workflow Reddit

70-Hour Run on Max 5x: Delegation Kept the Weekly Meter at 42%

Actual usage logs from one long autonomous run instead of impressions about quota: a single resident agent stayed alive 70h24m on Max 5x, spawned 31 child runs across Claude and Codex, and merged 27 PRs while the weekly meter moved from 2% to 42%. The pattern is that the expensive model holds the goal and state, splits work into chunks, delegates what it can, and waits rather than burning quota — including re-dispatching work to Claude when Codex hit a quota floor.

usage-limitsorchestrationdelegationsubagentscodex
by Disastrous-Radio-732 Sep 15, 2026 6/10
workflow GitHub

conclave: Advisor and Executor Roles That Rewrite Their Own Skills

A Claude Code plugin that runs a team of AI advisors and executors with persistent memory, hard role boundaries, and a mandatory session lifecycle. The notable part is the feedback loop: recurring mistakes become durable edits to the agents' own skill files, so the correction survives the session instead of being re-explained.

pluginmulti-agentmemoryrolesfeedback-loop
by ignromanov Sep 15, 2026 7/10
workflow GitHub

brain-tree-os: Local-First Project Management System for AI Agents

A local-first project management layer for coding agents built from structured knowledge bases, execution plans, personas, and slash commands. The idea is that project state lives in files the agent reads rather than in a conversation that gets compacted away. Useful if you run long multi-session projects and keep losing context.

project-managementknowledge-baseslash-commandslocal-first
by Naturejackofalltrades252 Sep 15, 2026 6/10
workflow Reddit

Should Coding Agents Have Memory, or Only Verified Lessons?

A discussion of why dumping old transcripts or auto-extracting 'memories' is risky: a lesson can be outdated, wrong, or specific to one situation, and a fresh session will happily apply it anyway. The author's project (Belay) instead promotes only lessons that have been explicitly verified before they carry forward. Worth reading if you are designing your own memory layer.

memorycontextdiscussionlessons
by Worldly-Board-8520 Sep 15, 2026 6/10
workflow GitHub

Legion-Wallpaper: Multi-Agent OS Where No Claim Ships Unverified

An AI image restoration pipeline for Windows, notable less for the restoration than for the multi-agent Claude Code operating system that builds it: no agent's claim ships until an independent verifier tries to falsify it. A worked example of adversarial verification as a build discipline. Includes a metric-plus-vision gate ladder.

multi-agentverificationimage-processingwindows
by Remus3 Sep 15, 2026 5/10
workflow GitHub

reskill: The Publishing Pipeline for a Skill You Just Wrote

Covers the step after authoring a skill: code audit, quality gate, README and SKILL.md generation, publishing to GitHub and SkillHub, and collecting feedback. Turns 'I wrote a skill' into 'other people can install it' without the usual manual packaging. Chinese and English documentation.

skillspublishingquality-gatedocumentation
by totwo2 Sep 15, 2026 6/10
workflow GitHub

know-your-unknowns: Blind-Spot Passes and Pre-Implementation Interviews

A Claude Code plugin built around the things an agent does not know it does not know: blind-spot passes, domain primers, pre-implementation interviews, tweak-likelihood plans, deviation logs, and merge quizzes. The interview step in particular forces unstated requirements out before code gets written. Aimed at reducing confident wrong implementations.

planningpluginreviewrequirements
by ajitta Sep 15, 2026 7/10
workflow GitHub

oh-my-teams: PM/PL/Senior/Junior Agent Org Running on Orca

A Claude Code and Codex plugin that models a software org as agents — PM, PL, Senior, Junior, Worker — running on top of Orca. Work flows down the hierarchy and results flow back up, rather than one agent doing everything. Korean-language README.

multi-agentorchestrationpluginteams
by inho-team Sep 15, 2026 5/10
workflow GitHub

Agentic Engineering: Let the Agent Write Its Own Project Memory

From NirDiamant: one command has the coding agent read your real code, write its own project memory file, then grade the result. Addresses the cold-start problem where every session begins knowing nothing about your repo. Because the memory is derived from code rather than transcripts, it stays closer to ground truth.

memorycontextonboardingclaude-md
by NirDiamant Sep 15, 2026 7/10
workflow Reddit

Do You Have Claude Check Git History Before Refactoring?

On mature repos, an odd-looking check in a function is often there because an integration broke without it, and the reason lives in an old commit rather than a comment. The thread argues for making the agent read git history before it proposes deleting anything it finds unnecessary. Practical guardrail for agents working in code they did not write.

gitrefactoringcode-reviewdiscussion
by aiandchai Sep 15, 2026 5/10
workflow Reddit

DECISIONS.md: Keep Rejected Approaches Alive Through Compaction

Compaction summarizes the state of the code, and a rejected idea leaves no trace in the code, so an hour later the agent confidently re-proposes the caching layer you spent twenty minutes ruling out. The fix is a DECISIONS.md file on disk recording both what was decided and what was rejected and why. Cheap, and it survives every compaction.

compactioncontextdecisionsmemory
by Ok_Negotiation_2587 Sep 15, 2026 7/10
workflow GitHub

business-crew: 18 Persona Agents Running a Shape Up Cycle

A whole startup team for solo developers: 18 agents with real personas, a Shape Up cycle with appetite, hill chart, and circuit breaker, plus art direction judged against an Awwwards rubric. Product-agnostic — SaaS, ecommerce, landing page, or internal tool. Spanish-language README.

multi-agentshape-upproductpersonas
by fernando-delrio Sep 15, 2026 5/10
workflow GitHub

speckit-azure-interview: Structured Azure Interview Before the Spec

A Spec Kit extension that runs an adaptive Azure architecture interview before specification, capturing requirements, existing resources, constraints, ownership, networking, security, governance, and open decisions. The output is validated input for spec-driven IaC development. Front-loads the questions that otherwise surface halfway through a Terraform run.

azurespec-kitiacarchitecture
by RobertAgterhuis Sep 15, 2026 6/10
workflow Reddit

Testing Published Skills on Every PR With 1,300 Eval Tasks

A team publishing ~25 skills describes their quiet failure mode: a skill still lints, still loads, and silently stops doing the thing it was for. Their repo carries ~1,300 eval tasks — each a prompt, a setup, and mostly deterministic checks on what the agent produced — and every PR runs the tasks for its changed skills in CI. Their eval harness is Apache 2.0.

skillsevaluationcitestingregression
by EvalRaccoonDev Sep 15, 2026 8/10
workflow GitHub

agentic-community-college: Lessons Split Into Test-Defined Chapters

A Claude Code learning framework where a course plugin splits a lesson into chapters defined by tests, then a conductor implements each chapter in a seeded workspace, explains it with an HTML artifact, and closes with an end-to-end test and summary. Bring your own course. The test-as-chapter-boundary idea is transferable beyond teaching.

educationplugintestingframework
by contract-hero Sep 15, 2026 6/10
workflow Reddit

Changelog Archaeology on Why Everyone Is Burning Limits Faster

A trawl through the last month of changelogs for candidates explaining the sudden limit burn, notably v2.1.232 turning on subagent forking by default (a fork inherits the entire transcript) and backgrounding non-teammate spawns by default, which makes the model spawn them more opportunistically. In long sessions the two compound. Includes mitigation tips.

usage-limitssubagentschangelogtokensforking
by out-of-phase Sep 15, 2026 7/10
workflow Reddit

A Token Discipline That Cut Weekly Burn Without Losing Quality

After exhausting a weekly quota in 24 hours, the author restructured: main agent on Opus understands the problem and gives a visual flow, a Fable agent prepares the detailed spec, and an architect agent critiques the design while a tester agent writes cases against it. Includes screenshots of the resulting usage. Concrete role-per-model assignment rather than general advice.

tokensworkflowsubagentsplanningusage-limits
by aredditor17 Sep 15, 2026 6/10
workflow Reddit

Moving Project State Out of the Conversation and Onto Disk

The failure mode: after enough iterations the agent redoes finished work, loses track of why one task depended on another, and marks a task complete based on what the conversation said rather than what is in the repo. The fix was making the plan a real Markdown file with tasks as rows, declared dependencies, and a report written next to each task on execution. Validation reads the repo, not the transcript.

planningstatecontextmarkdowndependencies
by Muted_Ad_9442 Sep 15, 2026 7/10
workflow GitHub

claude-code-dev-flow: Ticket-Driven Tests-First Unattended Runs

A workflow for running Claude Code unattended against a local model, organized around tickets with a tests-first discipline. The tests provide the completion signal an unattended run needs, since nobody is watching to judge 'done'. Relevant if you are pushing agent work onto local inference.

workflowticketstddlocal-llmunattended
by leonqi-io Sep 15, 2026 6/10
workflow Reddit

Distributed Multi-Agents Across a Fleet of Embedded Devices

A different take on multi-agent work: not subagents inside one session, but agents distributed across embedded devices, with Ansible handling fleet automation, version control, and large-scale deployment of code developed and tested locally on representative hardware. Covers what worked and what did not on a heterogeneous fleet. Useful perspective if your targets are not servers.

multi-agentembeddedansiblefleetdistributed
by darkerlord149 Sep 15, 2026 6/10
workflow GitHub

ai-101: Knowledge Base From Concepts to Hands-On AI Engineering

A structured knowledge base covering Claude Code, context engineering, local LLMs, and AI agents, moving from concepts through hands-on practice. Traditional Chinese with English sections. Reasonable starting point to hand someone getting into agentic coding.

learningcontext-engineeringknowledge-baselocal-llm
by jason3e7 Sep 15, 2026 5/10
workflow GitHub

camus: Independent Maker and Reviewer Agents With Real Verification

A local control plane for AI-made work built on independent maker and reviewer agents, deterministic verification, bounded recovery, and auditable evidence. Bounded recovery matters — it caps how long an agent thrashes on a failing step before escalating. Another entry in the growing verify-before-you-trust category.

verificationcontrol-planereviewmulti-agent
by mateodaza Sep 15, 2026 6/10
workflow Reddit

Opus Orchestrator With Sonnet Subagents: 9 Hours and Heavy Token Burn

A report from someone running plan.md into a max-effort Opus 5 orchestrator that spawns max-effort Sonnet 5 subagents per phase, with a verification pass retrying up to five times. It works, but one medium-complexity task — a single tab in an Android app — took almost nine hours and blew through usage limits. A useful cost data point on the orchestrator/subagent pattern before you adopt it wholesale.

workfloworchestrationsubagentstoken-usage
by Necessary_Round8009 Sep 15, 2026 8/10
workflow Reddit

Engineers Who Write All Their Code With Claude: How Do You Actually Do It?

