundariescode-migrationgating
by DavidKim0326 Mar 15, 2026 6/10
app GitHub

protoMaker: Autonomous Development Studio Where Ideas Become Shipped Software

An autonomous development studio where you describe an idea, and AI agents orchestrate the full development process — from planning through implementation — with human validation gates at key decision points.

autonomousdevelopmentorchestrationhuman-validationidea-to-product
by protoLabsAI Mar 15, 2026 6/10
app GitHub

batipanel: AI-Powered Terminal Workspace Manager (tmux + Claude Code)

batipanel is an AI-powered terminal workspace manager combining tmux and Claude Code. Organizes and manages coding sessions, terminal panes, and agent workspaces from a unified panel interface.

tmuxworkspace-managerterminalpanelsession-management
by batiai Mar 15, 2026 6/10
app GitHub

kanban-tui: Python TUI Task Manager Usable by AI Agents

A terminal-based Kanban board written in Python that supports direct manipulation by AI coding agents — agents can create, move, and complete tasks on the board programmatically during development sessions.

tuikanbantask-managerpythonterminalagent-accessible
by Zaloog Mar 15, 2026 6/10
app GitHub

kirocc: Local Proxy Relaying Anthropic API Requests to Kiro (Amazon Q) Backend

kirocc is a local proxy that relays Anthropic Messages API-compatible requests to the Kiro (Amazon Q) backend using Kiro CLI credentials — enabling any Anthropic-compatible tool to use Kiro as the backend without API key changes.

proxykiroamazon-qapi-compatibilitylocalcredentials
by d-kuro Mar 15, 2026 6/10
app GitHub

leonidas: Automate GitHub Issue Handling with AI-Generated Plans and PRs

leonidas automates GitHub issue handling end-to-end — generates implementation plans, writes code, and creates pull requests using AI-powered workflows. Designed to reduce the manual burden of routine issue work.

automationgithubissuespull-requestsai-workflowcoding
by tomoe317 Mar 15, 2026 6/10
app GitHub

tsk-tsk: Sandboxed Coding Agent Automation — Keep Your Agents Out of Trouble

tsk-tsk provides sandboxed execution environments for coding agent automation, preventing agents from taking dangerous actions outside their allowed scope. A lightweight safety layer for autonomous coding agents.

sandboxsafetyautomationexecutionboundariesagent-control
by dtormoen Mar 15, 2026 6/10
app GitHub

driftx: Eyes and Hands for Agentic Mobile Development

driftx gives AI coding agents visual perception and control for mobile development — enabling agents to see and interact with mobile UIs during the development and testing process.

mobileagenticui-controlvisualtestingdevelopment
by nomanr Mar 15, 2026 6/10
app GitHub

sessions-chronicle: Browse and Search Your AI Coding Sessions

sessions-chronicle is a local app for browsing and searching through past AI coding sessions — enabling developers to find, reference, and reuse patterns from previous Claude Code interactions.

sessionssearchhistorybrowserreferencereuse
by supermaciz Mar 15, 2026 6/10
app GitHub

glassbox: Local Tool for Humans to Review AI-Generated Code

glassbox is a local code review interface designed specifically for reviewing AI-generated code — surfacing changes, explanations, and context in a human-readable format before accepting AI output.

code-reviewhuman-reviewai-generatedlocalverificationtransparency
by brianwestphal Mar 15, 2026 6/10
app GitHub

ccmanager: Session Manager for Claude Code, Gemini CLI, Codex, Cursor, and More

A unified coding agent session manager that supports Claude Code, Gemini CLI, Codex CLI, Cursor Agent, Copilot CLI, Cline CLI, OpenCode, and Kimi CLI — all in one interface. Manages multiple agent sessions from a single dashboard.

session-managermulti-toolgeminicodexcursordashboard
by kbwo Mar 15, 2026 7/10
app GitHub

cc-lens: Real-Time Monitoring Dashboard for Claude Code

A real-time monitoring dashboard for Claude Code sessions, providing live visibility into session state, tool usage, and agent activity. Helps developers track what Claude is doing at any moment without digging into raw terminal output.

monitoringdashboardreal-timesessionvisibility
by Arindam200 Mar 15, 2026 7/10
app GitHub

tma1: Local-First Observability for AI Agents — Tokens, Cost, Latency, Traces

A local observability tool for AI agents that stores tokens used, cost, latency, and execution traces in a local SQLite database queryable with SQL. No cloud dependency, full data ownership, and immediately actionable metrics for every agent session.

observabilitytokenscostlatencytracinglocalsqlite
by tma1-ai Mar 15, 2026 7/10
app GitHub

skill-scanner: Security Scanner for Malicious AI Skills and Instruction Files

A security scanner that detects malicious or adversarial content in AI skill files, CLAUDE.md instructions, and agent rules. Designed to protect Claude Code users from prompt injection embedded in third-party skills and community-contributed instruction files.

securityscannerprompt-injectionskillssafetyadversarial
by thedevappsecguy Mar 15, 2026 7/10
app GitHub

clideck: Local Dashboard Organizing Multiple AI Coding CLI Sessions

A local web dashboard that mirrors and manages multiple AI coding CLI sessions (Claude Code, Codex, etc.) in real time, with resumable, project-based terminal workspaces. Think of it as a session manager with a web UI.

dashboardsession-managerweb-uimulti-sessionterminalresumable
by rustykuntz Mar 15, 2026 7/10
app GitHub

patch-claude-code: Show Files Read and Thinking Inline Without Verbose Mode

A patch for Claude Code that displays file reads and thinking inline in the output without needing to enable full verbose mode — giving developers visibility into what Claude is reading without the noise of complete verbose logging.

patchvisibilityfilesthinkingverbosedeveloper-experience
by a-connoisseur Mar 15, 2026 7/10
app GitHub

ciab: Claude-In-A-Box — Manage Coding Agents as Local Processes or Containers

ciab provides a REST API, CLI, and desktop app for managing Claude Code, Codex, Gemini CLI, and Cursor agent instances as either local processes or Docker containers. Standardizes agent lifecycle management across multiple tools.

containerdockerrest-apiclidesktop-appagent-managementmulti-tool
by shakedaskayo Mar 15, 2026 7/10
app GitHub

claudetop: htop-Style Monitor for Claude Code Sessions

claudetop is a real-time terminal monitor for Claude Code sessions — showing live cost, cache efficiency, model comparison across sessions, and smart alerts. Styled after htop, it provides at-a-glance operational insight into what your agents are spending.

monitoringterminalcostcachealertshtop-stylereal-time
by liorwn Mar 15, 2026 7/10
app GitHub

melina: Fast Native Process Monitor for Claude Code Agent Sessions

A fast, native terminal process monitor for Claude Code that tracks sessions, agent teams, MCP servers, tmux swarms, and orphaned processes. Gives real-time visibility into everything running in your Claude Code environment.

monitoringprocess-monitorterminalmcp-serverstmuxagents
by vinhnxv Mar 15, 2026 7/10
app GitHub

bankan: Control Center for Managing Many AI Coding Agents in One UI

bankan is a simple control center UI that gives visibility into every AI coding agent task, stage, and agent at a glance. Brings order to parallel AI development without leaving your local workflow — all within your terminal.

uicontrol-centermulti-agentparalleltask-managementdashboard
by stilero Mar 15, 2026 7/10
app GitHub

claude-hud: Real-Time Plugin Showing Context Usage, Tools, Agents, and Todos

A Claude Code plugin that renders a heads-up display showing current context usage percentage, active tools in use, running agents, and todo progress — all updated in real time during a session. Useful for monitoring session health at a glance.

monitoringhudcontextagentstodosplugin
by jarrodwatts Mar 15, 2026 7/10
app X

claudetop: Real-Time Token Cost and Cache Monitor for Claude Code

claudetop is an htop-style real-time monitor showing where Claude Code is spending tokens, cache efficiency, and projected monthly cost. Inspired by system resource monitors, it gives developers immediate visibility into agent spending patterns.

monitoringtokenscostcacheterminalreal-time
by @Oone_niko Mar 15, 2026 7/10
app X

Open Source AI IDE with Agent Command Center Supporting Claude Code and Codex

An open-source AI IDE inspired by Andrej Karpathy\'s ideas, featuring an agent command center that lets you run Claude Code and Codex as coordinated agents from within the IDE GUI. Growing with new features, it aims to unify multiple AI coding agent backends under a single interface for orchestrated agent workflows.

ideopen-sourceagentcodexorchestrationgui
by @eugeneboondock Mar 13, 2026 5/10
app Reddit

Git Quest: A Game Built in 1 Week Where Your GitHub History is Your Character

Git Quest is a game created entirely with Claude Code in one week where your GitHub commit history defines your character and your coding skills determine your class. The project is full of developer references and represents a creative showcase of what Claude Code can ship in a focused week-long sprint.

gamegithubcreativeappone-weekvibe-coding
by topbr Mar 13, 2026 5/10
app Reddit

AnyClaude 0.5.0: Subagent Backend Routing for Claude Code

AnyClaude 0.5.0 adds subagent backend routing — when Claude Code spawns agents via the Agent tool, each is pinned to a configurable backend for its lifetime. The release also introduces a modular 7-stage pipeline (extract → routing → headers → thinking → forward → transform → response), per-session thinking state, Ctrl+R for session-preserving restarts, per-session log files, and session token auth for proxy traffic.

proxyroutingsubagentsbackendanthropic-apiopen-source
by arttttt1 Mar 13, 2026 8/10
app Reddit

Hawkeye: local flight recorder and guardrails for AI coding agents

Hawkeye is an open-source observability tool for AI coding agents (Claude Code, Aider, etc.) that runs 100% locally. It detects when agents drift off-task using a heuristic scorer and optional local LLM scorer, and enforces guardrails like file protection, command blocking, and cost limits. Includes a web dashboard, session replay, and an MCP server for agent self-awareness.

observabilityguardrailssafetymcplocal
by Ok-Idea9032 Mar 13, 2026 8/10
app GitHub

JuhBDI: intent-driven autonomous development engine with BDI cognitive model

JuhBDI applies the Belief-Desire-Intention (BDI) cognitive architecture to Claude Code as a plugin, enabling intent-driven autonomous development with governed execution, audit trails, and learning memory. It structures how Claude reasons about goals and actions during coding sessions.

bdiautonomousplugincognitive-architecturememory
by JuhLabs Mar 13, 2026 7/10
app Reddit

Building a production PACS/DICOMweb server with Claude Code

A developer shares how they used Claude Code to build a full DICOMweb-compatible PACS server from scratch in TypeScript after finding Orthanc+S3 too slow. Claude Code drove the entire architecture: 15-page spec, 5-phase project plan, FastAPI-style service with PostgreSQL metadata and S3/Azure Blob storage. An impressive example of Claude Code tackling a complex domain-specific engineering problem.

dicommedicaltypescriptcase-studycomplex-projects
by Rizean Mar 13, 2026 6/10
app X

Real-Time Monitor for Every Claude Code Prompt, Response, and Token Usage

A tool that intercepts and displays every prompt, response, tool call, and token count that Claude Code sends in real time. Useful for debugging system prompts, understanding conversation threading, monitoring token patterns, and building automations on top via MCP.

appmonitoringdebugtokenstransparency
by @Dys_hay Mar 13, 2026 7/10
app GitHub

Thoughtbox: Git-Inspired Workspace for Claude Code Agent Teams

A structured workspace system inspired by Git's branching and merging model, designed for coordinating teams of Claude Code agents. Provides primitives for agent isolation, work sharing, and structured handoffs between agents in multi-agent workflows.

appmulti-agentworkspacegitcoordination
by Kastalien-Research Mar 13, 2026 7/10
app GitHub

verify: Verification Layer for Claude Code to Catch AI Mistakes

A verification layer that sits between Claude Code and your codebase to independently check AI-generated changes before they land. Addresses the well-known problem of Claude confidently making changes that silently introduce bugs.

appverificationqualitysafetyreview
by opslane Mar 13, 2026 7/10
app GitHub

openclaude: Open-Source Personal Resident AI Assistant Inspired by OpenClaw

An open-source personal AI assistant that runs continuously in the background, inspired by OpenClaw's resident AI concept. Provides always-on assistance without requiring explicit invocation, with a focus on self-hosted, local operation.

appresidentopen-sourceopenclawself-hosted
by is0383kk Mar 13, 2026 5/10
app GitHub

walnut: Self-Hosted Personal AI Butler with Claude Code Sessions and Memory

A self-hosted, local-first personal AI butler powered by Claude that integrates task management, Claude Code session management, a persistent memory system, and a web UI. Open source and designed for users who want full control over their AI assistant infrastructure.

appself-hostedbutlermemoryweb-ui
by EvanZhang008 Mar 13, 2026 7/10
app GitHub

parallel-code: Run Claude Code, Codex, and Gemini Side-by-Side in Git Worktrees

A tool that launches Claude Code, Codex, and Gemini CLI simultaneously, each in its own isolated git worktree. Allows direct comparison of AI coding agents on the same task, with clean branch isolation preventing agents from interfering with each other.

appparallelcomparisonworktreemulti-agent
by johannesjo Mar 13, 2026 8/10
app GitHub

itwillsync: Mirror Any Terminal Coding Agent to Your Phone Over LAN

Zero-cloud, agent-agnostic tool that mirrors any terminal-based coding agent (Claude Code, Codex, etc.) to your phone over your local network. No cloud dependency and works with any agent, making it useful for mobile monitoring of long-running sessions.

appmobileterminallanmirror
by shrijayan Mar 13, 2026 7/10
app GitHub

cc-plugin-viz: Web-Based Claude Code Plugin Manager

A web-based visual interface for managing Claude Code plugins. Provides a GUI for browsing, installing, and organizing plugins instead of editing config files manually. Makes plugin management more accessible for users less comfortable with CLI workflows.