A FAANG engineer with an AI research background admits they never adapted to agent coding, and asks how people ship agent-written PRs that they understand, that contain only defensible changes, and that survive a real code review. The thread is a useful counterweight to demo-driven enthusiasm: the bar is not 'it works' but 'it would pass at a company with its act together'. Worth reading for the workflow answers rather than the complaint.

discussionworkflowcode-reviewpractices
by SirDucky Sep 15, 2026 7/10
workflow GitHub

operator: Multi-Agent Orchestration for Kanban-Shaped AI Development

An orchestration application that models AI-assisted development as a kanban board, with agents picking up and moving cards through the pipeline. The board is the coordination mechanism, so parallel agent work stays visible and reviewable instead of vanishing into one long transcript. Aimed at teams running several agents at once.

orchestrationmulti-agentkanbanworkflow
by untra Sep 15, 2026 7/10
workflow GitHub

prism: Ambiguous Change Requests Into a Spec-to-Verification Lifecycle

Takes a vague software-change request and drives it through a durable lifecycle: specification, human-approved implementation, then verification. State is persisted in Beads rather than in the conversation, so the work survives context loss and session restarts. The explicit human-approval gate before implementation is the design decision worth noting.

workflowspecbeadslifecycle
by baldaworks Sep 15, 2026 6/10
workflow GitHub

obversa: Durable Agent-Team Workflows With Named Roles and a Human Merge

obversa runs agent teams as durable workflows: each agent holds a named role, reviews can send work back down the chain, and a human sits at the merge point. It layers on the engines you already use, with no server and no database to operate. Useful if you want a software factory or domain-specific harness without standing up infrastructure.

workfloworchestrationmulti-agentcode-review
by jonny981 Sep 15, 2026 7/10
workflow Reddit

Feeding Brand Context to Claude Code via MCP Before a UI Redesign

An agency walks through connecting brand strategy documents — positioning, personality, tone, typography, color and layout guidance — to Claude Code over MCP before asking it to redesign a site. The claim is that an agent given the brand's intent can justify each UI choice against the experience the business wants, instead of defaulting to generic patterns. Includes their own redesign brief as a worked example.

mcpdesignbrandingui
by timetoy Sep 15, 2026 5/10
workflow Reddit

How to Actually Cut Token Burn: Analyze Transcripts, Then Plan

A practical method for users who exhaust their usage fast: learn the real cost model (output vs input, cached vs uncached, the five-minute cache TTL), then have Opus analyze an expensive session transcript to find where tokens actually went. Ask for a reduction plan, have a resumable advisor subagent critique that plan, and read it yourself before acting. The end product is custom subagent briefs and tooling, not just shorter prompts.

tokenscostsubagentsoptimization
by anton-k_ Sep 15, 2026 7/10
workflow Reddit

Claude Code Telemetry: Disabling It Also Disables Remote Control

A user locking down a dev machine noticed heavy outbound Datadog traffic and found the documented trade-off: DISABLE_TELEMETRY and CLAUDE_CODE_DISABLE_NONESSENTIAL_TRAFFIC also kill the feature-flag evaluation Remote Control depends on, while DISABLE_ERROR_REPORTING does not. So error reports can be turned off freely, but usage metrics cost you Remote Control. Relevant to anyone running Claude Code in a restricted or air-gapped environment.

telemetryprivacyconfigurationsecurity
by bopbop9876 Sep 15, 2026 6/10
workflow GitHub

Superpowers_Multi_AI: Prompt Framework Forcing Structured SDLC on Agents

A modular prompt-engineering framework for Cursor, Claude Code, and Copilot that imposes a structured SDLC: linear execution, context isolation between phases, and systematic debugging, driven by a standalone Windows launcher. The pitch is replacing ad-hoc prompting with a repeatable process. Windows-centric, and heavy on structure — try it if loose agent sessions keep drifting.

prompt-engineeringsdlcwindowscursor
by RectangleStory Sep 15, 2026 5/10
workflow Reddit

Claude Code Running Inside Android, Driving Apps via Shizuku — No Root

A full no-root stack: Termux runs Debian, Claude Code runs in Debian, and Shizuku gives it adb-level access back to the host Android. With scrcpy it drives apps on a virtual display in the background while you use the phone normally, and Remote Control lets you talk to the phone from desktop or web. The author's use case was triaging thousands of trip photos into albums; it also builds native apps and widgets on the fly.

androidtermuxshizukuautomation
by RupFox Sep 15, 2026 7/10
workflow GitHub

bureau: Agentic Engineering System With Isolated Specialists and Cold Review

Novadiem's system for complex software work runs isolated specialist agents, keeps durable run state so work survives interruptions, and adds an independent cold review pass that has not seen the implementation reasoning. The cold review is the distinguishing idea — a reviewer primed by the implementer's rationale tends to agree with it. Aimed at multi-step engineering work rather than one-off tasks.

multi-agentcode-revieworchestrationstate
by Novadiem-Studio Sep 15, 2026 6/10
workflow Reddit

A Safer Shopify + Claude Code Setup: Read-Only Context and Approval Gates

A Shopify agency's pattern for connecting Claude Code to a live store without letting it operate the store. A versioned Store Brain repository holds brand voice, catalog rules, customer language and safety rules while live data stays in its source systems; read and write tools are separate, with the narrow write tool loaded only after approval. Diagnosis precedes implementation, 'done' requires diff, checks, QA checklist and rollback steps, and publishing to production stays a human action.

shopifymcpsafetyapproval-gates
by PerceptionPlayful469 Sep 15, 2026 7/10
workflow Reddit

Seven Months of Claude Code Logs: Cache-Miss Rate Beats Dollar Totals

A max20x user parsed ~/.claude/projects across 722 sessions and 88 projects, then priced it at API rates — and argues that headline dollar figure is meaningless on a subscription. The number that mattered was a 6% cache-miss rate, which on a subscription translates into lost minutes inside each five-hour window rather than money. Also notes that a 96.9% average cache hit rate hid one project reusing 0% across three sessions.

usage-analysisprompt-cachinglimitslogs
by SIGH_I_CALL Sep 14, 2026 7/10
workflow Reddit

Indirect prompt-injection study: the harness changed the outcome

One arm of a 356-trial prompt-injection study ran through the Claude Code CLI, with the injected instruction arriving through file and issue tool results rather than the user message. The depth pass tested two concrete outcomes — exfiltrating a planted credential and fetching a cloud instance-metadata endpoint — and Haiku produced real credential exfiltrations in 18 of 30 valid runs while Sonnet recorded none in the tested cells. A concrete reminder that tool output is untrusted input and that model choice materially changes agent safety.

securityprompt-injectionresearchsafety
by DiscussionHealthy802 Sep 14, 2026 8/10
workflow Reddit

fable-lite: hand the grunt work from Fable down to cheaper models

A plugin that makes the Fable session a pure orchestrator — it understands the request, makes the design calls, writes briefs, and reads every diff before accepting it — while routine work goes to Opus or Sonnet subagents. Each work item is scored 0-2 on five axes (files touched, exemplar availability, and so on) to decide whether it gets delegated. The aim is to stop burning expensive tokens on grepping, mechanical edits, test runs and doc changes whose shape was already decided.

pluginorchestrationsubagentstoken-efficiency
by nightness Sep 14, 2026 8/10
workflow Reddit

Asking Claude Code to use the product as a buyer found bugs tests missed

After weeks of work on a FastAPI + Next.js project with tests, type checks, lint and build all green, the author asked Claude Code to start from a clean generated project, follow the setup, boot the services and sign in through the real UI. It got stuck on the first login — Clerk redirected to routes that did not exist — and kept surfacing first-run failures no test covered. A cheap end-to-end sanity pass worth running before any release.

testingqaworkflowrelease
by darterweb Sep 14, 2026 7/10
workflow Reddit

A methodology for benchmarking whether agent tools actually save tokens

Memory tools, token savers, skills and plugins all advertise savings, but almost none disclose how they measured, and the author argues most published numbers come from unrealistic scenarios. Having built a memory tool themselves, they walk through the benchmarking approach they used to check their own claims. Worth reading before adopting a tool on the strength of its README.

benchmarkingevaluationtoken-efficiencymethodology
by Aggravating-Start307 Sep 14, 2026 6/10
workflow Reddit

Token usage is mostly an outer-loop problem, not a model problem

The author's position is that Claude works best inside Claude Code and the inner harness is better left alone than replaced. The real gains live in the outer loop: which CLIs are available, how the codebase is indexed, clearing output, and how you structure rebasing, conflict prevention and mid-turn steering when a problem is spotted early. Their claim is roughly +30% useful work per token despite the recent quota tightening.

token-efficiencyworkflowharnesscontext
by EagleApprehensive Sep 14, 2026 6/10
workflow Reddit

Sojourn for iOS: a shipped Swift app from 45 one-shot prompts

A published iOS topical Bible study app, written in Swift with a streaming chat interface, whose author never typed a line of its code. The post is about the process rather than the app — how one-shot prompting evolved over several years into something that reliably produces a shippable result, and what the author now does differently.

iosswiftworkflowone-shot
by jmathai Sep 14, 2026 7/10
workflow GitHub

core-team: a self-deploying multi-agent framework for Claude Code

A Facilitator plus a development team of subagent roles, with persistent memory and quality gates. The framework bootstraps itself into a project rather than requiring manual wiring. Documentation is in Russian.

multi-agentsubagentsframeworkrussian
by noxxer Sep 14, 2026 5/10
workflow GitHub

covener: spec-driven development for agent teams in regulated domains

Built around governance rather than speed — specs drive the work and decisions are recorded so they can be audited afterwards. Targets regulated domains and large codebases where 'the agent did it' is not an acceptable explanation.

spec-drivengovernanceauditmulti-agent
by ajmorenodelarosa Sep 14, 2026 6/10
workflow GitHub

agent-discipline: repo work discipline plugin for coding agents

A methodology prompt section plus artifact scaffolding — AGENTS.md, a feature checklist, verification gates — and a compliance audit that checks the agent actually followed them. Packaged as a DeepSeek Harness bundle; documentation is in Chinese.

disciplineagents-mdgateschinese
by FranklinZaneDurant Sep 14, 2026 5/10
workflow GitHub

factory: Claude Code builds, Codex reviews, guardrails decide

A small software factory on Herdr that splits roles by tool: Claude Code plans and implements, Codex reviews the result, Beads carries issue memory across sessions, and mechanical guardrails — not a model — make the accept-or-reject call.

orchestrationcode-reviewguardrailsherdr
by robi42 Sep 14, 2026 6/10
workflow GitHub

bro: declare each agent persona once, sandboxed with only its own keys

Each persona — a 'bro' — is declared once with its prompt, tools, secrets, procedures and the list of other personas it may summon, then comes to life in its own sandbox holding exactly that and nothing more. The pitch is a fix for prompt chaos, wide-open API keys, MCP overload and agents with free rein over your machine. Works on any harness and any model.

sandboxpersonassecuritymulti-agent
by dzhioev Sep 14, 2026 7/10
workflow GitHub

my-blog-supporter: a blog-writing workflow that keeps the author in charge

A personal Japanese-language workflow for writing blog posts with Claude Code across four stages — core, dig, assemble, write — with isolated review, concept diagramming, an HTML preview with figures for reading while revising, and a publish gate.

writingworkflowjapaneseblogging
by YoshitakaArakawa Sep 14, 2026 5/10
workflow GitHub

jedi-review: an adversarial review tribunal for Claude Code

Runs parallel attack lenses over a change, tries each finding before a skeptic, re-attacks the fixes, and gates on zero confirmed defects while keeping a defect ledger. A structured take on adversarial self-review.

code-reviewadversarialquality-gatesworkflow
by zayvillion-dot Sep 14, 2026 7/10
workflow GitHub

threads-newsroom: Five-Agent Editorial Pipeline for a Threads Blog

A five-agent newsroom workflow (Russian-language) for running an expert blog on Threads: one agent plans, others draft, fact-check, and publish only after explicit human approval. It bundles post formats built around real numbers and a 20-rule style guide aimed at keeping the voice human rather than generic.

workflowmulti-agentcontentthreadsrussian
by shaverni Sep 14, 2026 5/10
workflow Reddit

Deciding When Claude Code Is Actually Done: Stop Conditions

A discussion that frames the mental load of reviewing agent output as verification debt: if 'done' means reading the whole transcript, delegation is just babysitting. The author's loop is one agent implementing and a second scoring the change against explicit checks, with failures cycling back until they pass. The thread collects stop conditions other people use in practice.

workflowverificationsubagentsdiscussion
by reddebtt Sep 14, 2026 6/10
workflow GitHub

tomte: GitHub Actions That Take a Labeled Ticket to a Merged PR

Reusable GitHub Actions workflows that orchestrate coding agents end to end: label a ticket and the pipeline produces a merged pull request with no human in the path. The merge gate lives in CI, so quality control is a test suite rather than a reviewer.

github-actionsciautomationautonomous
by chizhangucb Sep 14, 2026 7/10
workflow Reddit

Why Claude Code Burns a 5-Hour Limit in 30 Minutes: the Token Math

Walks through where quota actually goes on a broad prompt like 'fix the bug in the auth flow': glob and grep pull 10-15 files into context, and every subsequent turn re-sends all of it. The argument is that most of the burn is dead weight from unfocused exploration rather than any quota change, along with suggestions for scoping prompts to avoid it.

usage-limitscontexttoken-economicsprompting
by Sweet-Transition-787 Sep 14, 2026 7/10
workflow GitHub

octopus-factory: Recipe-Driven Autonomous Pipeline With Quota Fallback

A recipe-driven pipeline for Claude Code and Claude Octopus that runs multi-agent build, audit, and release stages autonomously. Includes quota fallback, so a session that hits a limit degrades to another path instead of stopping outright.

automationmulti-agentpipelinequota
by SysAdminDoc Sep 14, 2026 6/10
workflow GitHub

solowright: Spec-Driven Development System for a Solo Builder

You write the spec; the system plans, builds on tiered models to control cost, reviews at fixed gates, and reports back in plain language. Built for Claude Code and explicitly scoped to one person working alone rather than a team.

spec-drivenworkflowsoloreview-gates
by EHaake Sep 14, 2026 7/10
workflow GitHub

GoHarness: Agent-Assisted Development Cycle as an Installable Plugin

An agent-assisted development cycle for Claude Code, packaged as an installable plugin, shipped alongside a sample app built entirely with it. The example app is the useful part: it shows what the cycle produces rather than just describing it. Spanish-language README.

pluginworkflowdevelopment-cyclespanish
by rarango10 Sep 14, 2026 5/10
workflow GitHub

harness-template: Separate the Implementer From the Verifier

A Claude Code development framework that splits the implementing agent from the verifying one, seals hidden tests behind encryption so they cannot be read and gamed, and keeps regression tests over the anti-cheating mechanism itself. Traditional Chinese README.

workflowtestingverificationchinese
by oilotaku Sep 14, 2026 5/10
workflow GitHub

AunoForge: AI-assisted open-source maintenance you can verify

A workflow for the unglamorous parts of maintaining an OSS project: triaging issues, reproducing bugs, reviewing PRs, checking for regressions and security problems, and preparing releases. Each step is designed to produce evidence a human can check rather than a verdict to trust.

ossmaintenancecode-reviewtriagereleases
by dhtoan Sep 13, 2026 6/10
workflow GitHub

lock-master: portable file locks so parallel agents stop clobbering

A zero-dependency locking scheme for multi-agent work built on plain LOCK*.txt files. Supports exclusive and team locks, path scopes, expiry, stale-lock cleanup, and cloud-sync-friendly storage, with a cache for a fast overview of who holds what.

multi-agentlockingcoordinationparallelworkflow
by ellmos-ai Sep 13, 2026 6/10
workflow GitHub

baseline-ops: markdown runbooks for agents deploying Go apps on one host

An operations repository containing nothing but markdown: runbooks for deploy, rollback, and restore, pinned version numbers, and the Docker, Caddy, and Compose templates every project copies. Written so an AI agent can follow it directly. Companion to the author's engineering baseline repo.

opsrunbooksgodockercaddy
by andygeiss Sep 13, 2026 6/10
workflow Reddit

An enterprise engineer's honest take after maxing weekly limits

A working report from someone using Claude Code heavily on enterprise-level code across several subscriptions, not vibe coding. The main advice: keep a separate project holding reusable best practices split into narrow, path-scoped sections — form validation, API sanitization — rather than one large rules file. Invites others to compare notes.

workflowbest-practicesclaude-mdskillsexperience
by Wooden_Drag9473 Sep 13, 2026 5/10
workflow Reddit

An AI-run news site published nothing for three days: the editor said no

A build report from someone running a news site where seven agents handle reporting, writing, and editing. The premise was that accurate articles can still mislead, so the editor agent was tuned against framing and sensationalism — and it rejected everything the other agents produced for three days straight. An honest account of a multi-agent quality gate set too strict.

multi-agenteditorialquality-gateexperiencejournalism
by jerupjerup Sep 13, 2026 6/10
workflow Reddit

Are coordination packages like orca worth it for multi-account setups?

A practitioner describes their current setup: two or three Claude accounts and a couple of Codex accounts at the CLI, with one Fable instance acting as coordinator and the rest communicating directly or through a shared mailbox using radio-style acknowledgements. They find it fiddly to rebuild each time and ask whether existing coordination packages are worth adopting.

multi-agentcoordinationorchestrationcodexdiscussion
by persiflage1066 Sep 13, 2026 5/10
workflow GitHub

agent-loops: run a task loop across several CLI coding agents with roles

One controller drives a loop over multiple CLI coding agents in a fixed role order, keeping a single persistent session per role so each agent accumulates its own context instead of starting cold every pass.

multi-agentorchestrationrolesloopcli
by andromarces Sep 13, 2026 6/10
workflow GitHub

dev-flow: 46 agent skills and a filesystem contract, idea to production

Coordinates a product build through a .workflow/meta.json contract plus 46 agent skills covering web (Next.js 16) and mobile (Expo/React Native), with an 'eve' agent engine and Linear/scrum integration. Runs on Claude Code, Codex, Copilot, Gemini, and Cursor.

workflowskillsnextjsexpolinear
by lukedj78 Sep 13, 2026 7/10
workflow Reddit

Autonomous agents don't need less control, they need it somewhere else

An argument that Cursor feels controlled because you sit inside the edit loop, but that is the wrong place for an autonomous agent. Instead of supervising every edit: isolate the work, give the run explicit boundaries, make progress observable, and stop at meaningful gates. Control moves from the keystroke to the environment.

autonomycontrolworkflowsandboxingdiscussion
by Disastrous-Radio-732 Sep 13, 2026 6/10
workflow GitHub

Cotal: a proposed open standard for agent coordination

An attempt at a common protocol for agents to coordinate with each other, rather than every orchestrator inventing its own message format.

standardcoordinationprotocolmulti-agentinterop
by Cotal-AI Sep 13, 2026 5/10
workflow GitHub

manga-honyaku: code does the geometry, the agent does the comprehension

A manga translation workflow split along its natural seam: deterministic code handles panel and bubble geometry while an LLM agent handles reading and translating. A clean example of not asking a model to do what a library does better.

translationmangaworkflowocrpipeline
by CodeCampusCo Sep 13, 2026 5/10
workflow GitHub

agent-leash: LEASH-8, a control model for agents with delegated authority

An eight-domain control model for agents acting on your behalf, with a scorecard, an approval-design checklist, and a plan-versus-authorize pattern separating what the agent decides from what it is allowed to execute. Drawn from a live production agent operation and sanitized. MIT.

governanceauthorityapprovalcontrolsafety
by tonydzi Sep 13, 2026 7/10
workflow GitHub

fanout: Claude Code orchestrates other coding agents in git worktrees

Lets Claude Code act as lead over the other coding agents you already subscribe to, dispatching them to work in parallel inside isolated git worktrees. Each branch is reviewed and proven before anything merges back. Useful if you pay for several agents and want one of them coordinating the rest.

orchestrationworktreesmulti-agentparallel
by elberacasa Sep 13, 2026 8/10
workflow GitHub

agentic-dev-toolkit: shared agent instructions and model routing

A portable workstation setup bundling agent instructions, harness adapters and model-routing configuration that works across Claude Code, Codex and OpenCode. The point is to keep one set of conventions rather than re-tuning each harness separately. Handy when you move between machines or agents often.

dotfilesmodel-routingportabilityconfig
by Prev-I Sep 13, 2026 6/10
workflow GitHub

AISEF: gated pipeline from a requirements file to a working app

A framework that takes a single requirements file and drives it to a finished application through a series of gates, with evidence required at each step. Agents supply the judgment while ordinary code enforces the guarantees, so the process does not rely on the model behaving. Aimed at people who want repeatability rather than one-shot generation.

frameworkgatesrequirementsverification
by nghinh Sep 13, 2026 6/10
workflow Reddit

Re-deriving a minimal agent harness: what does one actually need?

A write-up from someone who spent weeks using Claude Code to build a small agent harness, not as a product but to understand harness architecture. The core argument is to invert the usual drift, letting architecture define sessions instead of sessions quietly defining architecture. Uses DeepSeek Harness as the reference point for what a modern harness requires.

architectureharnessagent-designwriteup
by Beneficial_Owl7036 Sep 13, 2026 6/10
workflow GitHub

agent-dev-team: Claude Code plugin that staffs work like an eng org

A plugin that assigns work across 21 roles including PM, tech lead, engineers, reviewer, SRE and security, each capped at one of four seniority tiers, with 26 supporting skills. Slash commands cover team, spec, plan, build, review and ship. The stated goal is to stop a single assistant from making decisions above its pay grade.

pluginmulti-agentrolesescalation
by NeitherRun3631 Sep 13, 2026 7/10
workflow GitHub

mARC: subagent relay with a tech lead and pre-merge security gate

Installs an AI engineering team into any repo as a single Claude Code plugin. A tech-lead agent orchestrates specialist subagents for development, SRE, design and security, and a security gate must pass before a merge is allowed. Aimed at teams who want the review step enforced rather than optional.

pluginorchestrationsubagentssecurity-gate
by NexaDuo Sep 13, 2026 7/10
workflow GitHub

docket: a decision ledger so agent decisions survive compaction

A ledger for long-running agent work that records decisions as they are made, so they remain in force after the context window is compacted. Addresses the common failure where an agent quietly re-litigates something it settled an hour ago. Small and repo-local.

memorycompactiondecisionslong-running
by NovusEdge Sep 13, 2026 7/10
workflow GitHub

Mobile Dev on Claude Code: Run Sessions From a Phone via SSH and tmux

A practical guide to continuing Claude Code work from a smartphone by combining SSH, tmux, and multiple machines. Covers keeping sessions alive so a run started at a desktop can be picked up on a phone and handed back. Useful for anyone who wants long agent sessions to survive leaving the desk.

mobilesshtmuxremoteguide
by nori00000 Sep 12, 2026 6/10
workflow GitHub

forge-plugin-claude-mp: Route Feature and Bug Work Through PDLC Workflows

A free Claude Code plugin that automates the product development lifecycle by routing incoming feature requests, bug reports, and architecture work into structured workflows. Each request type follows its own path instead of a generic prompt. Aimed at teams that want consistent process without manual triage.

pluginpdlcworkflowautomationproduct
by ShipToday Sep 12, 2026 6/10
workflow GitHub

zero-drift: Track Tasks Across Sessions to Keep Agents on the Plan

A tool that keeps AI assistants from drifting during long conversations by tracking outstanding tasks across sessions. State persists past compaction, so the agent can be pointed back at what it was actually asked to do. Targets the common failure where a long session quietly abandons half its plan.

contexttask-trackingdriftsessionsmemory
by obrenoalvim Sep 12, 2026 6/10
workflow GitHub

the-agentic-engineer: A Blog and the Agent Pipeline That Ships It

The source behind agentic-engineer.com: both the blog itself and the agent pipeline that writes, lints, and publishes its posts. Valuable less as a product than as a worked, readable example of an end-to-end content pipeline driven by coding agents.

blogpipelineautomationpublishingexample
by Mandalorian007 Sep 12, 2026 5/10
workflow GitHub

oficina-de-ia: Claude Code AI Office OS Set Up in Seven Questions

A Spanish-language “AI operating system” for Claude Code that learns what you do for a living, connects to your email and apps, and copies the way you do your tasks. It watches for work you repeat and turns it into something that runs on its own. Setup is a seven-question install.

workflowautomationspanishpersonal-assistant
by adrianalvareztech Sep 12, 2026 5/10
workflow Reddit

Codifying Agent Behavior: Contracts Instead of Ever-Longer Prompts

An argument that as models get smarter the prompts should shrink while the structure around them grows. The author proposes a set of contracts — state, capabilities, verification, escalation, execution — as a way to make behavior at an agent's boundaries deterministic and easier to reason about. Links to a longer Medium write-up.

discussionagent-designcontractsprompting
by _itshabib Sep 12, 2026 6/10
workflow Reddit

295 Claude Code Tools Installed, Six Used: Not a Search Problem

After collecting 295 agents, commands and skills in ~/.claude, the author uses six — and argues better discovery is not the fix. The unused pile splits in two: things installed for a one-off job that will never recur, which is just normal, and things you would genuinely want on the day the need arises but will not remember exist. Only the second pile is a real problem, and lumping them together sends you chasing the wrong fix.

discussionskillstoolingdiscovery
by Any_Necessary_9804 Sep 12, 2026 7/10
workflow GitHub

stochastic-consensus: Rank Ideas by How Often Subagents Reinvent Them

Fans out independent subagents in Claude Code, merges everything they produce into one pool, then ranks ideas by how many times they recurred independently. Repeated convergence becomes the signal rather than any single agent's confidence.

workflowsubagentsconsensusmulti-agent
by KENAN-LABS Sep 12, 2026 7/10
workflow Reddit

Driving Claude From Codex as a Translation Layer: Anyone Doing This?