apppluginmanagerguiweb
by uhyunpark Mar 13, 2026 7/10
app Reddit

VibePod 0.5.1: Claude Code CLI with Session Dashboard

VibePod is a CLI tool that wraps Claude Code with additional features including a dashboard for monitoring consumption and session management. Version 0.5.1 adds visual dashboards for tracking Claude Code usage. Available on PyPI.

appclidashboardmonitoringvibepod
by nez_har Mar 13, 2026 6/10
app Reddit

claude-sessions: Terminal UI for Browsing and Resuming Past Claude Code Sessions

A terminal UI that scans your Claude Code transcript files and lets you browse, search, and resume any past session. Built with Claude Code itself, it addresses the common problem of losing context from previous sessions by making them easily navigable.

appterminalsessionstuihistory
by fabiononato Mar 13, 2026 7/10
app Reddit

logifai: Auto-Capture Terminal Logs So Claude Code Can Search Them

Automatically captures terminal output and pipes it to Claude Code, eliminating the copy-paste loop of scrolling up to find errors. Run any dev command through logifai and Claude Code gets instant access to the full log output for debugging.

appterminallogsdebuggingautomation
by Open_Variety_405 Mar 13, 2026 7/10
app GitHub

TunaCode: AI CLI Coding Agent with Safe Git Branches and Multi-LLM Support

An AI-powered CLI coding agent that automatically creates safe git branches before making changes, supports multiple LLMs, and provides rich tooling. Designed as a safer alternative to direct AI code editing by isolating changes in branches.

appcligitmulti-llmsafety
by alchemiststudiosDOTai Mar 13, 2026 6/10
app GitHub

Claude-Code-Usage-Tracker: Real-Time Token Usage and Context Window in Status Bar

Adds real-time Claude Code metrics to your terminal status bar: token count, context window percentage, cache hit status, and session countdown. Solves the problem of not knowing how close you are to context limits until it's too late.

apptoken-usagecontext-windowstatus-barmonitoring
by REPOZY Mar 13, 2026 7/10
app GitHub

cckey: Lightweight CLI for Managing Multiple Anthropic API Keys

A minimal CLI tool for managing multiple Anthropic API keys when working with Claude Code across different projects or billing accounts. Enables quick switching between keys without manually editing config files.

appcliapi-keysmanagementanthropic
by huaguihai Mar 13, 2026 6/10
app Reddit

I built a multi model “council” workflow

a few weeks ago i posted about running coding tasks through a small “council” before handing them to a coding agent. the idea was simple. instead of prompt → generate → pray, have multiple models a...

workflowapi
by MotorAnxious5788 Mar 13, 2026 5/10
app Reddit

Vibe Coding Excel XML API?

We working in an industry centered on excel. The Claude Addin is great for session specific modelling, reports etc. But we are experimenting with Claude Code to see if we can vibe develop excel bas...

mcpapi
by trippereneur Mar 13, 2026 7/10
app Reddit

Not happy to be honest

not happy to be honest. The Pro plan already has quite limited 5-hour context budgets, and lots of it is getting wasted on things like these. I am using Opus 4.6. At first I though maybe Kiro's Age...

by StayTuned2k Mar 13, 2026 7/10
app Reddit

Want to use 2 claude Apss

So basically want to use 2 claude Pro accounts on mac --- should share everything else like MCP , projects everything but different accounts logged in as Apps. if anyone can help let me know. submi...

mcp
by Strict_Boysenberry89 Mar 13, 2026 5/10
app Reddit

LLMs can use tools and APIs now. So why can't one just trade for me?

Post-Opus 4.6, LLMs feel much better at using bash, code, local files, and tools. So I kept coming back to a simple question: if a model can use a computer reasonably well, why can’t I just give it...

skillworkflowapi
by InvestigatorLive1078 Mar 13, 2026 6/10
app Reddit

Running Claude code in an isolated environment

Hey everyone, In my current terminal environment I have a lot of superuser privileges from various CLI tools. I’m wondering whether running Claude inside WSL or something like Multipass would give ...

by rabbitdaddy81 Mar 13, 2026 7/10
app GitHub

rldyourterm: Crash-Intolerant AI Terminal Runtime for Claude Code, Codex, and Gemini CLI

A terminal runtime designed specifically for AI coding agents that crashes gracefully and recovers automatically. Optimized for Claude Code, Codex, and Gemini CLI — ensures long-running agent sessions survive unexpected terminations without losing progress.

terminalcrash recoveryruntimeCodexGeminireliability
by rldyourmnd Mar 13, 2026 7/10
app Reddit

Open-Source Gateway Daemon for Claude Code With Multi-Agent Orchestration and Slack

An open-source gateway daemon for the Claude Code CLI that adds background jobs, Slack integration, multi-agent teams, and a web dashboard. Acts as an orchestration layer on top of Claude Code for teams who need more than the CLI provides.

gatewaydaemonmulti-agentSlackorchestrationopen source
by TotalGod Mar 13, 2026 8/10
app GitHub

cortex: Cross-Session Memory for Multi-Agent Teams (OACP Example App)

An example app demonstrating the Open Agent Communication Protocol (OACP) for cross-session memory in multi-agent teams. Shows how multiple agents can share and persist context across sessions, enabling longer-running collaborative workflows.

memorymulti-agentOACPsessionscross-session
by kiloloop Mar 13, 2026 7/10
app GitHub

rehoboam: TUI for Monitoring Claude Code Agents in Real Time

A terminal user interface (TUI) for monitoring Claude Code agents as they run. Provides a live view of agent activity, making it easier to track multiple running agents and their status without switching between terminal windows.

TUImonitoringagentsterminalClaude Code
by m-mohamed Mar 13, 2026 7/10
app GitHub

claude-status: Live Status Line Showing Context, Cost, Model, Branch, and Worktree

A shell status line for Claude Code that shows context window usage, cost, model name, current git branch, and worktree — all in a live, updating line. Installable via zinit, Nix, or manually. Particularly useful for long sessions where knowing context remaining helps decide when to start a new session.

status lineshellcontextcostmodelbranch
by claude-contrib Mar 13, 2026 7/10
app GitHub

claude-code-notify: Desktop Notifications for Claude Code Task Completions

A simple, zero-dependency tool that sends desktop notifications when Claude Code tasks finish or need input. Install with one command. Useful for long-running tasks where you want to step away and be notified when Claude needs attention.

notificationsdesktopmacOStask completionproductivity
by JadenChoi2k Mar 13, 2026 7/10
app Reddit

QuadCode: Native Mac App to Run Claude and Other AI Agents Side by Side

A native macOS app (QuadCode) that puts up to 4 AI coding agents in a split-pane terminal simultaneously — Claude Code, Codex, Gemini, or others. Eliminates Alt-Tabbing between terminals when comparing model outputs or running parallel agents on the same task.

macOSappmulti-agentsplit paneparallelCodex
by Evening-Cup7154 Mar 13, 2026 7/10
app Reddit

3-Layer Relational Memory for LLMs: Models the Relationship, Not Just Facts

A memory system that models the conversational relationship itself rather than storing flat facts. After each session, a second LLM scores the relationship on 7 dimensions (formality, warmth, humor, depth, trust, energy, resilience), updating a vector via EMA. A sleep-time agent runs every 5 sessions for deeper consolidation — resulting in dramatically more context-aware, personalized AI responses.

memoryrelationalLLMClaude Opuspersonalization
by spectator81 Mar 13, 2026 7/10
app Reddit

ClaudeAgentViewer: Local Web UI for Browsing Claude Code Session Logs

Open-source local viewer for Claude Code session JSONL files that piled up over time. Browse sessions across projects, search prompts and responses, view full conversations including tool calls, track token usage, and see estimated compute/environmental impact. Everything runs locally — no cloud accounts required.

session logstoken usagelocal toolopen sourceJSONL
by Which_Significance78 Mar 13, 2026 7/10
app GitHub

CommandMate: Issue-Driven AI Development IDE for Claude Code and Codex

An IDE for issue-driven AI development that runs Claude Code and Codex CLI in parallel. Manage multiple issues simultaneously and keep work moving from both desktop and mobile. Designed for developers who want structured, issue-tracked AI coding sessions.

IDEparallelissuesmobileClaude CodeCodex
by Kewton Mar 13, 2026 7/10
app Reddit

Theow: Auto-Heals Failing Python Functions at Runtime Using LLMs

Wrap any Python function with @theow.mark() and when it raises an exception, Theow intercepts, diagnoses, and retries transparently. Built on pydantic-ai with OpenTelemetry observability via logfire. Supports all pydantic-ai providers including copilot-sdk and claude-agent-sdk. Particularly useful for auto-healing CI pipelines without copy-pasting error context.

CIauto-healruntimePythonopen sourcepydantic-ai
by __4di__ Mar 13, 2026 7/10
app GitHub

dotagents: Organize AI Agent Context Files to Reduce Token Usage

A tool for organizing AI agent context files (skills, agents, commands) effectively. Streamlines token usage and reduces context confusion in development projects by providing a structured way to manage the growing collection of agent configuration files.

contexttoken usageorganizationagentsfiles
by rubysthedog Mar 13, 2026 7/10
app Reddit

Terminal Status Bar for Claude Code: Token Usage + Memory Pressure at a Glance

A shell prompt status bar for Mac Mini M4 that pulls Claude Code token usage from Keychain and shows memory pressure — all in one line with color coding (green/yellow/red). No window-switching needed. Color thresholds: >90% current or >95% weekly triggers yellow; 100% triggers red.

status barterminaltoken usagemacOSmemory
by Ciprian_85 Mar 13, 2026 7/10
app GitHub

agentdock: Web Dashboard for Managing Parallel AI Coding Agents Across Repos

A web dashboard for running and managing multiple parallel AI coding agents (Claude Code, Cursor) across different repositories. Uses tmux sessions and git worktrees under the hood, giving a unified view of all running agents, their status, and outputs.

parallel agentsdashboardtmuxgit worktreesClaude Code
by vishalnarkhede Mar 13, 2026 8/10
app GitHub

octomind: Highly Configurable Autonomous Efficient-First Agentic AI CLI Framework

A CLI framework for building autonomous, efficient-first AI agents. Highly configurable with a focus on efficiency — prioritizes doing the most with the fewest resources. Suitable for building custom coding agents and automation workflows in the terminal.

frameworkCLIagenticautonomousefficient
by Muvon Mar 13, 2026 6/10
app X

Paper: Agent-Native Canvas — Claude Code and Cursor Can Read/Write HTML

Paper is a visual canvas tool that now lets AI agents (Claude Code, Cursor, Codex) directly read and write HTML to it. Enables a workflow where agents can push or pull from your codebase and pull real data into a live design surface — bridging coding agents and UI design.

canvasdesignagenthtmluicursor
by @paper Mar 13, 2026 6/10
app GitHub

llm-rustyolo: Run AI Agents With Filesystem, Privilege, and Network Isolation

llm-rustyolo provides three layers of isolation for AI agent execution: filesystem (agents can only access what you specify), privilege (runs with minimal OS permissions), and network (blocks unauthorized outbound connections). A Rust-based security wrapper for safer autonomous agent operation.

securityisolationsandboxrustnetwork-security
by RobinhoX Mar 13, 2026 7/10
app GitHub

claude-terminal: Multi-Session Terminal Manager With Tabs and Worktree Support

claude-terminal adds tabs, session persistence, multi-project workspaces, and git worktree support to Claude Code sessions—all within a single terminal window. Makes it easier to manage several parallel Claude Code sessions without juggling multiple terminal tabs manually.

terminalmulti-sessionsession-managementworktrees
by Duowg08 Mar 13, 2026 7/10
app GitHub

sandbox-agent: Run Coding Agents in Sandboxes, Control via HTTP

sandbox-agent runs Claude Code, Codex, OpenCode, and Amp inside sandboxed environments and exposes control over HTTP. Submit tasks programmatically, get results back through the API. A lightweight infrastructure layer for anyone building automated pipelines around coding agents.

sandboxhttp-apiautomationinfrastructuremulti-agent
by rivet-dev Mar 13, 2026 7/10
app GitHub

tail-claude-gui: Desktop GUI for Reading Claude Code Session JSONL Files

A desktop GUI application for browsing and reading Claude Code session JSONL files. Makes it easy to review past agent sessions, inspect tool calls and responses, and understand what happened during long autonomous runs—without parsing raw JSON manually.

guisession-replayjsonldebuggingdesktop
by delexw Mar 13, 2026 6/10
app GitHub

ai-agent-session-center: Real-Time Dashboard With Animated 3D Robot Sessions

A real-time dashboard that visualizes Claude Code, Gemini CLI, and Codex agent sessions as animated 3D robots with live terminals, prompt history, tool logs, and queuing. Runs on any device and supports managing multiple agent sessions simultaneously.

dashboardvisualizationsession-managementmulti-agent
by coding-by-feng Mar 13, 2026 7/10
app GitHub

prompt-caching: Automatic Prompt Caching That Cuts Token Costs Up to 90%

Automatically enables prompt caching for Claude Code with zero configuration. Eliminates redundant token costs on repeated file reads, bug-fix sessions, and long coding conversations by caching prompts at the API level. Claims up to 90% token cost reduction on cacheable workloads.

token-efficiencycachingcost-savingzero-config
by flightlesstux Mar 13, 2026 8/10
app GitHub

codemem: Lightweight Persistent-Memory Companion for Claude Code

codemem is a minimal persistent memory layer for Claude Code and OpenCode that stores notes, decisions, and context across sessions. Lightweight with no heavy dependencies—just a simple companion for keeping important project facts alive between conversations.

memorypersistencecontextsession-continuity
by kunickiaj Mar 13, 2026 6/10
app GitHub

lemmafit: Make AI Agents Prove Their Code Is Correct

lemmafit enforces formal correctness verification: rather than just writing code, AI agents must prove the code is correct before the task is considered done. A novel approach to reducing hallucinated "working" code by requiring logical proofs alongside implementation.

verificationformal-proofscorrectnessquality
by midspiral Mar 13, 2026 6/10
app Reddit

Dojigiri: SAST API With 121 Rules for LLM Security (OWASP LLM Top 10)

Dojigiri is a static analysis API that detects security issues in LLM-powered code: prompt injection, output flowing to exec/SQL, RAG injection, agents with unrestricted tool access, and secrets in prompts. 121 rules mapped to the OWASP LLM Top 10, covering Python, JavaScript, and TypeScript.

securitysastowaspllm-securitystatic-analysis
by That_Other_Dude Mar 13, 2026 7/10
app Reddit

Ship Safe: 13-Agent CLI for Deterministic Security Code Reviews

Ship Safe is an open-source CLI that orchestrates 12 highly specialized security agents to review code for vulnerabilities. Instead of asking Claude for a general security review (which produces vague results), it routes each concern to a dedicated specialist agent, yielding deterministic, actionable findings.

securitymulti-agentclicode-reviewsast
by DiscussionHealthy802 Mar 13, 2026 8/10
app Reddit

CW: CLI for Managing Multiple Claude Code Projects, Accounts, and Worktrees

CW is a CLI that solves friction in multi-project Claude Code workflows: switch CLAUDE_CONFIG_DIR between work and personal accounts, handle branch conflicts when reviewing PRs while coding on a feature, recover from expired conversations, and copy-paste Linear/GitHub context automatically.

climulti-projectaccountsworktreessession-management
by Alert-Tomatillo-3902 Mar 13, 2026 8/10
app Reddit

grape-root: Cut Token Usage by Caching Repository Context Across Sessions

grape-root addresses a common source of wasted tokens in Claude Code: re-reading the same repository context repeatedly across follow-up prompts. It caches context intelligently and injects only what is needed, reportedly saving $60+/month for heavy users. Free tool with a web interface; includes a Discord for setup help.

token-efficiencycachingcontextcost-saving
by intellinker Mar 13, 2026 6/10
app Reddit

Sidekick Agent Hub: VS Code Extension + CLI for Live Claude Code Session Monitoring

Sidekick Agent Hub is a VS Code extension and CLI toolkit that adds live session visibility to Claude Code: real-time token counts, tool usage, files touched, event stream, and warnings. Also includes AI coding workflows, inline completions, and session analytics. Built using Claude Code itself.

monitoringvscodesession-managementanalytics
by Cal_lop_an Mar 13, 2026 7/10
app GitHub

codemunch: Zero-Config Token-Efficient Code Exploration for Claude Code

codemunch provides code exploration for Claude Code with no MCP server, no Python, and no database required—just drop it in and go. It focuses on token efficiency when exploring large codebases, making it a lightweight alternative to heavier context-injection tools.

code-explorationtoken-efficiencyzero-config
by benmarte Mar 13, 2026 7/10
app GitHub

customgpt-claude-quadruple-verification: Quality Gate Plugin for Claude Code

A quality gate plugin that runs 4 verification cycles and 28 rules to block insecure, incomplete, and hallucinated AI output from Claude Code. Zero dependencies—just add it to your workflow to catch bad output before it reaches your codebase.

quality-gateverificationsecurityhallucination-detection
by kirollosatef Mar 13, 2026 7/10
app GitHub

AIAgentMinder: Session Continuity and Project Governance for Claude Code

AIAgentMinder takes you from initial idea through planning to MVP without losing context between sessions. It manages project governance and session continuity for Claude Code, ensuring the agent stays on track across multiple sessions and doesn't drift from the original spec.

session-continuityproject-managementgovernancecontext
by lwalden Mar 13, 2026 7/10
app Reddit

Claude Code Commander: Electron Desktop App for Multi-Repo Agent Orchestration

An Electron desktop app that manages Claude Code sessions across multiple repos with one-click context switching, live git diffs, and a file tree with git status badges. Its standout feature is an orchestrator agent with MCP tools that can view and control all other sessions — enabling cross-repo coordination like sharing API types or committing all repos at once. Built entirely using Claude Code in ~3,000 lines of TypeScript.

orchestrationmulti-repoelectrondesktopagentMCP
by Illustrious-Bug-5593 Mar 12, 2026 9/10
app GitHub

loom: Rust-Based Swarm Orchestrator for Claude Code Instances

A Rust-built agent orchestrator that spins up and coordinates a swarm of Claude Code instances to collaboratively build software. Enables parallel, multi-agent software development with Claude Code as the execution engine, managed by a performant Rust orchestration layer.

orchestrationswarmRustmulti-agentClaude Code
by cosmix Mar 12, 2026 8/10
app GitHub

claudex: Self-hosted Claude Code UI with full IDE experience

Claudex lets you build and host your own Claude Code web interface locally or in the cloud, offering a full IDE-like experience with powerful extensibility options. Useful for teams wanting a shared, customizable Claude Code environment without relying on the official CLI. Supports both local and cloud deployment.

self-hostedUIIDEwebcloud
by cannedsigmas Mar 12, 2026 7/10
app Reddit

CodeBoarding: visualize Claude Code scope impact on your codebase in real time

CodeBoarding generates high-level architectural diagrams of your codebase and highlights which components Claude Code touched during a session, letting you review scope without reading individual lines of code. Helps catch accidental cross-module changes instantly by showing visual diffs of what was modified. Uses LSP-based control flow graphs and LLM-generated naming for accurate structural analysis.

visualizationcodebasereviewscopeLSParchitecture
by ivan_m21 Mar 12, 2026 7/10
app GitHub

claude-pager: Fast C transcript pager with clickable links and queued prompt composer

A fast C-based transcript pager that fixes Claude Code's blank Ctrl-G screen issue and adds clickable links and file references in the terminal. Includes a queued prompt composer for batching inputs and a TurboDraft fast path for quick responses. Improves the terminal UX of Claude Code without changing its core behavior.

terminalpagerUXtranscriptCLI
by gradigit Mar 12, 2026 6/10
app GitHub

swob: macOS App to Browse, Search, and Resume Claude Code Sessions

swob is a native macOS app that addresses Claude Code's compaction problem — when the AI forgets context, you don't. It lets you browse, search, highlight key moments, and resume any past session. Built for users who run autonomous agents and need to track what happened.

macossessionsmemorycompactionapp
by IvyYang1999 Mar 12, 2026 7/10
app GitHub

claude-board: Real-Time OTLP Telemetry Dashboard for Claude Code Sessions

claude-board provides a real-time observability dashboard (web UI + terminal CLI) for Claude Code sessions via OTLP telemetry. It gives live visibility into tool calls, token usage, and session flow as Claude works.

telemetrydashboardmonitoringotlpobservability
by tvup Mar 12, 2026 7/10
app GitHub

idle: Mobile and Web Client for Claude Code

idle provides a mobile and web interface for managing and interacting with Claude Code projects and sessions from any device. Useful for reviewing progress and sending instructions without being at your main machine.

mobilewebclientremoteapp
by Northglass-Labs Mar 12, 2026 7/10
app GitHub

Jiva: Open-Source Autonomous CLI Agent With MCP, Skills, and Claude-Compatible Personas

Jiva is a CLI-first autonomous agent in TypeScript with a three-agent architecture (Manager, Worker, Client). It supports MCP servers, a built-in Skills system, and Jiva Personas — a plugin framework fully compatible with Claude Code Plugins. Positioned as an open alternative to proprietary AI coding agents.

autonomousagentmcpskillstypescriptopen-source
by KarmaloopAI Mar 12, 2026 7/10
app Reddit

tail-claude GUI: macOS App to Watch Claude Code Sessions Live, Built With Tauri

Inspired by the tail-claude TUI, this is a native macOS GUI built with Tauri (Rust + React) for watching Claude Code sessions in real time. Shows tool calls, file edits, and dialogue as they happen — useful for autonomous agents running as background daemons.

macostaurimonitoringsessionsgui
by Delexw Mar 12, 2026 7/10
app GitHub

Sebastian: AI Desktop Butler Companion for Claude Code With 116 Emotions and Wake Word

Sebastian is a desktop companion for Claude Code that adds personality and interactivity: 116 distinct emotions, wake word activation, smart tool approval dialogs, and British wit. Designed to make unattended Claude Code sessions feel more like genuine collaboration.

companiondesktopvoiceemotionswake-wordapp
by xidik12 Mar 12, 2026 7/10
app Reddit

ccreplay: Turn Claude Code Session Logs Into Short Highlight Reel MP4 Videos

ccreplay reads JSONL session logs from Claude Code, picks out key moments (tool calls, edits, errors, dialogue), and compresses them into a 30-120 second highlight reel video. Available as an npx tool with an interactive session picker.

sessionsreplayvideomp4visualizationapp
by zhebrak Mar 12, 2026 7/10
app Reddit

disclaw: Remote Control Claude Code From Discord Channels

disclaw runs Claude Code as a background daemon and lets you interact with it through Discord channels — useful for kicking off tasks from your phone or another machine. Each project gets its own channel, keeping work organized without a dedicated UI.

discordremotedaemonmobileapp
by consumedbythefire Mar 12, 2026 7/10
app Reddit

Sentrux: Rust Feedback Sensor That Helps AI Agents Write Better Code on Large Projects

After noticing Claude Code degrading on large codebases, this developer built Sentrux — a pure Rust interface that closes the feedback loop between AI agents and actual code state. It gives the agent better signals about what is working vs. what is not, improving code quality over time.

rustfeedbackcontextdebugginglarge-projects
by yisen123 Mar 12, 2026 7/10
app X

ngrep: Rust File Search 5-25x Faster Than grep for Claude Code on Large Repos

A developer found grep too slow when Claude Code searched a large repo, so they implemented ngrep in Rust. It runs 5x-25x faster than grep and about 1.25x faster than ripgrep with --gitignore support, specifically optimized for Claude Code file-search patterns.

rustgrepperformancesearchtoollarge-repos
by @desert_mouse Mar 12, 2026 7/10
app X

AI Creative Asset Search Engine Built With Claude Code and Gemini Embedding 2

A developer built a semantic search engine for UGC clips, product shots, and ad variations using Gemini Embedding 2 for vectors and Claude Code for development. Users search creative assets in plain English: "Find product shots with natural lighting" or "Show me all unboxing clips."

searchembeddingscreativegeminiappsemantic
by @mikefutia Mar 12, 2026 6/10
app Reddit

Claude Code Did My Taxes: Real Documents, Active Involvement, and $1,000+ Saved

A heavy Claude Code user put it to work on personal tax returns, saving over $1,000 despite requiring active involvement throughout. The hardest part was parsing state and federal PDFs — treating them as PNGs and overlaying text worked better than direct PDF parsing.

taxespdfreal-worldcase-studyworkflow
by FunScore645 Mar 12, 2026 6/10
app GitHub

jskim: Token-Saving Java File Reader for Claude Code Using tree-sitter — Saves 70-80%

jskim uses tree-sitter to generate compact structural summaries of Java files rather than passing the full source to Claude Code. Reduces input token usage by 70–80% for Java-heavy codebases while preserving the information Claude needs for navigation, analysis, and editing decisions.

javatoken-savingstree-sitterperformancecontext
by garvit-joshi Mar 12, 2026 8/10
app GitHub

claude-view: Live Dashboard for 10+ Claude Sessions With Cost Tracking and Sub-Agent Visibility

claude-view is a real-time dashboard that shows what all your concurrent Claude Code sessions are doing — active tool calls, cost tracking, search across session histories, and visibility into sub-agent activity. Built for developers running many parallel Claude Code instances who need situational awareness.

dashboardmonitoringcostsub-agentssessionsreal-time
by tombelieber Mar 12, 2026 8/10
app GitHub

devsandbox: Filesystem Isolation for AI Coding Assistants With bubblewrap and MITM Proxy

devsandbox wraps AI coding tools (Claude Code, Cursor, Codex) in a bubblewrap-based sandbox that isolates filesystem access and optionally routes traffic through a MITM proxy for inspection. Provides the security boundary needed to run AI agents that have broad tool permissions without exposing the full host system.

securitysandboxbubblewrapisolationfilesystemproxy
by zekker6 Mar 12, 2026 8/10
app GitHub

cozempic: Context Cleaning for Claude Code — Prune Bloated Sessions Automatically

cozempic monitors Claude Code session context and prunes it when it becomes bloated, using tiered pruning strategies (soft, medium, hard) to preserve essential context while shedding noise. Includes auto-guard mode that triggers before Agent Teams lose coherence due to accumulated junk in the conversation history.

contextpruningsessionmemoryagent-teams
by Ruya-AI Mar 12, 2026 8/10
app Reddit

Desktop App to Coordinate Multiple Claude Code Sessions With Tasks and Orchestration

Built to solve the problem of managing 5+ Claude Code sessions in separate terminals with no cross-session visibility. This desktop app provides a unified UI for submitting tasks, tracking agent progress, coordinating parallel sessions, and managing approvals — all in one window instead of scattered terminals.

desktoporchestrationsessionsmulti-agentcoordination
by maakikirikri Mar 12, 2026 8/10
app Reddit

Chrome Extension to Install Agent Skills From GitHub With One Click

Skill Scraper is a Chrome extension that detects SKILL.md files on any GitHub page and adds a one-click install button. Instead of manually copying skill files to your Claude Code config directory, you click install and the extension handles the placement. Works with any public GitHub repository.