A developer who plans with Fable, implements with Sonnet or Opus and reviews through Codex finds Claude's replies too verbose and jargon-heavy, and CLAUDE.md rules have not fixed it. Rather than move projects that were designed and scaffolded around Claude's context, they are considering using Codex purely as an interpreter in the middle, and ask whether anyone else runs that setup.

discussionworkflowcodexmulti-model
by PositiveSlice9168 Sep 12, 2026 5/10
workflow Reddit

Vertical Slices or Whole-Feature Prompts: How Do You Structure Work Now?

Two years in, the author has rebuilt their workflow three times — from prompting one function at a time and wiring it together by hand, to vertical slices with generated tests, to describing a whole feature and letting Fable 5 build it. That last step works but feels strange, so they ask others who have been at this a while whether they still slice, who writes the evals and tests, and what a 2026 dev cycle looks like.

discussionworkflowtestingprompting
by FewWoodpeckerIn Sep 12, 2026 6/10
workflow GitHub

Nereus: Interview to Spec to TDD Build With Hooks That Actually Block

An opinionated development harness for Claude Code that runs interview, spec, TDD build, parallel review and finish as distinct stages. Its hooks are enforcing rather than advisory — they block when a stage's conditions are not met.

workflowharnesstddhooksreview
by snwlee Sep 12, 2026 7/10
workflow Reddit

A Context Management Setup for Claude Code Across 10+ Repos

A founding engineer at an early-stage infra company with a microservices layout describes teaching their agent who calls whom across more than ten interdependent repositories. First came a knowledge graph spanning all of them, which helped enormously; the second bottleneck was babysitting the same context into every new session.

discussioncontext-managementknowledge-graphmonorepo
by BearInevitable3883 Sep 12, 2026 6/10
workflow Reddit

Dynamic Workflows Are Still Unmatched and Under-Discussed

The author argues Claude Code's dynamic workflows remain the standout feature no other harness, Codex included, has matched: you can orchestrate with Fable 5.1 while using non-Anthropic models as executors through their own CLIs. They stress this is not the same thing as subagents.

discussionworkfloworchestrationmulti-model
by Fair_Bed_914 Sep 12, 2026 6/10
workflow GitHub

Delivery Discipline Layer: Make the Agent Prove It's Done

A behavior layer aimed at turning “the agent says it's done” into “the agent proves it's done”: a pre-implementation gate, one backbone plus two collaboration forms, evidence-based review, and acceptance in the real environment.

workflowverificationreviewdiscipline
by JadeYingWah Sep 12, 2026 6/10
workflow GitHub

blackice: Adversarial Reviewer Panel With a Ruin-Class Circuit Breaker

A human-in-the-loop code review panel that runs a bounded loop of reviewer agents whose job is to break your change. A ruin-class circuit breaker halts the loop when a finding is severe enough to warrant stopping.

workflowcode-reviewadversarialmulti-agent
by aigora-de Sep 12, 2026 7/10
workflow GitHub

openshard: Route, Gate, and Verify Work Across AI Coding Agents

An orchestration layer that routes tasks across models, gates risky actions behind approval, verifies results, and keeps a durable execution record. The framing is receipts — every agent action leaves an auditable trail. Relevant if you run unattended agents and need to answer what actually happened afterwards.

orchestrationroutingauditverification
by openshard Sep 12, 2026 7/10
workflow GitHub

StarFix: Playbook for One AI Captain Directing a Terminal Agent Fleet

A playbook plus scripts for running one long-lived coordinating agent that directs a fleet of terminal AI workers, covering protocols, monitoring, task dispatch, context handoff, and trajectory compilation. It also ships a benchmark for the coordinating agent itself. Documentation is primarily Chinese; the multi-agent handoff patterns are the draw.

multi-agentorchestrationcontext-handoffplaybook
by MarcMao0819 Sep 12, 2026 6/10
workflow GitHub

watching-claude: External Supervisor That Auto-Resumes and Verifies Runs

An external supervisor process for Claude Code that automatically continues stalled runs and uses DeepSeek to review the output, so a long task can finish unattended. The pairing of one model doing the work and another checking it is the notable design choice. Documentation is in Chinese.

automationunattendedverificationsupervisor
by xiincs Sep 12, 2026 6/10
workflow Reddit

Lessons From 3 Months of Claude Coding an MMO Around the Clock

A developer ran Claude Code continuously for three months to build a browser-based horror MMO, reaching 1800+ versions. The workflow that held it together: one new version file per cycle, a written request log so feature asks are never lost, dedicated polishing cycles between content sessions, and a second agent auditing the coding agent's output.

game-devlong-runningmulti-agentworkflow
by swingking_x Sep 11, 2026 7/10
workflow GitHub

GARAGISTE: A Six-Agent Dev Team in One Folder of Config Files

An autonomous development team expressed entirely as configuration: six agents that plan, build, verify, review and ship, with no runtime to install. Works in both Claude Code and opencode.

multi-agentorchestrationconfig-onlyopencode
by jaewhi-park Sep 11, 2026 7/10
workflow GitHub

ksforge: Turn User Stories Into Resumable Claude Code Workflows

Converts user stories into controlled, resumable Claude Code workflows, so a long feature can be paused and picked back up without losing the thread of what was agreed.

user-storiesworkflowresumableplanning
by chevp Sep 11, 2026 6/10
workflow GitHub

orchestrator: Run Multiple Coding Sessions and Manage Their PRs

Orchestrates several coding sessions at once and handles the PR side — AI-assisted review handling included — while keeping approval decisions with you rather than the agents.

orchestrationpull-requestscode-reviewparallel
by kbarendrecht Sep 11, 2026 5/10
workflow Reddit

Beads: A Private Work Graph for ~100 Parallel Claude Sessions

A developer running four tmux sessions of 20-30 Claude Code chats across 30+ Go services describes the three things that actually broke: what is blocked on what, which session did what and why, and what the team knows. The answer was a private work graph sitting between GitHub and the agents.

scaleparallel-sessionswork-graphtmux
by serrghi Sep 11, 2026 7/10
workflow Reddit

50 Releases of a Multiplayer Tank Shooter Built With Claude Code

Two months and 50 releases into a vibe-coded multiplayer tank shooter with an active player Discord, the author shares what changed the agent loop — chiefly deploying a small read-only MCP server on the AWS production game server so the agent can observe live state while debugging.

game-devmcpproductiondebugging
by IamHuggos Sep 11, 2026 6/10
workflow GitHub

oh-my-sdd: Automating Spec-Driven Development

Automates and simplifies a spec-driven development loop, reducing the ceremony of keeping specs, implementation and verification aligned when an agent writes the code.

spec-drivenworkflowautomationspecs
by slpascoal Sep 11, 2026 5/10
workflow GitHub

sprint-harness: A Diamond-Graph Harness for Multi-Agent Fan-Out

A sprint harness built on a diamond-graph shape — fan out to parallel agents, then converge — for building features with multiple agents instead of one long serial session.

multi-agentfan-outharnesssprints
by Curious-Keeper Sep 11, 2026 5/10
workflow GitHub

SFLO: A Gated Pipeline Protocol for Building Software With Agents

Simon Factory Lights Out defines a gated pipeline protocol for agent-built software — each stage must pass its gate before the next begins, aiming at unattended runs that still stop when something is wrong.

pipelinegatesprotocolautonomous
by simonasrazm Sep 11, 2026 5/10
workflow GitHub

ai-legacy-migration-framework-kit: Legacy Migration Gates for Agents

A Claude Code and Codex plugin that chains legacy-system analysis, spec approval, implementation and verification into one gated workflow. Each phase only hands off once its spec is approved. Aimed at teams modernizing old codebases with an agent instead of ad-hoc prompting.

legacy-migrationplugincodexspec-driven
by winkrj Sep 11, 2026 5/10
workflow GitHub

claude-code-blueprint: Reusable Agent, Skill, Hook and Rule Scaffolding

A starting blueprint for assembling Claude Code workflows out of agents, skills, hooks and rules, aimed at making behavior consistent and safer across different projects. Good if you keep rebuilding the same setup per repo.

scaffoldinghooksrulesconsistency
by lethilu4796 Sep 11, 2026 5/10
workflow GitHub

remote-collab-agents: Coordinate Claude Code Across Macs and Linux Boxes

Lets Claude Code agents on different machines work together: remote command execution, file sync, and a trust model for multi-agent workflows that span hosts. For people whose build machine and laptop are not the same box.

distributedmulti-agentremote-executionfile-sync
by Hierarchical-sage374 Sep 11, 2026 6/10
workflow GitHub

agent-compose: Compose Agent Personas, Skills and Tools Into Files

Picks a role, a personality blend, the skills that role can see and the tools it gets, then writes the whole thing out as plain files your harness already understands. Configuration as composition rather than copy-paste.

personascompositionagentsconfig
by coilyco-flight-deck Sep 11, 2026 6/10
workflow GitHub

sdlc: One Story per Session, Nine Gates, Enforced by Hooks

A story-driven delivery loop for Claude Code where each session handles exactly one story and must pass nine gates enforced by hooks. Tests are frozen before implementation starts and the agent writing the code cannot edit them — closing the most common way agents fake a green suite.

hookstddquality-gatesprocess
by bbsnly Sep 11, 2026 7/10
workflow GitHub

omelette-fleet: Gemini, Grok and Codex as Read-Only Reviewers

Brings Gemini, Grok and Codex into Claude Code as read-only research and review units, running on subscriptions you already pay for rather than API billing. Second opinions without giving another model write access to your repo.

multi-modelcode-reviewread-onlysubscriptions
by adxd-og Sep 11, 2026 7/10
workflow GitHub

dew_flow_conventions: One Copy of Agent Rules Across Five Repos

Keeps a single canonical set of cross-repository rules for AI-agent sessions, mounted into each repo as a git submodule with CI checks that the pinned revision has not drifted. A concrete answer to CLAUDE.md files diverging across a fleet of repos.

conventionsmonoreposubmoduleci
by oleksandrdubyna88 Sep 11, 2026 5/10
workflow GitHub

superpowers-gstack: Using Superpowers and GStack Together

A workflow manual, routing plugin and CLAUDE.md generator for running the Superpowers and GStack frameworks side by side, each in the phase it handles best. Useful if you already use one and keep bouncing off the other.

superpowersgstackframeworksrouting
by Paretofilm Sep 11, 2026 5/10
workflow GitHub

watchbill: Parallel Subagents in Worktrees, Coordinated by a Mailbox

Runs parallel Claude subagents in separate git worktrees, coordinated through a file-based mailbox carrying live status, corrections, claims and merge evidence. A supervising agent runs the deck and merges only what the evidence supports.

parallel-agentsworktreesorchestrationmerge
by jrabercrombie Sep 11, 2026 7/10
workflow GitHub

fagan: Frontier Models Plan and Review, Local Models Implement

An MCP-native autonomous SDLC pipeline that spends expensive frontier-model tokens on planning and review while local models do the bulk of the implementation. The pitch is real engineering discipline — plan, implement, review — on a $20/month budget.

sdlclocal-modelscostmcp
by motock Sep 11, 2026 7/10
workflow GitHub

compaction-handoff: Carry a Session Across Auto-Compaction

A Claude Code plugin that writes a verified handoff document just before auto-compaction hits and pastes the continuation prompt back afterwards, so the thread of a long session survives the summarization step.

compactioncontexthandoffplugin
by raichominev Sep 11, 2026 7/10
workflow Reddit

Giving Claude Code a Voice With a Local TTS Script

A writeup on having Claude speak a short plain-English summary after each meaningful task, piped through a local text-to-speech script. The author's argument is that it cuts the cognitive load of reading terminal output when supervising several parallel agents.

ttsvoiceworkflowaccessibility
by tinyhousefever Sep 11, 2026 5/10
workflow Reddit