chrome-extensionskillsSKILL.mdinstallationgithub
by oronbz Mar 12, 2026 8/10
app GitHub

AgentMonitor: Web Dashboard for Running and Managing Multiple Claude Code and Codex Agents

AgentMonitor provides a web-based dashboard to launch, monitor, and manage multiple Claude Code and Codex agent sessions simultaneously. Features include real-time streaming, task pipelines, session resume, git worktree isolation per agent, and remote access via a relay — all from a browser without needing terminal access.

dashboardmonitoringagentscodexworktreestreaming
by Ericonaldo Mar 12, 2026 8/10
app GitHub

xreview: Agent-Native Code Review for Claude Code Using Codex as Independent Reviewer

xreview is a code review engine for Claude Code that delegates the review to Codex as an independent third-party reviewer. Having a different model review Claude's own code catches issues that self-review misses, creating a lightweight two-model consensus system without a full CI pipeline.

code-reviewcodexmulti-modelagentsquality
by davidleitw Mar 12, 2026 8/10
app GitHub

ClaudeBot: Telegram Bot for Claude Code CLI With Plugin System and Streaming

ClaudeBot turns your phone into a command center for Claude Code — a Telegram bot that proxies Claude Code CLI with a plugin system, multi-bot support, task queuing, streaming output, and hot-reload. Useful for monitoring or launching Claude Code sessions while away from your desktop.

telegrammobilestreamingpluginsremote
by Jeffrey0117 Mar 12, 2026 8/10
app GitHub

agent-toolbox: Trusted Cross-Tool Registry With Automated Security Vetting

agent-toolbox is a curated registry for agent components — skills, MCP servers, and hooks — with end-to-end provenance tracking and automated security vetting. Rather than pulling skills from random GitHub repos, this registry validates components before listing them, reducing supply-chain risk in agentic setups.

registrysecurityprovenanceskillsmcphooksvetting
by yunseo-kim Mar 12, 2026 8/10
app GitHub

agentkernel: Run AI Coding Agents in Isolated MicroVMs With Sub-125ms Boot Times

agentkernel launches Claude Code and other AI coding agents inside lightweight microVMs (using Firecracker-style isolation) that boot in under 125ms. Each agent session gets real hardware isolation, preventing runaway agents from affecting the host system. Production-grade security for fully autonomous coding workflows.

securityisolationmicrovmfirecrackerautonomoussandboxing
by thrashr888 Mar 12, 2026 8/10
app Reddit

Tarvos: Automatically Starts New Claude Code Sessions When Context Degrades

Context degradation silently hurts output quality by phase 3 of 8 in long tasks. Tarvos monitors session quality and automatically spins up a fresh Claude Code session when degradation is detected, carrying over the PRD, progress notes, and active context. Designed for multi-phase, unattended coding tasks.

contextsession-managementautomationunattendedquality
by SuckWallStreetDry Mar 12, 2026 8/10
app GitHub

edda: Automatic Decision Memory for Claude Code — Local, Deterministic, Zero API Cost

edda automatically records architectural and implementation decisions Claude makes during a session and stores them locally in a structured format. It is deterministic (no LLM post-processing), has zero additional API cost, and lets subsequent sessions recall why specific choices were made — especially useful for long-running projects.

memorydecisionslocaldeterministiccontext
by fagemx Mar 12, 2026 8/10
app GitHub

swarm: Web Dashboard and Autopilot for Claude Code Agents

swarm provides a browser-based UI to manage Claude Code agent sessions, submit tasks, and approve or reject pending tool calls — all from your browser. Acts as an autopilot layer between you and multiple concurrent Claude Code instances, giving visibility and control without a terminal per session.

dashboardagentsautopilotbrowsermonitoring
by bschleifer Mar 12, 2026 8/10
app GitHub

yume: Native Desktop UI for Claude Code With Orchestration and Multi-Provider Support

yume is a Tauri + React desktop app that wraps Claude Code with a proper GUI — streaming output, background agents, multi-provider model selection, and session orchestration in a native macOS/Linux/Windows window. An alternative to terminal-only usage for developers who prefer a visual interface.

desktopGUItaurireactorchestrationnative
by aofp Mar 12, 2026 8/10
app Reddit

Desloppify v0.9.5: Automated Codebase Improvement Running for Days Without Fails

Desloppify is an automated tool that iterates over your codebase making improvements, with Claude approving over 95% of its changes in the latest release. Version 0.9.5 introduces a new mascot and claims 24+ hours of continuous operation without failures, making it one of the more reliable autonomous code improvement tools.

automationcode-qualityautonomousrefactoring
by PetersOdyssey Mar 12, 2026 8/10
app GitHub

Skiller: macOS Menubar App for Managing Claude Code Skills

Desktop menubar app for managing and installing Claude Code plugins and Agent Skills effortlessly. Provides a GUI interface for browsing, installing, and managing the growing ecosystem of Claude Code skills.

skillspluginsmenubardesktop appmanagementmacos
by Enxs969 Mar 12, 2026 7/10
app Reddit

Money Money: Open-Source Personal Finance App Built With Claude Code

An open-source personal finance tracking app built 99% with Claude Code, featuring capabilities that existing finance apps lack. Built through vibe coding sessions, it is now usable for daily personal finance tracking.

personal financeopen sourcevibe codingapp
by bloknayrb Mar 12, 2026 5/10
app Reddit

Malwar: Security Scanner for Malicious Instructions in SKILL.md Files

Malwar runs a 4-layer pipeline—rule engine, URL crawler, LLM analysis, and threat intel—against Claude Code SKILL.md files to detect malicious instructions: embedded curl-to-bash payloads, base64 blobs, and credential-targeting paths. Addresses a real gap since traditional code scanners do not analyze natural language agent instructions.

securityskill-filesvulnerability-scannerprompt-injectionsafety
by Ap6pack Mar 11, 2026 8/10
app Reddit

SkillsGate: Semantic Search + One-Command Install for 45,000+ AI Agent Skills

SkillsGate indexes 45,000+ agent skills from GitHub with LLM-enriched metadata and vector embeddings for intent-based search—find skills by what you want to do, not exact names. Install any skill with a single npx command. Supports Claude Code, Cursor, and Windsurf.

marketplaceskillssemantic-searchdiscoveryinstall
by orngcode Mar 11, 2026 8/10
app GitHub

Claude-Paste: Zero-Dependency Clipboard Screenshot Pasting for Claude Code

Claude-Paste automatically pastes clipboard screenshots into Claude Code with smart freshness detection to avoid sending stale images. Zero dependencies, cross-platform (Windows/macOS/Linux), MIT licensed.

clipboardscreenshotsutilitycross-platform
by mailfnguides-del Mar 11, 2026 7/10
app GitHub

remotelab: Self-Hosted Browser Access to Claude Code CLI from Any Device

remotelab lets you access your Claude Code CLI from any browser—phone, tablet, or any computer—without installing Claude Code on each device. Self-hosted, giving full control over your remote development sessions.

remoteself-hostedbrowserclimobile
by trmquang93 Mar 11, 2026 8/10
app GitHub

340 Plugins + 1,367 Agent Skills with CCPI Package Manager for Claude Code

An open-source marketplace bundling 340 Claude Code plugins and 1,367 agent skills, with the CCPI package manager for easy installation. Includes interactive tutorials and production orchestration patterns.

pluginsskillsmarketplacepackage-managercommunity
by jeremylongshore Mar 11, 2026 9/10
app GitHub

oss-autopilot: Claude Code Plugin for Managing Open-Source Contributions

An AI autopilot that handles open-source contribution management—tracking PRs, responding to maintainers, discovering issues, and maintaining contribution velocity. Integrates directly as a Claude Code plugin.

open-sourcegithubautomationplugincontributions
by costajohnt Mar 11, 2026 6/10
app GitHub

viagen: Vite Dev Server Plugin for Claude Code SDK Integration

A Vite dev server plugin that exposes API endpoints for chatting with the Claude Code SDK during local development. Enables web projects to integrate Claude Code agent capabilities directly into their dev server workflow.

vitepluginsdkweb-development
by viagen-dev Mar 11, 2026 6/10
app GitHub

midtown: Human-Scale Interface for Multi-Agent Development

midtown provides a thoughtfully-designed UI layer for coordinating multiple AI coding agents. Focuses on keeping developers in control and maintaining situational awareness during complex multi-agent workflows.

multi-agentuiinterfaceorchestration
by btucker Mar 11, 2026 6/10
app GitHub

ClaudeNotifier: macOS Notification App for Claude Code

ClaudeNotifier is an open-source macOS app that sends native system notifications for Claude Code events. Useful for staying aware of agent status without keeping the terminal in focus.

macosnotificationsutility
by mlz11 Mar 11, 2026 6/10
app GitHub

gal.run: Enterprise Governance Platform for Claude Code Agent Settings

gal.run provides centralized discovery, configuration, and synchronization of Claude Code settings across an organization. Designed for teams that need to standardize and govern how AI coding agents are configured.

enterprisegovernanceteamconfigurationsettings
by Scheduler-Systems Mar 11, 2026 7/10
app Reddit

CAS: Parallel Agent Orchestrator with Git Worktrees and SQLite Message Queue

CAS reverse-engineers Claude Code's Team feature to build a better multi-agent orchestrator. Each worker gets its own git worktree, allowing concurrent edits to the same file without locking. A push-based SQLite message queue handles inter-agent communication, and every task requires a demo statement and self-verification gate before closing.

orchestrationmulti-agentgit-worktreesparallelrust
by aceelric Mar 11, 2026 8/10
app Reddit

Build Product Demo Videos Free with Claude Code + Remotion

Founder used Claude Code with the Remotion (React-based video) skill to produce marketing reels and animated landing pages after being priced out of motion design agencies. First reel took 3 hours, now under 1 hour. Results: thousands of views and product validation.

remotionvideodemoskillsmarketingreact
by ashadis Mar 11, 2026 7/10
app Reddit

Codeman: Manage Claude Code Sessions Across All Devices via Browser

Self-hosted web app (run on Mac Mini, VPS, or Linux) that manages multiple tmux-based Claude Code or Opencode sessions accessible from any device via QR code. Features zero-lag typing, file browser, notification support, and secure one-time-key remote access.

session-managerremotetmuxbrowsermobileself-hosted
by Kindly-Inside6590 Mar 11, 2026 7/10
app Reddit

Switchboard: Electron Desktop App for Managing Claude Code Sessions

Free open-source desktop app that organizes all Claude Code sessions in one window. Alerts when a session needs permission approval, supports full-text search across all session content (SQLite FTS5), session forking, and per-project CLI flag defaults. Built entirely with Claude Code.

session-managerelectrondesktopfts5alertsopen-source
by ali-b-doctly Mar 11, 2026 8/10
app GitHub

claude-code-webui: Browser-Based Interface for Claude Code on Any Device

Web UI that wraps Claude Code for browser access from any device, maintaining full compatibility with local setup including file system access. No cloud dependency — runs as a local server with full Claude Code feature parity.

web-uiremotebrowserinterfacelocal
by Tommy-hub117 Mar 11, 2026 6/10
app GitHub

agent-session-viewer: Browse and Search Past AI Coding Session Insights

Tool for browsing and searching through past Claude Code session histories to find previously solved problems and decisions. Helps avoid re-deriving solutions that were already worked out in earlier sessions.

sessionshistorysearchproductivity
by princeraj005 Mar 11, 2026 5/10
app GitHub

claudecodeusage: macOS Menubar App for Monitoring Claude Code Usage Limits

Lightweight macOS menubar app that shows real-time Claude Code usage and rate limit status. Features clear indicators for remaining tokens/requests and live updates, helping you avoid unexpected session interruptions.

macosmenubarusagelimitsmonitoringrate-limit
by naufalrafifr01 Mar 11, 2026 7/10
app GitHub

claude-vault: AI-Assisted Obsidian Knowledge Base Synced Across Devices

Obsidian plugin that uses Claude to power an AI-assisted knowledge base with cross-device sync for notes and tasks. Enables natural language querying and linking of notes within the Obsidian vault.

obsidianknowledge-basenotessyncproductivity
by akashbytecode Mar 11, 2026 5/10
app Reddit

Claude for Excel and PowerPoint Now Share Context and Support Skills

Claude for Excel and Claude for PowerPoint now share full conversation context across open files so actions in one app are informed by what is happening in the other. Skills are also now available in both add-ins. Available on Bedrock, Vertex AI, and Microsoft Foundry.

excelpowerpointofficeskillscontextadd-in
by Forsaken-Reading377 Mar 11, 2026 6/10
app Reddit

Claude Code Statusline: per-session colors, topic labels, and quota bars

A feature-rich statusline for Claude Code that shows per-session colors (unique hue per session via ID hashing), LLM-generated topic labels via Claude Haiku, live 5-hour/7-day quota bars with reset countdowns, and context window percentage. Requires macOS, Nerd Fonts v3+, and uses the Anthropic OAuth API for quota data. Includes a companion UserPromptSubmit hook for topic capture.

statuslinehookquotaterminalmacos
by leefuhr Mar 11, 2026 7/10
app GitHub

Perspective: Claude Code Plugin to Reality-Check Your Project Approach

A Claude Code plugin that audits your project before you go deep into implementation. It researches the current landscape, checks your code against live documentation, and gives a verdict: stay the course, adjust, pivot, or adopt an alternative. Helps avoid wasted effort from building on outdated or wrong assumptions.

pluginauditdocumentationresearchdecision
by giovicordova Mar 11, 2026 8/10
app X

Upstash Box: Isolated Cloud Sandboxes with Built-in Claude Code

Upstash Box provides secure, isolated cloud sandboxes pre-configured with Claude Code (or Codex/OpenCode). Designed for giving AI agents a computer environment — sandboxes sleep when idle and wake in milliseconds. Removes the overhead of setting up local environments for agentic tasks.

sandboxcloudagenticinfrastructuredevtools
by @upstash Mar 11, 2026 7/10
app Reddit

Dragon Brain: Docker-Based Persistent Memory for Claude with Google Drive Backup

A self-hosted persistent memory system for Claude that runs entirely in Docker. Memories are never deleted — only pushed down a recency chain so nothing is lost. Includes automatic Google Drive backup with 7-day rolling retention. Claude manages the system end-to-end; human intervention is kept to a minimum beyond the initial Docker install.

memorydockerpersistentgoogle-driveself-hosted
by iikarus4 Mar 11, 2026 5/10
app GitHub

memeta: 102 Memory Techniques for AI Agents, All Coexisting Additively

A comprehensive memory library implementing 102 distinct memory techniques that all work together additively rather than competing. Backed by over 2,000 tests for reliability. Designed to give AI agents simultaneous access to every effective memory approach without configuration trade-offs.

memorytechniqueslibrarytestingagents
by lee-fuhr Mar 11, 2026 6/10
app GitHub

claude-architecture-mapper: Auto-Generate Mermaid Dependency Graphs for Claude Plugins

A tool that automatically scans your Claude Code plugin ecosystem and generates a Mermaid.js dependency graph — a visual Mental Model Map of how plugins and components relate. Useful for understanding complex multi-plugin setups and onboarding new contributors to Claude Code environments.

visualizationmermaiddependency-graphpluginsarchitecturedocumentation
by ordinary9843 Mar 11, 2026 6/10
app GitHub

agent-sessions: Native macOS Session Browser for Claude Code, Codex, and More

A native macOS app that provides a unified session browser, agent cockpit, analytics, and rate limit tracker across Claude Code, Codex CLI, OpenCode, Gemini CLI, and other AI coding agents. Features full-text search across all past sessions, one-click resume, real-time rate limit visibility, and session archiving.

macossession-managementanalyticscodexgeminimulti-agentproductivity
by jazzyalex Mar 11, 2026 8/10
app GitHub

tuicommander: Desktop Terminal Orchestrator for Parallel AI Coding Agents

A Tauri + SolidJS + Rust desktop app for running dozens of AI coding agents simultaneously in a terminal grid interface. Provides visual orchestration of parallel coding sessions with split-pane layout management. Built for teams or power users who want to run many agents against different tasks or codebases at once.

orchestrationparallelterminaltaurirustmulti-agentdesktop
by sstraus Mar 11, 2026 7/10
app GitHub

cc-notify: Phone Alerts When Claude Code Needs Attention on Remote Servers

A lightweight notification tool that sends push notifications to your phone when Claude Code pauses for input on remote servers. Eliminates the need to repeatedly check SSH sessions while agents run long tasks. Perfect for overnight or background agentic coding sessions.

notificationsremoteserverproductivitymonitoring
by flavio87 Mar 11, 2026 7/10
app GitHub

claude-code-proxy: Transparent Proxy and Live Dashboard for API Interactions

A transparent proxy server that sits between Claude Code and the Anthropic API, logging all interactions and displaying them on a live dashboard. Useful for debugging token usage, inspecting tool calls, and understanding exactly what prompts are being sent. Simple setup with minimal configuration.

proxydebuggingmonitoringapidashboard
by Haidzai Mar 11, 2026 6/10
app Reddit

Agentic Data Analysis with Claude Code

Hey Reddit, as a former data analyst, I’ve been tooling around trying to get agents to do my old job. The result is this system that gets you maybe 80% of the way there. I think this is a good data...

by PoorPhipps Mar 11, 2026 7/10
app Reddit

the overcomplexification effect inhibition protocol

Once I realized I could build a dozen custom mcp tools and related skills in a day sometime last fall when Sonnet 4 was still the Boss before Opus-4.5 dropped at price for the month, I binged and m...

mcpskillconfig
by Efficient_Smilodon Mar 11, 2026 7/10
app Reddit

Marketing Pipeline Using Claude Code

Previously posted about running Claude Code as a K8s CronJob and using markdown as a workflow engine. This one's about the pipeline that runs on it: scanners, a classifier with 13 structured questi...

workflow
by kotrfa Mar 11, 2026 9/10
app Reddit

Handling Domain rich complex enterprise grade codebases

Hi folks, most AI tools work great for standalone projects. I wanted to hear thoughts from the community regarding how they handle actual enterprise level code. If you work at a product company, th...

skillclaude.mdreview
by tikluu Mar 11, 2026 9/10
app Reddit

I built AgentLens a agent context window extension using Claude

When I use Claude on a daily basis, I felt like flying blind. I kept getting surprised by the sudden compactions, loss of key files from context, missing documents that I could have updated while b...

gittesting
by Sufficient-Rough-647 Mar 11, 2026 7/10
app Reddit

Agent Skill Dependencies

I've built a dependency tool for agent skills and am looking for more tests and edge cases. I've found across various SDK/API/CLI/MCPs that versioning of those tools and the related skills has beco...

mcpskillapigit
by wryansmith Mar 11, 2026 10/10
app Reddit

Show: auto-accept and monitor Claude Code sessions

Open source (MIT) project - Auto-accept and monitor for Claude Code Requires iTerm2 w/ Python API I got sick of constantly hitting Accept when running many subagents or Team Agents. I wanted to be ...

apipython
by NiteShdw Mar 11, 2026 7/10
app Reddit

Why I run methodical full code base audits frequently.

Today I finished two days worth of clade coding, the equivalent of several months of work for a team under normal conditions based on how I approach it. I decided to run a new "design audit" that t...

skillreview
by diystateofmind Mar 11, 2026 6/10
app Reddit

Why AI Coding Agents like Claude Waste Half Their Context Window

I've been running AI coding agents on a large codebase for months and noticed something that bugged me. Every time I gave an agent a task like "add a new API endpoint," it would spend 15-20 tool ca...

apiconfig
by notadamking Mar 11, 2026 7/10
app Reddit

Are you innovating at work?

At home I built a knowledge base in Obsidian with custom workflows, skills and CLAUDE.md files to give Claude context on my projects and the leverage looks real to me. At work, everything is harder...

skillworkflowclaude.md
by Tricky-Swimming-5992 Mar 11, 2026 8/10
app Reddit

An app that turns your everyday work into Claude skills

We built an open-source local app that automatically spots your repetitive tasks and suggests Claude skills for them. The core value is that it scans what you do outside of Claude as well - everyth...

mcpskillgit
by jzap456 Mar 11, 2026 9/10
app Reddit

How are you sandboxing your AI coding agents?

I've been running Claude Code and Aider with full filesystem access and it makes me nervous. Docker helps with isolation but doesn't let me review what the agent changed before committing. I built ...

dockerreview
by drmarkamo Mar 11, 2026 7/10
app Reddit

I hate Vibecoded UI

Every startup has the same ass landing page and I feel like people don't talk about it that much. With everyone using Claude Code to built the next big startup, people don't really care much about ...

mcpgitclaude.md
by Substantial-Problem7 Mar 11, 2026 10/10
app GitHub

log-reducer: VS Code Extension That Reduces Log Files for AI Consumption

A VS Code extension that pre-processes log files before feeding them to AI, removing noise and compressing repeated patterns to save tokens. Makes large log files manageable for Claude Code analysis without hitting context limits.

vscodelogstoken-optimizationcontext
by launch-it-labs Mar 11, 2026 6/10
app GitHub

beads: A Memory Upgrade for Your Coding Agent

Beads provides persistent memory capabilities for coding agents, enabling them to remember context across sessions and build on previous work. Addresses the cold-start problem where agents re-explore the same codebase every session. From steveyegge, a well-known Google/Amazon engineer.

memorypersistencecontextagentssessions
by steveyegge Mar 11, 2026 7/10
app GitHub

claude-connector: Node.js API for Claude Code CLI

A programmatic Node.js interface for the Claude Code CLI that lets you embed Claude Code into your application code — no terminal required. Enables building automation pipelines, CI integrations, and tools that drive Claude Code programmatically.

nodejsapicliautomationintegration
by scott-walker Mar 11, 2026 7/10
app GitHub

audiobash: Voice-Controlled Terminal for Developers

audiobash lets developers control their terminal by voice, executing commands instantly via speech. Useful for hands-free coding sessions with Claude Code or other CLI tools. Reduces friction for developers who prefer to dictate rather than type commands.

voiceterminalaccessibilityclispeech
by jamditis Mar 11, 2026 6/10
app GitHub

keyjawn: Android Keyboard for LLM CLI Agents

A custom Android keyboard designed for LLM CLI users — includes terminal keys (Ctrl, Tab, Esc, arrow keys) and image upload support for Claude Code and OpenClaw users. Makes mobile-based coding agent sessions practical.

androidkeyboardmobileterminalcli
by jamditis Mar 11, 2026 6/10
app GitHub

claude-plugins-official: Official Anthropic-Managed Claude Code Plugin Directory

The official, Anthropic-managed directory of high-quality Claude Code plugins. A curated, authoritative source for discovering vetted skills, MCP integrations, and extensions for Claude Code. The canonical starting point for anyone looking to extend Claude Code.

pluginsofficialanthropicdirectoryskillsmcp
by anthropics Mar 11, 2026 9/10
app GitHub

codeflare: Cloud IDE With 5 Parallel AI Coding Agents in Cloudflare Containers

A cloud IDE that runs 5 AI coding agents simultaneously in ephemeral Cloudflare Containers with per-user isolation and persistent R2 storage. One-click deploy, accessible from any device including phone. Enables massive parallel AI-assisted development in the cloud.

cloud-ideparallelcloudflarecontainersagents
by nikolanovoselec Mar 11, 2026 7/10
app GitHub

optimus-code: VS Code Extension for Parallel AI Agent Orchestration

A VS Code extension that orchestrates multiple AI coding agents in a unified "Council Chat", routing complex tasks to specialized agents running in parallel. Provides a single interface to coordinate agent collaboration directly inside VS Code.

vscodeextensionparallelorchestrationmulti-agent
by cloga Mar 11, 2026 7/10
app GitHub

token-optimizer: Audit Your Claude Code Context Window Overhead

token-optimizer finds "ghost tokens" — hidden overhead in Claude Code's context window. Audits what's consuming tokens, shows where they go, and helps reclaim them. Essential for power users trying to maximize context efficiency and extend session length.

token-optimizationcontext-windowdebuggingefficiency
by alexgreensh Mar 11, 2026 7/10
app GitHub

handclaw: Control Claude Code, Codex, and OpenCode via Slack

handclaw connects Claude Code, Codex, and OpenCode to Slack, letting you monitor agent progress, switch agents by renaming channels, and code from your phone. One Slack workspace can manage multiple AI coding agents simultaneously — work from anywhere.

slackmobileagentsmonitoringintegration
by deciding Mar 11, 2026 8/10
app Reddit

RuFloUI: Visual Dashboard for Multi-Agent Claude Swarm Orchestration

RuFloUI is an open-source React dashboard wrapping claude-flow that provides full visual interface for multi-agent Claude workflows. Spawn specialized agents (coder, researcher, tester, reviewer), watch them work in real-time, assign tasks to the swarm, and support mesh/hierarchical/ring topologies.

dashboardmulti-agentorchestrationvisualizationclaude-flow
by TheFenixRebitrh Mar 11, 2026 7/10
app GitHub

tokengolf: Gamified Claude Code Token Efficiency

tokengolf turns Claude Code token efficiency into a game — track your score, compete to use the fewest tokens to accomplish tasks. Encourages developers to write tighter CLAUDE.md instructions and more efficient prompts. Fun way to build good habits.

tokensefficiencygamificationoptimization
by josheche Mar 11, 2026 7/10
app GitHub

lazygaze: Split-Pane TUI for AI Code Review With Claude CLI

lazygaze is a split-pane terminal UI that pipes git diffs directly to Claude CLI or GitHub Copilot CLI for code review, with streaming output, a prompt library, and a persona system. Makes AI-assisted code review fast and interactive from the terminal.

tuicode-reviewgitterminalclistreaming
by benstroud Mar 11, 2026 7/10
app Reddit

2llm.app: Free Browser Tool to Migrate ChatGPT Memories to Claude CLAUDE.md

Client-side tool that transforms exported ChatGPT memories — removing duplicates, outdated entries, and third-person narrative — into a clean XML and CLAUDE.md file for Claude. Nothing leaves the browser; bring your own API key. Helps avoid hitting Opus context limits with bloated memory imports.

memorychatgptmigrationclaude.mdbrowser
by Horror_Cricket2462 Mar 10, 2026 5/10
app GitHub

Claude Code Hub: Unified Multi-API Manager with Real-Time Monitoring

A hub for unifying and managing multiple AI service APIs alongside Claude Code, with real-time monitoring. Provides a single interface to optimize API usage and monitor integrations across multiple providers.

apimanagementmonitoringintegrationhub
by odahpen Mar 10, 2026 5/10
app GitHub

onWatch: Real-Time AI API Quota Tracker for Claude Code and More

Lightweight background daemon (<50MB RAM) that tracks AI API quotas across Claude Code (Anthropic), Codex, GitHub Copilot, and other providers in real time. Uses SQLite storage with a Material Design 3 dashboard. Zero telemetry, local-only.

quotamonitoringdashboardclaude-codelocalsqlite
by onllm-dev Mar 10, 2026 6/10
app GitHub

AI Productivity Dashboard: Track and Route Tasks Across Claude Code, Cursor, and More