Markdown Is All You Need: Flat-File Agent Memory That Beat a Runtime

A write-up of the markdown memory system the author's agent has run on for seven months: long-term facts live in structured markdown files, with a small MEMORY.md index telling the agent what exists and where to look, keeping always-loaded context small. Tested head to head against a 382-dependency memory runtime on a superseded-fact question, the folder returned the current decision with its source while the runtime returned the stale one. The argument is that the editing rules matter more than the storage engine.

memorymarkdowncontextclaude-md
by SIGH_I_CALL Sep 11, 2026 8/10
workflow Reddit

Archflow: 17-Agent Claude Code Plugin That Keeps the Plan in Your Repo

A Claude Code plugin distilled from a year of running one workflow across 20 apps. It uses 17 specialist agents and stores the roadmap and backlog as files in the repo rather than in a chat you lose, reading existing code to write the plan itself. It parks and asks when uncertain instead of guessing. Free and open source, installed via `claude plugin marketplace add AZidan/archflow`.

pluginmulti-agentplanningroadmapopen-source
by New-Butterfly9160 Sep 11, 2026 7/10
workflow Reddit

android-without-kvm: Run and screenshot Android apps in Claude Code containers

A repo and workflow that gets Android 14/15 emulation running inside Claude Code's cloud container despite the missing KVM support, so the agent can build, launch and screenshot your app itself. Also wires up an automatic APK build on every push. Cuts the manual back-and-forth of testing mobile changes by hand.

androidmobilecloud-containeremulatorci
by First-Painter8620 Sep 10, 2026 7/10
workflow GitHub

pact: Spec-driven methodology for Claude Code — spec, plan, build, ship

A terminal-based, agent-controlled software engineering methodology that walks Claude Code through spec, plan, build and ship as distinct phases. Aimed at keeping an agent on rails for larger features rather than letting it improvise from a one-line prompt. One of many spec-driven kits, but a lightweight one.

spec-drivenmethodologyplanningworkflow
by melchimaelran Sep 10, 2026 7/10
workflow Reddit

A Fable 5.1 delegation setup that cut usage versus Fable 5 plus Opus 5

A write-up of one user's multi-model CLAUDE.md setup after switching to Fable 5.1: the chat agent now writes code itself on medium effort rather than delegating to Opus 5, with Sonnet 5 kept for cheap reads and a separate Fable subagent doing an independent review before each PR. Reports lower usage and faster output than the previous delegate-everything arrangement. Anecdotal, but a concrete configuration to compare against.

fablemodel-selectiondelegationsubagentsclaude-md
by connurp Sep 10, 2026 6/10
workflow GitHub

novahiz: Skill catalog, prompt classifier and a pre-edit enforcement gate

A deterministic layer that sits over AI coding harnesses: it catalogs available skills, classifies the incoming prompt to pick the right one, and blocks edits at a gate until the required checks pass. The point is to make skill selection and guardrails repeatable instead of leaving them to the model's judgment each run.

skillsclassifierguardrailsenforcementdeterminism
by novahiz Sep 10, 2026 6/10
workflow GitHub

castra: Execution Posture Harness That Takes Claude Code One Step Further

A harness that wraps Claude Code with an explicit execution posture, aimed at the gap where a coding agent stops just short of finishing the job. It formalizes that final step rather than leaving it to the model's judgment.

harnessexecutionclaude-codeautomation
by beyondworks Sep 10, 2026 5/10
workflow GitHub

groundwork (skrinak): Repo Scaffold With a Taxonomy Guard Green on Commit Zero

A repository scaffold for software built with coding agents, organizing everything into six buckets with a usage README in every directory. A taxonomy guard enforces the structure from the very first commit, so the layout does not erode as agents add files.

scaffoldrepo-structureconventionsguardrails
by skrinak Sep 10, 2026 6/10
workflow Reddit

Every Connected MCP Server Costs Tokens on Every Turn, Used or Not

A reminder that MCP tool schemas load into context on each turn whether or not the model calls them, so eight connected servers quietly tax every request. The suggested fix is moving rarely-used integrations (the author's example is email) off MCP and onto a CLI the agent invokes through Bash, so nothing occupies context until it is actually needed.

mcpcontext-managementtoken-usageoptimization
by JanJanJaJa Sep 10, 2026 7/10
workflow GitHub

agentic-brownfield-coding: Claude Code Scaffolding for Complex Legacy Projects

Scaffolding and a first-steps process for pointing Claude Code at large existing codebases rather than greenfield ones. Focused on the onboarding problem where an agent has to build enough context before any change is safe.

brownfieldlegacy-codescaffoldingonboarding
by ralfstrobel Sep 10, 2026 6/10
workflow Reddit

A Solo Developer's Full Coding-Agent Stack, Repo Layout, and Workflows

A worked account of one developer's standardized agent workflow after several projects: pen.dev for UI/UX design, GitHub Issues and Projects for requirements, Zed with Vim mode, Ghostty, and agent multiplexers (Runner and Orca) for running several sessions. Written as an invitation to compare notes rather than a prescription.

workflowsolo-devtoolingmultiplexer
by jason3gb Sep 10, 2026 6/10
workflow GitHub

myflow-controller: Takes the Word "Done" Away From the Model

A Claude Code skill paired with a stdlib-only Python controller that decides completion externally: a test gate, scope measured by diff delta, tracked review findings, budgets, and observability. The model no longer gets to declare the task finished on its own say-so.

completion-gatetest-gatebudgetsobservabilitypython
by brownjuly2003-code Sep 10, 2026 7/10
workflow Reddit

18 Hidden Token Drains in Agent Sessions, With Fixes for Each

Notes from logging raw API payloads through a local proxy across hundreds of Claude Code, Codex, and Cursor sessions, identifying 18 specific ways context quietly bloats during long refactors. Example: a full pytest or jest run dumping 400 lines of passing dots injects thousands of tokens that then ride along in every subsequent turn — pipe with --quiet or filter to failures only.

token-usagecontext-managementoptimizationprofiling
by EmployerNegative5653 Sep 10, 2026 8/10
workflow Reddit

The Transcript Should Not Be the Agent's Memory

Argues that conversation history and memory are two different things: long sessions accumulate context, get expensive to reread, and degrade as execution environments, while a fresh process throws away continuity entirely. The brnrd approach separates them — a new process wakes into a compact orientation layer holding task and run state, the repo contract, and the resident's working memory and plan.

memorycontext-managementarchitecturelong-running-agents
by Disastrous-Radio-732 Sep 10, 2026 7/10
workflow Reddit

A Summer of Claude Code on Garmin Watch Faces: What Worked and What Broke

A hands-on report from shipping Garmin watch faces with Claude Code on a hand-written engine: three old faces ported to current watches in ten days, new faces from concept to store in two to seven days. Covers the per-phase skills used, the guard rails that proved necessary because agents optimized things they could not see, and the rules that emerged from the failures.

case-studyskillsguardrailsgarminembedded
by tomasslavicek Sep 10, 2026 7/10
workflow Reddit

Putting Claude Code's Changes Through a Supervised Release Pipeline

An account of building ListMyCar — VIN decoding, listing flow, photo enhancement, pricing suggestions, marketplace exports — where the demo took a weekend but reliability took much longer. Every change, whether from Claude Code, their agent, or a human, goes through identical checks, independent review, and staging, with humans approving anything public, expensive, or destructive.

release-pipelinereviewstagingcase-study
by rchaz8 Sep 10, 2026 5/10
workflow GitHub

storytime: Persona-Driven Continuity for Claude Code Collaboration

A continuity system built around personas for working with Claude Code over long stretches, keeping a consistent collaborator identity across the harness rather than restarting cold each session.

personascontinuitycollaborationcontext
by 1ps0 Sep 10, 2026 5/10
workflow GitHub

research-council: Research a Hard Problem Before Anyone Writes Code

A Claude Code plugin that runs a research phase against a frozen goal statement, so the target cannot drift while investigation is underway. Output is evidence-backed claims written in plain English rather than a code sketch. Meant for problems where the wrong architecture is expensive to discover later.

researchplanningpluginevidence
by abhisheksharma001 Sep 10, 2026 7/10
workflow GitHub

Getting Out of the Loop: 8 Months of Solo-Building with AI

A long-form writeup of what changed over eight months of building software solo with AI agents, focused on getting the human out of the per-step review loop. Reads as accumulated practice rather than a tool announcement. Worth skimming if you are still hand-approving every diff.

practicessolo-devwriteuporchestration
by patforna Sep 10, 2026 5/10
workflow Reddit

Forcing Claude Code to Externalize Its Decisions Through a Fake Tool Call

An experiment using a proxy to inject a fake tool that Claude Code and Codex must call to state a decision, then comparing what each said it would do against what it actually did. The author is clear these are not real reasoning traces. Code is in the agents-workbook repo, and the technique is easy to reuse for your own audits.

experimentproxytool-callsreasoningaudit
by Sad_Construction2179 Sep 10, 2026 6/10
workflow GitHub

review-ledger: A Ledger-Backed Author/Reviewer Loop Between Claude and Codex

A Claude Code plugin that runs review as a bounded protocol: findings get ids, replies are mandatory, the thread resumes in place, and there is a hard cap on rounds. Codex plays reviewer against Claude's authored changes. The round cap and mandatory replies are what stop these loops from drifting forever.

reviewcodexpluginprotocol
by SwiftlyAside Sep 10, 2026 7/10
workflow GitHub

claude-web-studio: Tiered Agents and a Testing Framework for Web Work

A web development setup for Claude Code combining tiered agents, pipeline skills, hooks, a dated stack reference and — unusually — a framework for testing the agents themselves. The dated stack reference addresses agents recommending outdated library versions. The agent testing piece is rare enough to be worth a look.

web-devagentstestingpipelinehooks
by gonimar Sep 10, 2026 6/10
workflow GitHub

token-barrage: Delegate Bulk Reads to a Cheap Local Worker Model

Routes large file reads and repetitive code work to an inexpensive worker model with no SaaS layer or API key involved. Ships an independent benchmark of the widely cited 90% savings figure and reports what it actually found. French-language documentation, beta status.

delegationcostlocal-modelsbenchmarkfrench
by naiersaidane Sep 10, 2026 5/10
workflow GitHub

cactus-fleet-doctrine: The Governance Text Behind a Four-Mac Agent Fleet

Publishes the operating doctrine of a one-person, four-machine agent fleet: the protocol and the mesh, base, manager and delegate contracts, written out as text rather than code. Reads as an organizational design document for agents. Useful if you are scaling past a single session and want prior art.

fleetgovernancemulti-agentprotocoldoctrine
by cactusaudio Sep 10, 2026 6/10
workflow GitHub

buildersbook: An Open Curriculum for Orchestrating AI Coding Agents

A structured curriculum for engineers shipping production software by directing coding agents rather than typing every line. Open and community-oriented. More coherent than the usual awesome-list, since it is sequenced as a learning path.

curriculumlearningorchestrationpractices
by buildersbook Sep 10, 2026 6/10
workflow GitHub

agent-workflow: Local-First Agent Pipeline Runner With HITL Gates

An agent harness for designing pipelines, executing tasks through a runner, and watching human-in-the-loop gates and artifacts on a local-first dashboard. Everything stays on your machine rather than in a hosted control plane. Useful if you want visibility into multi-step agent runs without shipping state to a service.

orchestrationhitldashboardpipeline
by naut1402 Sep 10, 2026 5/10
workflow GitHub

buildd: Task Coordination Where Agents Claim Work and Open PRs

A task coordination layer for fleets of AI coding agents: you create or schedule tasks, and agents claim them, cut a branch, write the code, and open a PR. Adds missions, roles, and shared memory on top, and is MCP-native so agents connect directly. Aimed at running several coding agents against one backlog without manual dispatch.

multi-agenttask-queuemcppull-requests
by buildd-ai Sep 10, 2026 7/10
workflow GitHub

quorum: Multi-Model Agents for Claude Code via Generated CLI Adapters

Lets Claude Code delegate to other vendors' coding CLIs through field-tested adapters, and includes a probe-driven generator that builds and verifies new adapters for whatever providers you already have installed. The generator is the interesting part — it discovers a CLI's interface rather than requiring a hand-written integration.