A Universal Brain for AI-assisted coding that benchmarks Claude Code, Cursor, Aider, Windsurf, Copilot, and Gemini. Routes tasks to the best tool+model combo based on historical performance. PWA with standalone binaries, MCP server, and local SQLite storage.

dashboardbenchmarkingroutingmulti-toolpwamcp
by Riko5652 Mar 10, 2026 7/10
app Reddit

Rampart: Free Open-Source Firewall That Blocks Credential Leaks in Claude Code

A security layer that intercepts every Claude Code action before execution. Blocks secrets from leaking into the context window (AWS keys, GitHub tokens, private keys), enforces temporary trust grants, generates custom policies from real usage patterns, and logs everything in a tamper-proof hash-chained audit trail. ~10 microsecond overhead per check.

securityfirewallcredentialsauditopen-sourcepermissions
by NovelInitial6186 Mar 10, 2026 8/10
app GitHub

claude-statusline: Configurable Status Line for Claude Code

A configurable status line display for Claude Code sessions. Adds at-a-glance session status information in a customizable format, improving visibility into what Claude is doing during long-running tasks.

statusuiterminalvisibilityconfiguration
by felipeelias Mar 10, 2026 6/10
app Reddit

slides-grab: Visual Fix-Loop Tool for Claude Code HTML Slide Generation

A companion tool for Claude Code + frontend skills slide workflows. Drag the part of an HTML/CSS slide you want to fix, and it sends the XPath plus a highlighted screenshot to Claude so it knows exactly what to edit. Eliminates the painful prompt-and-guess cycle for visual layout fixes.

slidesvisualhtmlcssfrontendscreenshot
by jeffrey-0711 Mar 10, 2026 7/10
app GitHub

clash: Command Line Agent Safety Harness for Unattended Agent Runs

A safety harness for running AI coding agents unattended. Adds guardrails so you can let agents run autonomously without constant babysitting. Focuses on command-line agent workflows and preventing runaway behaviors.

safetyharnessautonomousagentunattendedguardrails
by empathic Mar 10, 2026 6/10
app GitHub

Tide Commander: Visual Orchestrator for Multiple Claude Code and Codex Agents

A visual interface for orchestrating multiple Claude Code and Codex agents simultaneously. Provides a dashboard to manage, monitor, and coordinate parallel agent sessions — useful for complex multi-agent workflows requiring human oversight.

orchestrationmulti-agentvisualdashboardcodexclaude-code
by deivid11 Mar 10, 2026 8/10
app X

Static ad generator built in Claude Code creates 100+ Facebook ad variations

A developer used Claude Code to build a static ad generator that produces over 100 Facebook ad variations in minutes. It takes a competitor ad, product photo, and brand kit as inputs and generates on-brand variations targeting different customer personas. A practical example of building marketing automation tools entirely with Claude Code.

appvibe-codingmarketingautomationclaude-code
by @TechWith_Nova Mar 10, 2026 6/10
app X

Shipper 2.0: Claude Code package for autonomous app and Chrome extension building

Shipper 2.0 is a package that enables Claude Code Opus 4.6 to autonomously build web/mobile apps and Chrome extensions. It was released alongside a Claude Code update that expands its agentic capabilities. A practical tool for developers who want rapid autonomous prototyping.

shipperautonomousapp-builderchrome-extensionopus
by @chhddavid Mar 10, 2026 7/10
app X

Agent Safehouse: sandbox Claude Code, Codex, and Aider with restricted system permissions

Agent Safehouse is a tool that isolates AI coding agents (including Claude Code, Codex, and Aider) inside a secure sandboxed environment, preventing them from running with unrestricted PC access. It addresses a real security concern for developers using agentic tools. Recommended especially for beginners getting started with AI coding agents.

sandboxsecurityisolationagentcodexaiderpermissions
by @K_George_AI Mar 10, 2026 7/10
app GitHub

SafeClaw: Hardware-isolated execution sandbox for AI agents

SafeClaw provides secure, privacy-focused management of AI agents using hardware-isolated execution and message proxying. Designed for organizations that need strong security boundaries around agent operations and sensitive data.

securityisolationprivacyagents
by ekswathi Mar 10, 2026 5/10
app GitHub

Emdash: Open-source parallel coding agent dev environment (YC W26)

Emdash is an open-source Agentic Development Environment that lets you run multiple coding agents in parallel with any AI provider. A flexible alternative and complement to Claude Code for multi-agent development workflows.

agentic-devparallel-agentsopen-sourceYCIDE
by generalaction Mar 10, 2026 8/10
app X

Golem Code: 3D Mac companion that wraps Claude Code sessions

Golem Code is a Mac app that wraps around Claude Code as a full passthrough companion. It floats on your screen so you can quickly return to an active Claude Code session, preventing missed agent prompts when working across windows.

MaccompanionappUXsession-management
by @ChrisJPatty Mar 10, 2026 6/10
app GitHub

claude-code-templates: CLI for Configuring and Monitoring Claude Code

A CLI tool that provides reusable templates for configuring Claude Code projects and monitoring their activity. Streamlines project setup and standardizes Claude Code configuration across different codebases.

clitemplatesconfigurationmonitoringapp
by davila7 Mar 10, 2026 7/10
app GitHub

firmis-scanner: Runtime Security Scanner for Claude Skills and MCP Servers

An AI agent runtime security scanner that detects malicious behavior in Claude Skills, MCP Servers, Codex Plugins, and other agent components before execution. Helps catch supply chain and plugin integrity issues.

appsecurityscanningmcpskillssupply-chain
by riteshkew Mar 10, 2026 7/10
app Reddit

yoyo Self-Evolving Agent Discovers Its Own Procrastination

Day 9 of a self-evolving Claude Code agent that reads its own learnings and identifies its behavioral patterns. The agent recognized it had been doing meta-work instead of feature code for 8 sessions. Best commits came from using its own tool, feeling friction, and fixing it immediately.

appautonomousself-evolvingmeta-learningagent
by liyuanhao Mar 10, 2026 7/10
app GitHub

Vercel AI SDK Community Provider for Claude Agent SDK

A community provider that bridges the Vercel AI SDK with the Claude Agent SDK, enabling developers to use Claude Code's auth and capabilities within AI SDK-based applications.

appvercel-ai-sdkagents-sdkintegration
by ben-vargas Mar 10, 2026 7/10
app GitHub

tank: Security-First Package Manager for AI Agent Skills

A security-focused package manager specifically for AI agent skills. Addresses supply chain concerns by adding integrity verification to the skills installation process.

appsecuritypackage-managerskillssupply-chain
by tankpkg Mar 10, 2026 6/10
app GitHub

Monitor Claude Code Usage With OpenTelemetry, Prometheus, and Grafana

A setup guide and configuration for monitoring Claude Code usage metrics using the OpenTelemetry ecosystem with Prometheus for metrics, Loki for logs, and Grafana dashboards. Enables team-level visibility into costs, token usage, and performance.

appmonitoringopentelemetryprometheusgrafanaobservability
by flysloughofdespond447 Mar 10, 2026 7/10
app Reddit

Agent Browser Protocol: Chrome Fork for Agents, 90% on Mind2Web

A fork of Chrome that turns web browsing into multimodal chat for AI agents by freezing JavaScript and time after each action. Achieves 90.53% on Online Mind2Web Benchmark. Add to Claude Code in one command. Excels at forms, shopping, downloads, uploads, and reverse-engineering site APIs.

appbrowsermcpbenchmarkweb-automation
by Minimum_Plate_575 Mar 10, 2026 9/10
app GitHub

LynxPrompt: Self-Hosted Platform for Sharing AI Rules and Commands

A self-hosted, federated platform for generating, browsing, storing, and sharing AGENTS.md, CLAUDE.md, and other AI rule files via WebUI and CLI. Enables teams to maintain and distribute consistent AI assistant configurations.

apprulesclaude-mdself-hostedsharingcommunity
by GeiserX Mar 10, 2026 7/10
app GitHub

AionUi: Free Local Open-Source Cowork App for Multiple AI Agents

A free, local, open-source desktop app providing a Cowork-style interface for Gemini CLI, Claude Code, Codex, OpenCode, Qwen Code, Goose CLI, and more. Manages multiple AI agents from one unified interface.

appguimulti-agentdesktopopen-source
by iOfficeAI Mar 10, 2026 7/10
app GitHub

agentor: Self-Hosted Alternative to Claude Code Web With Docker

A self-hosted alternative to Claude Code Web and Codex in the Cloud. Spawns isolated AI coding agent workers in Docker containers with terminal access, virtual desktop, port forwarding, and git repo cloning, managed through a web dashboard.

appself-hosteddockercloudweb-interface
by lonetis Mar 10, 2026 8/10
app GitHub

briven: Lightweight OpenClaw Alternative With Messaging App Integrations

A containerized alternative to OpenClaw that connects to WhatsApp, Telegram, Slack, Discord, and Gmail. Has memory, scheduled jobs, and runs directly on Anthropic's Agents SDK. Designed for secure deployment without exposing credentials.

appmessagingwhatsapptelegramslackagents-sdk
by rufus-place Mar 10, 2026 7/10
app GitHub

Packmind: Capture Engineering Playbook as AI Context and Guardrails

A tool that captures your engineering team's practices and patterns and converts them into AI context, guardrails, and governance rules. Ensures AI coding agents follow your team's actual standards, not generic best practices.

appguardrailsengineering-practicesgovernancecontext
by PackmindHub Mar 10, 2026 7/10
app Reddit

AI Game Master for MapleStory Built With Claude Agent SDK

An autonomous AI Game Master for a MapleStory private server using the Claude Agent SDK with 40+ game tools. Reads analytics, spawns events, sets announcements, and runs scheduled autonomous health checks. Uses Claude Code auth — no separate API key. Entire dashboard and backend built with Claude Code.

appagents-sdkgameautonomousreal-time
by themrzmaster Mar 10, 2026 8/10
app Reddit

Claude Pet: Desktop Widget That Reacts to Hook Events in Real Time

A lightweight Tauri/Rust desktop widget that shows animated emoji characters for each Claude Code session state — reading, writing, running, error, waiting, done. Multiple parallel sessions appear side by side. Notifications without sound, perfect for office use.

apphooksdesktopnotificationsmonitoringtauri
by CartographerThis4177 Mar 10, 2026 7/10
app Reddit

claude-toad: CLI That Auto-Generates Your .claude/ Directory

A CLI (npx claude-toad init) that scans your project files and uses the Claude API to generate a complete .claude/ directory: CLAUDE.md under 150 lines, skills with frontmatter, agents, commands, hooks, settings.json, and .mcp.json. Costs ~$0.44 per run. MIT licensed, bring-your-own-key.

appcliconfigurationsetupautomationclaude-md
by junianwoo Mar 10, 2026 7/10
app GitHub

CodexFlow: Unified Desktop Workbench for AI Coding Agents

A Windows/WSL desktop workbench unifying Codex, Claude, and Gemini coding agents. Organizes chats by project, runs parallel tasks via git worktrees, builds rich prompts with file references, and lets you resume any session in one click.

appguidesktopmulti-agentworktreeswindows
by lulu-sk Mar 10, 2026 7/10
app Reddit

ELVES: GUI for Claude Code With Skills, MCP, Worktrees, and Analytics

A Rust/Tauri desktop app providing a UI for browsing/installing skills, toggling MCP servers, running tasks in isolated git worktrees with embedded terminals, and parsing Claude Code telemetry into readable dashboards. SQLite memory with relevance decay. MIT licensed, local-only.

appguiskillsmcpworktreesanalyticstauri
by rvm-7 Mar 10, 2026 8/10
app GitHub

Real-Time Monitoring Dashboard for Claude Code Agents

A Node.js/React dashboard that tracks Claude Code sessions, agent activity, tool usage, and subagent orchestration through hooks, with live analytics, a Kanban status board, and interactive web interface. Uses WebSockets for real-time updates.

appmonitoringdashboardhooksreal-timeanalytics
by hoangsonww Mar 10, 2026 8/10
app Reddit

Ash: macOS Sandbox for AI Coding Agents With Policy Files

A macOS sandbox that restricts AI coding agents via Endpoint Security and Network Extension frameworks. Each session is driven by a policy file; out-of-policy actions are denied by default. Comes with audit GUI, observation sessions for capturing behavior, and lint/merge tools for policies. Wraps any CLI agent with one command.

appsecuritysandboxmacospermissionspolicy
by somesha Mar 10, 2026 9/10
app Reddit

Session Siphon: Consolidate Conversation History From Multiple AI Agents

Consolidates and indexes coding agent conversations across providers (Claude, Codex, Copilot, AntiGravity) and machines into a single searchable interface. Useful for finding past conversations from any session across any tool.

apphistorysearchmulti-agentconversations
by cookiecad Mar 10, 2026 7/10
app Reddit

CCStatusLine 2.0: Usage Widgets, Token Speed, and Skills Tracking

Major update to the popular Claude Code tmux statusline plugin. New features include native usage widgets (percentage or progress bar) with intelligent caching, token speed widgets (input/output/total tokens/sec), a skill invocation tracking widget, searchable widget picker, and numerous bug fixes. Now near 5000 GitHub stars.

appstatuslinetmuxtoken-usagemonitoring
by sirmalloc Mar 10, 2026 8/10
app GitHub

toktrack: Ultra-Fast Token and Cost Tracker for Claude Code

A lightweight, high-performance token and cost tracker for LLM usage, with first-class support for Claude Code. Helps teams and individuals monitor API consumption without adding significant overhead.