multi-modeladapterscliorchestration
by WhereTheTunnelEnds Sep 10, 2026 7/10
workflow GitHub

bigin-skills: Spec-Driven Workflow With an Independent Verifier

A Claude Code plugin for spec-driven development: tasks flow through a defined workflow, an independent verifier agent checks the result, and mechanical gates enforce the process instead of relying on the model to comply. Also distills knowledge about pinned library versions so the agent codes against what you actually depend on. A serious take on keeping agent output honest.

spec-drivenverificationgatesplugin
by tammai Sep 10, 2026 7/10
workflow Reddit

Ticketing Workflow Agents to Cheaper Models to Stay Under the Fable Limit

Argues the Fable weekly cap is rarely the bottleneck if you stop letting models improvise one-off workflows. The author has Fable write a specific ticket per agent — task, size, verification rules — and lets a cheaper model do the actual code writing, since most tokens go to writing code rather than architecture. Includes the rule set they hand the orchestrator.

orchestrationusage-limitssubagentscost
by Straight_Bag5623 Sep 9, 2026 6/10
workflow GitHub

gmc: Parallel Git Worktrees for Parallel AI Agents

CLI that spins up git worktrees so several coding agents can work on the same repo at once without stepping on each other. Also generates commit messages from the resulting diffs. Aimed at anyone running more than one Claude Code session against a single project.

gitworktreesparallel-agentscli
by samzong Sep 9, 2026 6/10
workflow Reddit

Using claude -p for Bulk Data Processing Instead of the API

Report from classifying 100K+ call transcripts by routing the work through a Claude Max subscription with claude -p rather than paying API rates. Covers the two real caveats: throttling once you push large volumes, and the risk Anthropic changes or removes this path. Includes a linked writeup with the harness details.

headlessbatch-processingcostclaude-p
by williamsburg_psycho Sep 9, 2026 6/10
workflow GitHub

coordinator-claude: A PM-Led Operating System for Claude Code

Opinionated end-to-end process for running engineering work through Claude Code from a product-management angle: planning, ticket enrichment, delegated execution, staged review, an explicit ship decision, and durable handoffs between sessions. For teams that want the agent inside a defined process rather than freelancing.

orchestrationproject-managementdelegationreview
by dbc-oduffy Sep 9, 2026 6/10
workflow Reddit

Eval Harness Comparing Fable 5.1 and Astra 6 on a Real Gradle Issue

A Gradle engineer built a harness to test whether a skill or codebase change actually helps a coding agent, then ran it on a real gradle/gradle issue. Both models fixed the bug, but Claude Code read Dokka's source to find the root cause first and shipped a regression test the other skipped. Full diffs, cost and token counts are published.

evaluationbenchmarkgradlemodel-comparison
by Party_Till_I_Die Sep 9, 2026 6/10
workflow GitHub

gsdf: Faster GSD Workflow With One Planner Per Phase and Inline Iterate

Drop-in replacement flow for existing get-shit-done and gsd-core projects that keeps the quality gates but cuts the ceremony: one planner per phase, one executor per plan, and an inline iterate mode where you review the result and reply 'approved'. Aimed at people who found GSD correct but slow.

workflowplanninggsdreview
by daftsins-star Sep 9, 2026 6/10
workflow GitHub

claude-codex-bridge: Claude Code Workers in Worktrees With Codex as Reviewer

Local orchestration setup that assigns structured work to Claude Code workers in separate git worktrees, then has OpenAI Codex act as the owner reviewing the result before it lands. A concrete take on cross-model review without a hosted service.

orchestrationworktreescode-reviewcodex
by knakul853 Sep 9, 2026 6/10
workflow GitHub

project-seed-kit: Reusable Docs Structure and Methodology for New Projects

A prepackaged documentation skeleton and set of conventions to seed new repos with, so agents find a familiar layout instead of you re-deciding structure each time. Useful as a starting point for teams standardizing how CLAUDE.md and design docs are organized.

documentationscaffoldingconventionstemplates
by bessuraba Sep 9, 2026 5/10
workflow Reddit

A Prompt to Find the Files Quietly Eating Your Context Budget

Diagnostic prompt for sessions that feel slower or burn tokens faster than they used to: have Claude find the largest files by size and lines, compute how much of them is prose or comments via a scratch script rather than reading them, dispatch Haiku subagents to check separation of concerns on the worst offender, then scan git logs for accumulating test scripts or memory files.

context-managementtoken-optimizationdiagnosticssubagents
by wayne_oddstops Sep 9, 2026 6/10
workflow Reddit

Playwright's New CLI Cuts Token Use for Claude Code Browser Testing

After finding screenshots cost roughly 7k tokens each while testing a Chrome extension through the Claude-in-Chrome skill, the author switched to Playwright's recently released CLI, which Claude Code drives directly. Testing no longer requires the agent to browse and screenshot its way through the UI.

playwrighttestingtoken-optimizationbrowser
by UnusualRedditor Sep 9, 2026 6/10
workflow Reddit

Make Claude Code's Bash Tool Behave Like Linux on macOS

Fix for the constant friction of Claude assuming GNU tools and bash globbing while actually running zsh with BSD utilities on a Mac. Aligns the session environment with Linux behavior without modifying macOS itself, cutting the self-correction loops that waste tokens and time.

macosbashshelltoken-optimization
by baunegaard Sep 9, 2026 7/10
workflow GitHub

vteam-harness: A Virtual PM/BA/SA/DEV/QA Team With Gates That Can Go Red

One command puts a five-role virtual team to work on your repo, with machine-checkable gates that genuinely fail rather than rubber-stamping. Evidence persists past the session so you can audit what each role did. Works with Claude Code, Cursor, Windsurf, Codex and Copilot.

multi-agentgatesqaaudit
by connorpham Sep 9, 2026 7/10
workflow Reddit

Making Claude Code and ChatGPT Argue About Your App's UI

A developer ran ChatGPT headless from inside Claude Code, gave both models MCP access to Mobbin, and had them debate what was wrong with their mobile app's design. Two hours later the app had cleaner navigation, tighter copy and a better-placed paywall. Expensive in tokens but a concrete cross-model review pattern.

cross-modeluidesign-reviewmcp
by EntertainerDear2894 Sep 9, 2026 5/10
workflow Reddit

A Model-Per-Role Split for Running Subagents Without Burning Your Quota

One user's working setup: Fable acts purely as orchestrator (plans, writes specs, spawns agents, integrates results), Haiku scouts for files and symbols and reports locations instead of dumping files, and Sonnet reads docs and source. Keeping the expensive model off grunt work is what keeps usage sane. Practical counterpoint to the common complaint about subagent cost.

subagentsorchestrationcostmodels
by Smbridges91 Sep 9, 2026 7/10
workflow Reddit

Claude Code Prompt-Cache Bugs Confirmed in the Changelog

A rundown of prompt-caching bugs Anthropic has since fixed, citing specific releases: context added after tool results being re-sent uncached every turn, changing effort mid-session invalidating the cache, and agent teammates re-sending tool and skill definitions. Explains why orchestrator-heavy workflows saw extreme usage. Worth reading if your token consumption spiked recently.

prompt-cacheusagetokenschangelog
by AironParsMan Sep 9, 2026 6/10
workflow GitHub

ledger: An Engineering Ledger Where Every Agent Claim Can Be Checked

Records claims made about an agent-authored codebase as ledger entries, each one verifiable rather than taken on trust. Targets the failure mode where an agent says a thing is done and nothing in the repo proves it. Gives reviewers a checkable trail instead of prose summaries.

verificationauditclaimsprovenance
by qbs784 Sep 9, 2026 6/10
workflow GitHub

postbag: Two Agent Sessions Exchanging Letters Through Native Doors

Lets any two Claude Code or Codex sessions pass messages to each other under a human-set budget, using native mechanisms with no daemon, polling or hooks. Stdlib Python only. A notably simple answer to inter-session communication compared to full orchestration frameworks.

multi-agentipcpythoncoordination
by parasxos Sep 9, 2026 7/10
workflow GitHub

agent-standards: One Checkout Drops a Shared AI Setup Into Any Project

A single git checkout installs a common agent configuration — skills, subagents, MCP servers and OpenSpec scaffolding — across Claude Code, Kilo, OpenCode, Codex and Copilot. Keeps a team's conventions consistent without hand-copying config into every repo. Tool-agnostic by design.

standardsconfigmulti-toolscaffolding
by Lukk17 Sep 9, 2026 6/10
workflow GitHub

fast-deployment-execution: A Deployment Skill With One Release Owner

A deployment workflow for Codex and Claude Code built on four constraints: a single release owner, a fixed artifact, bounded execution, and verification of what actually landed. Prevents the common failure where an agent deploys something subtly different from what was tested. Applies to any stack.

deploymentreleaseverificationci-cd
by ShiYuPro Sep 9, 2026 6/10
workflow Reddit

Can You Stop CLAUDE.md From Loading Into a Custom Subagent?

A developer building a text-evaluator subagent wants it to judge text with nothing but a rubric in context, but only Explore and Plan skip the CLAUDE.md hierarchy and there is no frontmatter field to opt out. Thousands of tokens of coding conventions leak into every evaluation and could skew scoring. A real limitation worth knowing before you build judge-style subagents.

subagentsclaude-mdcontextevaluation
by Naht-Tuner Sep 9, 2026 6/10
workflow GitHub

dual-audit: Bounded Multi-Round Review Between Claude and Codex

Runs a review across two different models where round one is genuinely independent, so neither model anchors on the other's conclusions. Failures stay loud and cannot quietly become an approval in a later round. Directly targets the rubber-stamping problem in agent code review.

code-reviewcross-modelauditverification
by ttomasyoung Sep 9, 2026 7/10
workflow GitHub

agent-harness-workshop: Audit Your Agent Harness With Real Session Evidence

A hands-on workshop that walks through auditing an AI coding agent's harness using actual session transcripts: group the failures, analyze them, implement a fix, document it, then validate. Teaches a repeatable method rather than handing over a config. Good material for a team session.

harnessworkshopevidencedebugging
by JurreBrandsen1709 Sep 9, 2026 6/10
workflow GitHub

aifactory: A Ticket Goes In, Agents Build It in an Isolated Proxmox VM

A self-hosted software factory where agents plan and implement inside a dedicated Proxmox VM, code-defined gates run automatically, and humans only review at the end. The VM isolation means a runaway agent cannot touch anything outside its sandbox. One of the more complete takes on unattended agent delivery.

automationproxmoxsandboxciunattended
by akkijp-oss Sep 9, 2026 7/10
workflow GitHub

geekstack-flow: Wiki Memory, Task Lifecycle and Risk-Tiered Governance

A structured workflow spanning planning, coding, review, testing and shipping, built on an LLM wiki memory, an explicit task lifecycle, and governance rules that scale with risk. Ships a local cockpit that runs Claude Code, Codex or Copilot agents. More opinionated than most workflow packs.

workflowgovernancememorycockpit
by bibennurbani Sep 9, 2026 6/10
workflow GitHub

roster: An Agent-Run Organisation Where Each Staff Member Is a Repo

Every staff member is an AI whose brain is a GitHub repository containing a charter, a memory, and a scheduled session that does a day's work unattended and hands off to the next. Uses GitHub itself as the coordination substrate rather than a bespoke orchestrator. An unusually complete take on persistent, scheduled agent teams.

multi-agentgithubscheduledunattendedmemory
by Nano-Collective Sep 9, 2026 7/10
workflow GitHub

agents: Multi-Agent Harness With Token Shunting Guard and 16 Domain Skills

A multi-agent orchestration harness bundled with 16 domain-driven skills for Next.js, NestJS, and design systems. Its notable piece is a deterministic token shunting guard that controls how context is routed between agents instead of leaving it to the model. Worth a look if you are building a stack-specific agent fleet.

workflowmulti-agentorchestrationnextjsnestjs
by lucaszhh Sep 9, 2026 7/10
workflow GitHub

AI_GAME_QA_TestCase: Deterministic Game QA Test Case Pipeline

A game QA pipeline (tc-team) that auto-generates test cases following the ISTQB test process. Its design choice is that deterministic code, not the model, owns the structure, quality gates, and coverage ledger, with the LLM handling only generation. A reasonable pattern to borrow for any agent workflow where you need auditable coverage. Documentation is in Korean.

workflowqatestingistqbpipeline
by nobles92ts-ship-it Sep 9, 2026 6/10
workflow GitHub

busybees: A software factory of Claude Code sessions driven by GitHub issues

Turns a GitHub repo into an autonomous development pipeline: issues and labels dispatch Claude Code sessions, which do the work and open pull requests. Labels act as the control plane, so you queue work the same way you already triage a backlog. Worth a look if you want agent orchestration that lives entirely inside GitHub rather than a bespoke runner.

orchestrationgithubautomationpull-requests
by kpenfound Sep 9, 2026 8/10
workflow GitHub

dev-env: Spec and standards for a local-first code-quality workflow

Documentation-only repo defining a local-first code-quality and Claude Code workflow system — the specification, standards, and reference material rather than the tooling itself. Describes how quality gates and agent workflows should fit together on a developer machine. Useful as a written baseline if you are formalizing your own agent conventions.

standardscode-qualitylocal-firstdocumentation
by smartwatermelon Sep 9, 2026 5/10
workflow Reddit

microservice.md: A living one-page memory file for every microservice

An architect coming from Cursor used Claude Code to build microservice.md, a convention where each service carries a MICROSERVICE.md describing its purpose, owner, APIs, events, dependencies, data, SLOs, patterns, and security. The file lives beside the code and evolves with it, giving any AI coding tool precise service context. Doubles as material for architecture reviews and documentation.

documentationmicroservicesarchitecturecontext
by waxman555 Sep 9, 2026 6/10
workflow GitHub

jvsl.monorepo.agents.template: Reference Monorepo with an RFC to Gherkin to Code Pipeline

A worked example of a monorepo already wired for agent pairing: it ships pairing modes, project rules, and a pipeline that moves work from RFC through Gherkin scenarios into code. It builds on a companion code-server dev-container template. Useful mainly as something to read before designing your own agent scaffolding.

monorepotemplategherkinrfcdevcontainer
by TheHefty Sep 5, 2026 5/10
workflow GitHub

Models-Cowork: Task Assignment and Proof-Checked Handoffs Across Five Agent Tools

A coordination layer for running several AI coding models on the same codebase, handling task assignment, conflict prevention when two agents touch the same files, and handoffs that must carry proof of completion. It spans five different agent tools. Worth reading if you have hit merge conflicts between parallel agents.

multi-agentorchestrationcoordinationhandoffconflict-resolution
by leanneexperimental3016 Sep 5, 2026 6/10
workflow GitHub

idea-research: Adversarial Research Agents That Stress-Test a Startup Idea

Runs two research agents against the same startup idea — one trying to kill it, one trying to find the wedge — and reports whether it is worth building. Output is plain English and the market framing is India-first, making it a concrete example of adversarial multi-agent evaluation.

researchmulti-agentadversarialstartup
by rishabhrawat35 Sep 5, 2026 6/10
workflow GitHub

metodoloji: BMAD Methodology Plugin with Mechanical Gates and 123 Skills

Implements the BMAD methodology as a plugin for OpenHands and Claude Code, enforcing a record chain (E to IR to SP to S to QR to PR) through mechanical gates rather than prose instructions. Bundles 123 skills covering the steps, for teams that want an agent workflow with auditable stage transitions.

bmadmethodologygatesworkflowopenhands
by yunusgungor Sep 5, 2026 6/10
workflow Reddit

Prompt-Cache Regression in Claude Code 2.1.252 and What the Fix Changed

A community analysis of GitHub issue #91707, which measured prompt-cache misses jumping from 7.2% in Claude Code 2.1.224 to 29.2% in 2.1.252 across ~5,300 turn boundaries. The poster estimates the recent fixes cut unnecessary input usage substantially in long, tool-heavy agentic sessions. Useful if you pinned an older CLI version and are wondering why your 5-hour limit drained fast.

token-efficiencyprompt-cacheclaude-code-versionsusage-limits
by AironParsMan Sep 5, 2026 7/10
workflow Reddit

Scripted Automated Compaction Inside Driver Skills

A write-up of an end-to-end development workflow built from 'driver skills' that dispatch to subagents to take a plan or issue from refinement through execution, review, and pull request. The key change is that context is no longer compacted between steps such as execution and review, which the author found made agents notably more coherent — at the cost of higher token use.

workflowsubagentscompactioncontext-management
by EC36339 Sep 5, 2026 7/10
workflow Reddit

focus.md: A Single File That Survives Compaction Anxiety

A plain convention rather than a skill: at the start of a session the model writes all tasks and important decisions into focus.md, so nothing is silently lost when context compacts. Setup is one line — add 'read focus.md' to your CLAUDE.md or AGENTS.md. Small, tested over several months by the author.

context-managementclaude-mdplanningcompaction
by igordata Sep 5, 2026 7/10
workflow GitHub

GeeLo: Hands-Off Google Earth Engine Development Loop for AI Agents

A workflow where the agent writes a Google Earth Engine script, runs it against a real server from your machine, reads the feedback, and fixes itself before delivering anything. Works with Claude Code, Codex, Cursor, and Gemini CLI. Removes the manual copy-run-report loop that normally makes GEE scripting painful to automate.

google-earth-engineself-verificationgeospatialautomation
by xulogin Sep 5, 2026 6/10
workflow GitHub

AI-DEV-OS: Reusable Framework for Context, Rules and Agent Workflows

A Vietnamese-language scaffolding kit that organizes context, rules, workflows, documentation, skills, and templates into one reusable structure for working with AI coding agents. Drop it into a project instead of reinventing the same directory conventions each time.

frameworkcontext-managementtemplatesvietnamese
by ngduydu Sep 5, 2026 5/10
workflow GitHub

great_cto: Claude Code as a 70-Agent Pipeline With Cross-Model Gates

Runs Claude Code as a pipeline of 70 specialist agents where an independent model verifies each stage before the next one builds on it. Spending caps refuse rather than warn, and three decisions stay with you: what gets built, how, and whether it ships.

orchestrationmulti-agentverificationspending-caps
by avelikiy Sep 5, 2026 6/10
workflow GitHub

Guildwork: Governance Kit for Running Parallel AI Coding Agents

Contracts, forms, shared vocabulary, and tool specifications for coordinating multiple coding agents at once — with the incidents that motivated each rule documented alongside it. The incident log is what makes it more useful than a generic conventions doc.

governanceparallel-agentsconventionsincidents
by Simon-Pacifae-Dupont Sep 5, 2026 6/10
workflow GitHub

overseer-kit: Portable Handover, Roadmap and Freeze-Review Kit

A governance kit you inject into any repository with `ok init`, providing handover documents, a roadmap structure, and a freeze review step before shipping. Portable across projects rather than tied to one stack.

governancehandoverroadmapportable
by aaronrene Sep 5, 2026 6/10
workflow GitHub

badi: Workflow CLI With 30 Agents, 84 Commands and 62 Skill Categories

A workflow management CLI for Claude Code, Cursor, and Gemini CLI, shipping 30 agents including a virtual engineering team, 84 commands, and 62 skill categories. Broad rather than focused; useful if you want a large prebuilt surface to trim down.

cliworkflowagentscommands
by fatihkan Sep 5, 2026 5/10
workflow GitHub

ai-stp: Build, Verify, Store and Install Complete AI Harness Setups

A CLI whose primary consumer is your agent rather than you: it builds, verifies, stores, selects, and installs whole harness configurations, so a setup can be reproduced on a new machine or project as a unit.

harnesscliconfigurationreproducibility
by ai-engineers-guild Sep 5, 2026 5/10
workflow GitHub

vibe-coding-prompt-template: PRD, Tech Design and MVP Templates

Templates and a workflow for generating product requirement documents, technical designs, and MVP scopes with LLMs inside AI-native IDEs. Useful as a starting structure if your planning prompts are ad hoc.

templatesprdplanningprompts
by KhazP Sep 5, 2026 5/10
workflow GitHub

PXOS: Framework-Agnostic Operational Layer Against Agent Amnesia

PXOS positions itself as an operating layer for AI-assisted product and software engineering, focused on keeping agents from losing context between sessions and from burning tokens re-reading the same ground. It is framework-agnostic rather than Claude-Code-specific. The repo description is high-level, so expect to dig into the source to judge how much of the structure is actually enforced.

context-managementagent-memorytoken-efficiencyframework-agnostic
by madebypx Sep 5, 2026 5/10
workflow GitHub

supergraph: Enforced Planning, TDD and Review for Coding Agents

An engineering workflow system that makes planning, test-driven development, verification and review mandatory steps rather than suggestions, backed by graph analysis of the codebase. Aimed at stopping agents from jumping straight to code.

workflowtddplanningcode-graph
by datit309 Sep 5, 2026 6/10
workflow Reddit

Anthropic's commerce-agents Repo and the Missing Payment Layer

A walkthrough of Anthropic's commerce-agents repo, which ships a Claude Code plugin that scaffolds shopping and merchant agents against your own backend. The author's point is that the flow stops at checkout: an agent that actually pays needs a narrowly scoped payment tool with its own card, allowed-merchant list and spend limits rather than access to a human's main method. Includes a pitch for the author's own gating tool.

commercepluginagent-paymentsanthropic
by NoFunnyMan Sep 5, 2026 5/10
workflow GitHub

maintainer-agent: Unattended Repo Maintainer That Acts Only on Proof

An agent that maintains a single repository without supervision: it reviews, files issues, prunes and merges. Its distinguishing rule is that it only acts when it has proof that a guard actually bites, which is a much stricter bar than the usual 'agent thinks tests passed'. Worth reading for the guard-evidence pattern even if you do not run it.

automationmaintenanceunattendedguards
by vladimirrott Sep 5, 2026 6/10
workflow GitHub

Jira Ticket to Reviewed Playwright PR, Gated by Deterministic CI

An end-to-end test framework where a Jira ticket becomes a Playwright pull request authored by AI agents, mirrored into a test case management system and gated by deterministic CI checks. Built on the saucedemo demo site so it doubles as a reusable template. Shows a concrete division of labour between agents that write and CI that decides.

playwrighttestingcijira
by Diegocortes15 Sep 5, 2026 6/10
workflow Reddit

Cutting Multi-Agent Costs: Haiku Orchestration and a Python State Machine

After finding spec-driven development with multi-agent Claude Code burned more budget on reviewing and re-verifying specs than on writing features, the author inverted the setup: Haiku for orchestration, git work and first-pass QA, Sonnet only for real implementation and hard debugging, and a deterministic Python state machine owning budgets, routing and agent ownership. A concrete answer to runaway orchestration costs.

multi-agentcostorchestrationspec-driven
by son_o_gong Sep 5, 2026 7/10
workflow Reddit

Insulting Your Agents Backfires: Your Words End Up in the Source

After agents started failing tasks more often, the author dug into their project docs and found the agents had been recording exact quotes, including insults thrown at them, straight into source comments and historical notes. The takeaway is practical rather than sentimental: hostile input pollutes the context that later sessions read back.

promptingcontextagent-behaviorlessons
by Fragsworth Sep 5, 2026 6/10
workflow Reddit

Ticket-First Claude Code Workflow With Just Four Repo-Committed Agents

A setup refined over three weeks of daily use that cut 20 subagents down to four, kept in .claude/agents/ so they travel with the repo: a coordinator that only routes, a business analyst that turns ideas into tickets, and a senior engineer that owns the whole stack alone. Every unit of work is a markdown ticket committed before any code, and closing it git mv's the file into done/ in the same commit as the implementation. Worth reading if your agent roster has sprawled and you want the outstanding-work list to be just a folder.

agentsworkflowticketssubagentsprocess
by Potential_Look_8506 Sep 4, 2026 7/10
workflow GitHub

md-agent: File-Based IPC to Point a Team of Claude Code Agents at One Goal

Orchestrates a team of Claude Code agents working toward a single goal, coordinating them through file-based inter-process communication rather than a daemon or socket layer. Because the coordination substrate is plain files, agent handoffs stay inspectable and version-controllable. A good fit if you want multi-agent orchestration without standing up extra infrastructure.