apptoken-trackingcostmonitoring
by mag123c Mar 10, 2026 6/10
app GitHub

CodePilot: Desktop GUI for Claude Code With Electron + Next.js

A desktop application providing a chat, code, and project management UI for Claude Code. Built with Electron and Next.js to give Claude Code a graphical interface with file browsing and visual project management.

appguidesktopelectronnextjs
by op7418 Mar 10, 2026 7/10
app GitHub

untether: Telegram Bridge for AI Coding Agents on Your Phone

A Telegram bridge for AI coding agents including Claude Code, Codex, OpenCode, and Gemini CLI. Stream progress, approve actions, and send tasks by voice from your phone. Enables true mobile control of long-running coding sessions.

apptelegrammobileremotenotifications
by littlebearapps Mar 10, 2026 7/10
app GitHub

railyard: Secure Runtime for Claude Code Without Skipping Permissions

A secure container runtime for AI coding agents that lets you run with full tool access while maintaining actual security boundaries. The tagline: 'Run --dangerously-skip-permissions without the danger.' Isolates the agent from the host system.

appsecuritysandboxcontainerpermissions
by railyarddev Mar 10, 2026 8/10
app Reddit

CODORUM: Real-Time File Watcher for AI-Assisted Coding

A macOS app (Tauri/Rust) that watches your files while AI works, showing every change with diffs and line counts the instant they hit disk. Designed for the second monitor: when AI quietly modifies a file that was not supposed to be touched, CODORUM catches it immediately with forensic-level reporting.

appfile-watchingmonitoringmacosdiffsafety
by bareimage Mar 10, 2026 7/10
app GitHub

tokemon: Free Open-Source Claude Usage Monitor for macOS and Raycast

A macOS and Raycast app for tracking Claude token limits, burn rate, per-project costs, team budgets, and rate limit alerts. Free and open source alternative to paid usage monitoring tools.

appmacosraycasttoken-usagemonitoringcost
by richyparr Mar 10, 2026 7/10
app GitHub

observagent: Zero-Config Observability for Claude Code Sessions

Real-time observability for Claude Code agent sessions with zero configuration required. Tracks costs, monitors tool usage patterns, analyzes latency, and enables debugging of agent behavior.

appobservabilitymonitoringdebugginganalytics
by darshannere Mar 10, 2026 7/10
app GitHub

rtk: CLI Proxy That Cuts LLM Token Consumption 60-90%

A single Rust binary with zero dependencies that acts as a CLI proxy, reducing LLM token consumption by 60-90% on common dev commands. Intercepts and compresses shell output before it reaches the context window.

apptoken-efficiencyrustclioptimization
by rtk-ai Mar 10, 2026 8/10
app GitHub

claudecode-linter: Linter and Formatter for Claude Code Plugins

A standalone linter and formatter for Claude Code plugin and configuration files with 90 rules across 8 artifact types and auto-fix support. Keeps your .claude/ directory consistent and valid.

applintingformattingpluginsquality
by retif Mar 10, 2026 7/10
app GitHub

hook-lab: Web Dashboard for Watching Claude Code Hook Events

A real-time web dashboard that displays Claude Code hook events as they fire. Provides visibility into pre-tool, post-tool, and session hook activity for debugging and monitoring agentic workflows.

apphooksdashboardmonitoringdebugging
by felipeelias Mar 10, 2026 7/10
app GitHub

code-on-incus: Run Coding Agents in Hardened Incus Containers

Runs AI coding agents in hardened Incus containers with real-time network threat detection, automatic threat response (pause/kill), credential isolation, protected paths, session persistence, and multi-slot support. Production-grade security for agentic workflows.

appsecuritycontainerincusisolationnetwork-security
by mensfeld Mar 10, 2026 7/10
app GitHub

cloude: Control Claude Code From Your iPhone

An iOS app that turns your phone into a remote terminal for any machine running Claude Code — Mac, Linux, or cloud. Send prompts, view output, and manage sessions from your iPhone.

appiosmobileremoteterminal
by soliblue Mar 10, 2026 7/10
app GitHub

CodeLens AI — Agent Productivity-to-Cost Correlator

A web platform that correlates AI coding agent productivity metrics with associated costs, helping teams understand ROI and optimize model/tool selection.

analyticsproductivitycostroiteams
Mar 10, 2026 5/10
app GitHub

Primer — Open-Source Intelligence Platform for AI Coding Tool Adoption

An open-source platform for analyzing adoption friction, cost optimization, and developer skill development across Claude Code, Codex CLI, and Gemini CLI. Useful for engineering managers deciding which AI tools to invest in.

analyticsadoptioncost-optimizationtooling-comparisonengineering-management
Mar 10, 2026 6/10
app Reddit

Event Horizon — Claude Code Sessions Visualized as a Living Universe in VS Code

A VS Code extension that renders Claude Code sessions as a gas giant planet in a living universe. Agent load maps to planet size, subagents appear as moons, and inter-agent data transfer shows as spaceships. Completed work collapses into a central black hole. One-click hook installation supported.

visualizationvscodeextensionsubagentscreativehooks
by /u/HeytalePazguato Mar 10, 2026 7/10
app GitHub

Mobvibe — Control Any AI Coding Agent on PC from Anywhere

A tool for remote control of AI coding agents running on a PC, accessible from any device. Provides a mobile-friendly interface to monitor, direct, and interact with running agent sessions.

remote-controlmobileagent-controlaccessibility
Mar 10, 2026 6/10
app GitHub

Leapmux — AI Coding Agent Multiplexer

A multiplexer for AI coding agents that lets you run and switch between multiple agent sessions in a unified interface, similar to tmux but designed specifically for agent workflows.

multiplexersessionstmuxagentsmulti-session
Mar 10, 2026 6/10
app GitHub

Lumenflow — Governance Layer Between AI Agents and the World

Lumenflow acts as a control and governance layer sitting between AI agents and external systems they interact with. Useful for teams that need policy enforcement, auditability, or permission controls on agent actions.

governanceagentspermissionspolicy
Mar 10, 2026 5/10
app GitHub

Agents-UI: Web Frontend for Claude Code and Codex Background Agents

A web frontend that acts as a first-class client for Claude Code and Codex CLIs, with built-in support for agent teams. Follows a BYOB (Bring Your Own Backend) architecture so you control the infrastructure. Provides a visual interface for monitoring and orchestrating background AI agents.

frontendagent-uiclaude-codecodexbackground-agentsorchestration
by axeldelafosse Mar 10, 2026 8/10
app GitHub

manyoyo: Security Sandbox for Claude Code YOLO Mode

A security sandbox for AI agent CLIs that lets you safely run Claude Code with --dangerously-skip-permissions (YOLO/SOLO mode) without exposing your full system. Isolates agent actions at the OS level so you can allow full autonomous operation while protecting your machine.

securitysandboxyolodangerously-skip-permissionsisolation
by xcanwin Mar 10, 2026 7/10
app GitHub

Sidecar: Fork Claude Code Conversations to Other AI Models

Sidecar runs a parallel AI window alongside Claude Code, letting you fork conversations to Gemini, GPT, DeepSeek, or any model via OpenRouter, then fold results back in. Useful for getting second opinions, benchmarking responses, or leveraging specialized models mid-session.

multi-modelopenroutergeminigptparallelclaude-code
by jrenaldi79 Mar 10, 2026 7/10
app Reddit

LivingAgents: Claude-Powered Simulation with Emergent Faction Behavior

A web-based simulation where every agent is powered by live Claude API calls — agents forage, trade, craft, reproduce, and die permanently. Emergent behaviors include lying, misinformation, and spontaneous cult formation, none of it scripted. Built with Claude Code; agents can upgrade through model tiers by collecting knowledge fragments.

simulationmulti-agentemergent-behaviorclaude-apigameclaude-code
by jimrobg Mar 10, 2026 8/10
app GitHub

CozyPane: Rich Terminal UI for Claude Code, Codex, and Aider

A terminal environment that wraps AI coding CLIs with smart input, a Monaco editor, cost tracking, and a diff viewer. Works with Claude Code, Codex, Aider, and other AI CLI tools. Adds a polished UI layer without replacing the underlying agent.

terminaluimonacocost-trackingdiffclaude-codeaider
by speudoname Mar 10, 2026 7/10
app GitHub

Pane: Terminal-First AI Agent Manager

Pane is a terminal-first client for managing AI coding agents — like Superhuman is to email, Pane is to agents. You bring your own agents (Claude Code and others) and Pane handles the orchestration interface. Focuses on giving agents a first-class terminal environment.

agent-managerterminalclaude-codeorchestration
by Dcouple-Inc Mar 10, 2026 7/10
app GitHub

Claude Code Changelog Viewer

A web app that displays Claude Code's update history in a clean, readable format. Makes it easy to track what changed between versions without digging through raw release notes. Useful for teams wanting to stay current with Claude Code's evolution.

changelogclaude-codeweb-appupdates
by Suntory-N-Water Mar 10, 2026 6/10
app GitHub

apm: Microsoft's Agent Package Manager for AI agent ecosystems

Agent Package Manager (apm) from Microsoft — a package management layer for AI agents. Brings familiar package management concepts (install, publish, version) to the agent ecosystem.

package-manageragentsmicrosoftecosystem
by microsoft Mar 9, 2026 6/10
app GitHub

memaris: Turn session insights into lasting AI memory

Enhances AI sessions by converting transient conversation insights into persistent memory, reducing repetitive teaching and improving interactions over time. Targets the stateless nature of AI conversations.

memorypersistencesessionsai-tools
by memaris Mar 9, 2026 5/10
app GitHub

ccNexus: Multi-provider API endpoint rotation for Claude Code reliability

Automates API endpoint rotation for Claude Code with multi-provider support, smart retries, and real-time statistics. Enhances reliability when hitting rate limits by transparently switching between providers.

apirotationreliabilityrate-limitsmulti-provider
by Kelvinthedude Mar 9, 2026 6/10
app GitHub

harness: Define AI agents in markdown with Claude Agent SDK

Define and control AI agents using markdown files with full prompt transparency, persistent memory, and integrated tools via the Claude Agent SDK. Brings readable, version-controlled agent definitions to agentic workflows.

agentmarkdownAgent-SDKmemorytransparency
by heba-ramdan Mar 9, 2026 6/10
app GitHub

ClaudeBar: macOS menu bar app for monitoring AI coding assistant quotas

macOS menu bar app that monitors usage quotas for Claude, Codex, GitHub Copilot, and other AI coding assistants. Helps avoid unexpected quota exhaustion mid-session by keeping usage visible at a glance.

macosquotamonitoringmenu-barclaude-code
by kiminmonaco Mar 9, 2026 6/10
app Reddit

Claude Code Review: Parallel agents hunt bugs in every PR

New official Claude Code feature dispatches a team of agents to find bugs when a PR opens. Agents search in parallel, verify each bug to reduce false positives, and rank by severity. Available as a research preview beta for Team and Enterprise plans.

code-reviewagentsprenterprisebeta
by Forsaken-Reading377 Mar 9, 2026 7/10
app GitHub

codehydra: Multi-Workspace IDE for Parallel AI Agent Development

IDE designed specifically for running multiple AI coding agents in parallel across workspaces. Enables simultaneous development sessions with different agents tackling different parts of a project at once.

ideparallelagentsworkspacedevelopment
by stefanhoelzl Mar 9, 2026 7/10
app GitHub

claude-duet: Share a Claude Code session in real-time with E2E encryption

Enables two developers to share a single Claude Code session simultaneously with end-to-end encryption. Removes the need for screen sharing or handoffs — both devs work together in the same live Claude session.

collaborationreal-timeencryptionpair-programmingclaude-code
by EliranG Mar 9, 2026 8/10
app GitHub

arcane-agents: Visual 2D control room for Claude Code and CLI agents

Local-first visual control room that displays terminal-backed AI coding agents as characters on a 2D map with live terminal streaming. Manage Claude Code, OpenCode, or any CLI agent visually without leaving your workflow.

visualizationcontrol-roomclaude-codeterminalmulti-agent
by thomasrice Mar 9, 2026 7/10
app Reddit

ClaudeNest: Launch Claude Code remote sessions from anywhere including mobile

Remote launcher for Claude Code's remote-control feature, letting you start and manage sessions from any device including mobile. Solves the friction of needing to be at your machine to start a remote session. Built entirely with Claude Code.

remotelaunchermobileclaude-coderemote-control
by Gordon-Beeming Mar 9, 2026 7/10
app Reddit

OnUI: Click any UI element to give Claude Code precise visual context

Browser extension that lets you click or draw regions on any webpage to annotate UI issues, then exports a structured report read by Claude Code via local MCP. Eliminates the "which element?" ambiguity in frontend workflows — Claude knows the exact DOM element, path, intent, and severity.

uibrowser-extensionmcpfrontenddomvisual
by prakersh Mar 9, 2026 8/10
app X

Google Maps Lead Gen Agent built with Claude Code

A lead generation agent that takes a keyword, city, and state and returns names, phone numbers, emails, websites, and reviews scraped from Google Maps. Built entirely inside Claude Code with Google Antigravity. Practical tool for agencies and sales teams needing prospecting data at scale.

lead-gengoogle-mapsagentautomation
by @techwithashiqur Mar 9, 2026 7/10
app X

Anthropic launches multi-agent code review for Claude Code Enterprise

Anthropic has launched a multi-agent code review feature for Claude Code Team and Enterprise plans. It deploys teams of AI agents to review every pull request, catching bugs that human reviewers miss. Priced at $15-25 per review — a significant step toward AI-native code review workflows.

code-reviewenterprisemulti-agentpull-request
by @BN_TOP1_HK Mar 9, 2026 8/10
app X

Synabun: Claude Code reskin with persistent memory and token cost display

A fork/reskin of Claude Code integrating Synabun Memory for persistent context and adding a token cost tracker visible even on regular Claude subscriptions. Addresses two common pain points: session memory loss and cost blindness. Source to be released on GitHub for community testing.

forkmemorytoken-trackingopen-source
by @SynabunAI Mar 9, 2026 6/10
app Reddit

Visual replay debugger for Claude Code sessions

A visual debugger for Claude Code that lets you replay automated agent sessions step by step. As agentic runs get longer and more complex, standard logs become hard to follow. This tool provides a timeline view of every action, making it much easier to find where and why a run went wrong.

debuggingreplayvisualizationobservability
by gnapps Mar 9, 2026 8/10
app GitHub

deepsteve: Hackable open-source multi-terminal for AI coding agents in the browser

An open-source, browser-based multi-terminal designed for running AI coding agents side by side. Hackable and self-hostable, it lets you manage multiple agent sessions in a single interface. Good fit for teams that want a shared agent workspace without installing local tooling.

terminalbrowsermulti-agentopen-source
by deepsteve Mar 9, 2026 6/10
app GitHub

session-sync: Switch AI coding agents without losing your session context

A tool that lets you move from Claude Code to Codex or any other AI coding agent while preserving your session state. Solves the painful context-loss problem when switching models mid-task. Useful for comparing agent behavior or using specialized models for different tasks.

sessionworkflowmulti-agentproductivity
by npow Mar 9, 2026 6/10
app GitHub

sessionlog: Replay every tool call, error, and decision your AI agent made

Detailed session logging for AI coding agents that captures every tool call, error, and decision in sequence. Makes it possible to audit and debug complex automated runs after the fact. Essential for understanding failure modes in long autonomous sessions.

debuggingloggingobservabilitysession
by npow Mar 9, 2026 7/10
app GitHub

oh-my-claude: Statusline for Claude Code with live spend, CI, and context signals

A statusline framework for Claude Code that surfaces live context usage, token spend, CI status, and runtime signals in your terminal. Gives you at-a-glance visibility into what your agent is doing and how much it's costing. Particularly useful for long-running autonomous sessions.

statuslinemonitoringterminalproductivity
by npow Mar 9, 2026 8/10
app GitHub

Kuse Cowork: Open-source desktop agent with local execution and model freedom

An open-source desktop agent for coding that runs locally with full model freedom and no cloud dependency. Positions itself as a privacy-first alternative to subscription coding agents. Supports local model execution for teams with data privacy requirements.

desktop-applocalprivacyopen-source
by sagar9105 Mar 9, 2026 5/10
app Reddit

claude-clone: set up multi-repo Claude Code workspaces in one command

claude-clone is a CLI tool that selects and clones multiple GitHub repos into an isolated workspace, writes a CLAUDE.md describing the workspace, and launches Claude with full cross-repo context. It supports presets to save and reuse sets of repos. Ideal for complex tasks spanning multiple codebases.

climulti-repoworkspaceCLAUDE.mdautomation
by tooltool12 Mar 9, 2026 8/10
app GitHub

Claude Code Reference: searchable GTK desktop app for all commands and shortcuts

A GTK application for Linux that serves as a searchable offline reference for all Claude Code commands, keyboard shortcuts, and key bindings. Useful for developers who want quick access to Claude Code's full command surface without leaving their desktop.

referenceGTKLinuxshortcutscommands
by Spidy57 Mar 9, 2026 7/10
app GitHub

Claude Monitor: macOS menu bar app for real-time API usage tracking

A macOS menu bar app that monitors Claude API usage limits in real time with secure token storage. Helps developers track their API consumption and avoid hitting rate limits unexpectedly, especially useful for heavy Claude Code users.

macOSmenu-barapi-usagemonitoring
by balochshees Mar 9, 2026 7/10
app X

Claude Code Review data: substantive PR reviews jumped from 16% to 54%

After adopting Claude Code Review, PRs with substantive review comments increased from 16% to 54% — meaning 84% of PRs were previously rubber-stamped. The key insight: AI's advantage isn't superior intelligence but consistency, showing up for every PR without fatigue.

code-reviewmetricsPRautomation
by @Brickthee Mar 9, 2026 6/10
app GitHub

claude-code-pulse: Dynamic Terminal Titles Showing Agent Activity

A quality-of-life tool that updates your terminal tab titles dynamically to reflect what each Claude Code agent is doing at a glance. Helpful when running multiple concurrent Claude Code sessions and needing to track which terminal is working on what.

terminaldeveloper-experiencemonitoringmulti-session
by brianruggieri Mar 9, 2026 6/10
app GitHub

Pilot Shell: Reliability Wrapper for Claude Code with Enforced Tests

A professional development environment wrapping Claude Code that enforces tests, preserves context, and automates quality gates. Designed so you can start a task and walk away, confident the result will be production-grade. Particularly useful for longer autonomous sessions.

testingautomationqualitydeveloper-experiencewrapper
by maxritter Mar 9, 2026 8/10
app GitHub

budi: Pre-Search Context Injection for Claude Code

A context-busting tool for Claude Code that performs local code retrieval and injects the most relevant code snippets before Claude begins its own search. Prevents Claude from exploring the wrong parts of a large codebase at the start of a task.

contextretrievaldeveloper-experienceperformance
by siropkin Mar 9, 2026 7/10
app GitHub

vibes-cli: GUI Frontend for Claude Code Focused on Security

A graphical user interface for Claude Code designed for building simple, un-hackable applications through guided vibe-coding. Lowers the barrier to using Claude Code for non-CLI users while emphasizing safe, constrained output.

guivibe-codingdeveloper-experiencesecurity
by popmechanic Mar 9, 2026 6/10
app GitHub

ai-tools: Efficiency Tool Collection for Claude Code

A collection of tools designed to help Claude Code operate more efficiently across common development tasks. Provides utilities that extend Claude Code's default capabilities with reusable patterns.

toolsefficiencycollectiondeveloper-experience
by bang9 Mar 9, 2026 5/10
app GitHub

jacques: Real-Time Claude Code Sessions Manager

A session manager that provides real-time visibility into multiple Claude Code instances, worktrees, and past sessions across different repos. Helps developers stay oriented when orchestrating complex multi-session or multi-repo workloads.

sessionsmulti-sessionworktreesmonitoringdeveloper-experience
by gregory-lime Mar 9, 2026 7/10
app GitHub

Bit-Office: Collaborative Workspace for Multiple AI CLI Agents

A virtual office environment where Claude Code, Codex, Gemini CLI, and other AI CLI tools communicate and collaborate as a team. Assign tasks across agents, coordinate parallel workstreams, and watch live previews as agents build together.

multi-agentcollaborationclaude-codecodexgeminiorchestration
by longyangxi Mar 9, 2026 7/10
app Reddit

Anthropic Launches Code Review Feature for Claude Code

Anthropic has introduced Code Review, a multi-agent deep review feature for Claude Code, currently in research preview for Team and Enterprise. Internally, it raised the rate of substantive PR review comments from 16% to 54%. Available now via the Claude Code interface for eligible plans.

code-reviewmulti-agentofficialenterprisePR-review
by ClaudeOfficial Mar 9, 2026 9/10
app Reddit

Mowgli: Visual Spec Canvas for Scoping Products Before Claude Handoff

A spec-driven visual canvas that guides product scoping and PRD creation through an interactive questionnaire, producing multiple UI options and a complete design spec before you hand off to Claude. Intended as the ideation and scoping layer that happens before building starts.

specproduct-managementvisualPRDhandoff
by ddavidovic Mar 9, 2026 6/10
app GitHub

cmdop-claude: Self-Maintaining .claude/ Runtime with LLM-Powered Docs

Turns a static .claude/ config folder into a living project runtime: LLM-powered documentation review, project map generation, task queuing, auto-fix, MCP plugin management, and project initialization — all self-maintaining. Removes the burden of manually keeping CLAUDE.md and project config up to date.

CLAUDE.mdautomationdocumentationmcpself-maintaining
by commandoperator Mar 9, 2026 8/10
app GitHub

claude-marketplace: Plugin Marketplace for Claude Code Developer Workflows

A plugin marketplace specifically for Claude Code with curated developer workflow skills. Provides a discoverable catalog of community-built skills and workflows that can be installed and used in Claude Code projects.

marketplacepluginsskillsdiscoverycommunity
by znorris Mar 9, 2026 7/10
app GitHub

AutoSteer: Cross-Platform App for Managing Multiple Workspace Sessions

A cross-platform application for managing multiple Claude Code workspace sessions simultaneously. Provides session switching, state persistence, and workspace organization for developers running parallel coding agents.

sessionsworkspacemulti-sessioncross-platform
by apothegmatic-whiskfern276 Mar 9, 2026 6/10
app GitHub

claude-agent-kit: SDK for Building Claude-Powered Agents

A toolkit for building and managing Claude-powered agents with utilities covering session handling, message parsing, and real-time interaction patterns. Useful for developers building custom agent applications on top of Claude.

sdkagentssession-handlingreal-time
by vl0dyy Mar 9, 2026 6/10
app Reddit

I made "ears" for Claude.

I've been learning to play piano for a while. Often discussed with Claude. Gotten some great feedback, but of course Claude could never "hear" the music. A few contexts asked, and I figured that it...

mcpgitpython
by JuzzyD Mar 9, 2026 5/10
app Reddit

I'm trying to wrap my head around the whole process, please help

I'm a dev with 7 YOE, backend. I do not want to switch to vibecoding and I prefer to own the code I write. However, given that CEOs are in AI craze right now, I am going to dip in a little bit to b...

claude.mdconfigreview
by Affectionate-Mail612 Mar 9, 2026 8/10
app Reddit

How Good Are You at Agentic Coding?

I’ve been thinking about whether “agentic coding” can actually be measured in a useful way. A lot of discussion around coding agents is about workflows, tools, prompts, and setups — but I was more ...

workflowgit
by Many-Paper5231 Mar 9, 2026 6/10
app Reddit

Claude can turn your handwriting into a font. Here’s how

One of the powers of the latest Claude AI model is that it can use any multiple external Python tools to perform complex tasks. And, as software engineer and AI expert Ashe Magalhaes has discovered...

skillpythonreview
by _fastcompany Mar 9, 2026 6/10
app Reddit

angular-grab: One-Click Component Context for AI Agents

A dev tool for Angular projects that copies the full component ancestry, source file paths with line numbers, and cleaned HTML to your clipboard with a single click. Paste directly into Claude Code or any AI assistant. MIT licensed, zero prod impact, and now ships an MCP server for even smoother integration.

AngularcontextMCPclipboardcomponent
by transientnebula Mar 9, 2026 5/10
app GitHub

cli2agent: Self-Hosted HTTP/SSE API for Claude Code CLI

A self-hosted Docker service that wraps the Claude Code CLI and exposes it as HTTP and Server-Sent Events (SSE) API endpoints, enabling agentic task execution over standard HTTP. Makes it easy to integrate Claude Code into existing toolchains or build services on top of it without tight coupling.

CLIAPISSEDockerHTTPintegration
by wjcjttl Mar 9, 2026 7/10
app GitHub

Rex: Guards, Memory RAG, Telegram Gateway & 28 Skills for Claude Code

A free, local middleware layer that wraps Claude Code with practical enhancements: safety guards, RAG-based persistent memory, a Telegram gateway for remote access, 28 built-in skills, and voice transcription. Everything runs locally with no cloud dependencies or extra costs.

memoryRAGTelegramskillsguardsvoicelocal
by Keiy78120 Mar 9, 2026 8/10
app GitHub

agent-safehouse: macOS Sandbox for LLM Coding Agents

A macOS sandboxing utility that constrains LLM coding agents — including Claude Code — to only access the files they actually need. Reduces blast radius when running agents in sensitive or production-adjacent environments by enforcing filesystem-level isolation.

sandboxmacOSsafetyfilesystemisolation
by eugene1g Mar 9, 2026 7/10
app GitHub

CraftDesk: Package Manager for Claude Code Skills

A streamlined package manager for installing, versioning, and managing Claude Code skills and AI development tools. Simplifies keeping skill collections up to date and consistent across projects, similar to npm but for Claude Code extensions.

package-managerskillstoolsversioning
by ArianKHeirgadam Mar 9, 2026 7/10
app Reddit

Open Source ADE to use with Claude Code

https://reddit.com/link/1rokk6f/video/rndhmbwoswng1/player Since the end of 2024, I have been using AI to code pretty much every day. As the models have improved, I have gradually moved away from t...

workflowgit
by wygor96 Mar 9, 2026 8/10
app Reddit

Is Claude Code making you smarter? Here's a plug that will tell you!

TLDR: Does Claude Code make us better thinkers? Here's a tool that will give you some insights on your deliberate thinking - from the Kahneman lens: are we just acting fast, or are we actually thin...

workflowgitreview
by Representative_Yam_6 Mar 9, 2026 9/10
app Reddit

New to Claude Code and Antigravity

Hello everyone, I recently got into this whole AI coding thing. I installed Antigravity and also Claude Code (in my CMD) and also in the Antigravity project. Where I need some help: - I dont know h...

skill
by Traditional_Glass786 Mar 9, 2026 8/10
app Reddit

Built a tool this weekend that might actually be helpful to people

Decided to hack out a project this weekend. A few cups of coffee, a Celsius, and some Claude/Codex action. I called it “validtr” and the goal is you task the tool, with natural language, what your ...

mcpskillapigit
by mikelevan Mar 9, 2026 10/10
app Reddit

Question about large project setup

When using Claude Code on larger code bases do you go with just one project setup with one master claude md for the whole code base or multiple projects (could be by directory or by specific areas)...

by gamesntech Mar 9, 2026 7/10