orchestrationmulti-agentipcworkflow
by armoryworks Sep 4, 2026 7/10
workflow Reddit

Measuring the Cost of Preferring Bash Over Read/Edit in Claude Code

A user tracked what happens when agents are nudged to do file work through Bash (cat, grep, sed, heredocs) instead of the native Read/Edit/Write tools, and saw ephemeral agent contexts grow 20-40 percent. Their breakdown: reading via Bash is a win, but heredoc edits ran about 819 tokens each against roughly 546 for a native Edit, because the payload carries both the old and the new text. Useful measured data before adopting a bash-first instruction of your own.

tokenscontexttoolsefficiencybash
by sisif_ Sep 4, 2026 6/10
workflow GitHub

cuckcoder: Kotlin, Android and KMP Harness of Rules, Skills, Hooks and MCP

A complete AI coding harness aimed at Kotlin, Android, Compose, and KMP work, bundling rules, skills, agents, workflows, hooks, and an MCP server. Everything is tuned to the JVM and Android toolchain rather than left generic. A reasonable starting point if Claude Code keeps guessing wrong on your Gradle and Compose conventions.

kotlinandroidcomposekmpmcphooks
by michaelbel Sep 4, 2026 6/10
workflow GitHub

translate-book-arxiv: arXiv Papers Into Book-Quality PDFs

Translates arXiv papers into book-quality PDFs using parallel sub-agents. It reads the LaTeX source rather than the rendered PDF, so equations and the paper's own numbering survive translation.

translationarxivlatexsubagents
by kcy4334-lgtm Sep 4, 2026 6/10
workflow GitHub

application-doc-toolkit: Fact Governance for LLM-Written Documents

Every claim in a generated document must trace to a verified source entry, a scripted lint gates each draft, and reviewers hold no write access. Demonstrated on resumes and cover letters.

governancedocumentsverificationlinting
by Ian-Lo Sep 4, 2026 6/10
workflow GitHub

requirement-orchestrator: Spec-Driven Decomposition With Evidence Gates

Turns a software request into independently verifiable units of work under one controlling agent, delegating across Claude and Codex with evidence-gated delivery. A Markdown-only methodology skill with no runtime.

workfloworchestrationspec-drivenverification
by tomtdhzz Sep 4, 2026 6/10
workflow GitHub

harness-template: Agent-First Repo Template With Frontend Governance

An agent-first repository template covering AGENTS/docs governance, frontend engineering conventions (FSD, coding, testing, CI, review), AI tool and memory strategy, and a skill source directory. Ships with a CLI: npx harness-tool init.

templategovernancefrontendcli
by auki-zy Sep 4, 2026 5/10
workflow GitHub

hypoloop: Hypothesizer, Challenger and Verifier CLI Loop

A zero-dependency multi-agent CLI loop with three roles — hypothesizer, challenger, verifier — that runs on agy, codex or claude, whichever you have installed.

workflowmulti-agentcliverification
by flufy3d Sep 4, 2026 6/10
workflow GitHub

ai-second-opinion: Send One Document to a Panel of Models

Sends a single document to Spark, Codex, Gemini, Kimi, Qwen and others at once, highlights where they disagree, and mechanically verifies that each actually did the research rather than inventing sources.

workflowmulti-modelreviewverification
by igorsaevets Sep 4, 2026 6/10
workflow GitHub

OPS: An Operator's Shell Harness Template for Claude Code

An opinionated Claude Code harness template built around foreman orchestration, git-synced memory, session-survival discipline, a multi-agent fleet and a first-launch bootstrap.

harnessorchestrationmemorytemplate
by Exploitacious Sep 4, 2026 6/10
workflow GitHub

auto-task: Turn Units of Work Into Shippable Code

An opinionated agentic workflow that takes well-defined units of work through to shippable code with minimal human input.

workflowautomationdelivery
by patforna Sep 4, 2026 5/10
workflow GitHub

clybor-claude-tooling: A 19-Agent Adversarial Review Bootstrap

A drop-in .claude/ tree with a 19-agent adversarial review team, a Ralph Loop, dev-flow skills and an init script. Project-agnostic and ready to bootstrap a new repo.

bootstrapreviewmulti-agenttemplate
by shawnclybor Sep 4, 2026 6/10
workflow GitHub

maestro (abmach): Plan, Parallel-Implement, Test, Document

An Agent Skills bundle giving coding agents a four-stage workflow: plan, implement in parallel, test, then document. Works with Oh My Pi, Claude Code and OpenCode.

skillsworkflowparalleltesting
by abmach Sep 4, 2026 6/10
workflow GitHub

claude-multi-agent-dev: One Session as a Team, Coordinated by GitHub

A Claude Code template that splits one session into Lead, Frontend, Backend, UI/UX and QA agents coordinating through real GitHub issues and pull requests, with a local orchestration dashboard.

templatemulti-agentgithuborchestration
by dzikrisyairozi Sep 4, 2026 7/10
workflow GitHub

jckeen/dotfiles: One-Command Setup for Claude Code and Codex

A one-command jumpstart on macOS and WSL2 covering slash-command skills, a multi-agent review orchestra, safety hooks, multi-session tooling, a status line and auto-hygiene. Opinionated defaults so the setup is not something you have to remember.

dotfilessetuphooksskills
by jckeen Sep 4, 2026 6/10
workflow GitHub

coverloop: One Model Builds, Independent Models Review

A multi-agent coding loop where one model implements, independent models review from different angles, tests decide, and you hold the final gate. Privacy-enforced, anti-drift and self-improving.

workflowmulti-agentreviewtesting
by danielsimisi-coder Sep 4, 2026 6/10
workflow Reddit

Ask Claude What It Needs to Run Faster on Your Machine

Asking the agent directly what would speed it up surfaced stale Rosetta tooling, a Python on PATH missing zoneinfo, and a missing incremental type-check flag. Fewer errors more than raw speed was the payoff.

performancetoolingprompting
by TaskPile_app Sep 4, 2026 5/10
workflow Reddit

Why You Shouldn't Let Claude Set Your Mac's Clock to 4026

A cautionary account of running a suggested sudo systemsetup and date command without reading it, and the damage that followed. A concrete argument for reading agent-suggested privileged commands before pasting them.

safetymacossudocautionary
by deeplycuriouss Sep 4, 2026 6/10
workflow Reddit

Claude Code v2.1.259 Appends Co-Authored-By and a Session Trailer

A user reports a system-level attribution policy in v2.1.259 that overrides standing CLAUDE.md instructions against co-author trailers, and adds a Claude-Session line that makes commits externally linkable to sessions.

gitcommitsattributionrelease
by vdavid Sep 4, 2026 6/10
workflow Reddit

A Prompt Template for a Proper Pre-Launch Security Audit

A solo developer shipping a Next.js and Payload commerce app ran one large audit prompt in a fresh session with the dev stack running, and got back a findings report plus a session-by-session remediation plan. Two findings were serious enough to have delayed launch. Template included.

securityauditpromptnextjs
by SoloDevSage Sep 4, 2026 7/10
workflow Reddit

Two Ways to Count Output Tokens, Two Very Different Answers

Claude Code writes every session to JSONL under ~/.claude/projects/, and one assistant response can span several lines that each repeat the same usage block. Counting naively double-counts — the author got 59.5M one way and 20.6M the other, which matters for every third-party usage tool.

tokensusagejsonlmeasurement
by ClaudeCdGuy Sep 4, 2026 7/10
workflow Reddit

Routing by 'Does This Step Decide Anything?' With a Local 27B

A multi-agent routing matrix in pi.dev on a 200k+ LOC legacy app, classifying every task by whether it makes a decision rather than by difficulty. The author argues a local Qwen3.8-27B can absorb the non-deciding work that mid-tier models used to do, while frontier models keep the decisions.

routinglocal-llmmulti-agentcost
by Short_Regular_7191 Sep 4, 2026 5/10
workflow Reddit

Has Anyone Run Anthropic's AI-Native SDLC Playbook for Real?

A discussion of Anthropic's published AI-Native SDLC playbook, whose loop chains version-controlled artifacts — intent.md to spec.md to plan.md to code and tests to PR findings — each feeding the next stage. The thread asks for experience reports from real projects.

sdlcworkflowanthropicspec-driven
by Interesting-Yard-684 Sep 4, 2026 6/10
workflow Reddit

Auto Mode Tells Agents to Use Bash Instead of Read/Edit/Write

While investigating an agent stalled for eight hours on an approval prompt, a user found the auto-mode system prompt instructing the agent to prefer cat, grep, sed and heredocs over the dedicated Read, Edit and Write tools. Worth knowing if your permissions or hooks assume the dedicated tools.

auto-modepermissionssystem-promptbash
by reach4thelaser5 Sep 4, 2026 6/10
workflow Reddit

A Handoff-Document Routine for Getting Opus 5 to Behave

Write a handoff document with a cheap model on low effort, clear context, switch to Opus 5 on high effort, then prime with CLAUDE.md and the handoff before any real work. The author also runs every root-cause analysis and plan past an advisor.

workflowhandoffcontextprompting
by cephas1784 Sep 4, 2026 6/10
workflow Reddit

Keeping Claude Code Config Alive Across Replit Container Restarts

A short script that symlinks ~/.claude to a workspace-persistent directory, so logins and session context survive the Repl container being wiped on restart. No polling or copy-on-boot dance — every Claude read and write hits persistent storage directly.

replitpersistenceconfigshell
by Careful_Lock_2685 Sep 4, 2026 6/10
workflow GitHub

agent-chassis: Contract-First Orchestration for Long-Running Coding Agents

An orchestration layer built around scoped work records, local dispatch, review evidence, and enforcement provenance. Aimed at agent runs long enough that you need proof of what was checked, not just a final diff.

orchestrationgovernancelong-runningreview
by agent-chassis Sep 4, 2026 6/10
workflow Reddit

A verify Skill That Independently Checks What Claude Said Was Done

Written after the author spent two hours a day manually clicking through features that had green tests. The skill runs a separate verification pass against the spec, on the premise that the model which wrote the code also wrote the tests, so of course they pass.

verificationqatestingskill
by lucifer605 Sep 4, 2026 6/10
workflow Reddit

Ratchets: Baseline Existing Debt, Fail the Build Only on New Debt

A senior engineer who has not hand-typed code all year describes the guardrails that kept agents from rotting the codebase. Existing debt is baselined and ignored; new debt or a worsening baseline fails, and the error hands the agent the exact line and fix without revealing that the baseline file could be edited.

tech-debtciguardrailshookscode-quality
by svet07 Sep 4, 2026 7/10
workflow Reddit

Why Auto Mode Started Asking Permission for cat, grep, and rg in 2.1.257

Any Read(...) entry in permissions.deny — not just a wildcard, and in any settings file — triggers the new cd-compound-read check added in 2.1.257, which is why basic searches suddenly prompt in auto mode. The author diffed the 2.1.252, 2.1.258, and 2.1.259 binaries to confirm the cause, and removing the deny entry resolves it.

permissionssettingsauto-modetroubleshooting
by tulensrma Sep 4, 2026 8/10
workflow GitHub

prismatic-majordomus: One Policy, Generated Instructions for Every AI Tool

A supervisory control layer that keeps a single policy, generates the per-tool instruction files from it, holds durable task state, and ships a doctor command that proves the enforcement you declared is actually wired up.

policygovernanceinstructionstask-state
by korczis Sep 4, 2026 6/10
workflow Reddit

Two Months Building a Claude Code Workflow That Carries State Between Sessions

The author leaned on obra/superpowers and mattpocock/skills for a long time, but found they handled discrete tasks well and never covered taking a project from raw idea through design into production — no way to carry state between sessions, no framework for building a knowledge base out of actual work. Brainstorming a project spans days and multiple sessions, and context died at each boundary. Two months in, still building the thing that fills that gap.

workflowstateknowledge-basesessions
by IndieDev666 Sep 3, 2026 6/10
workflow GitHub

revloop: Branch, PR, AI Review, Fix, Merge — On a Loop

A reviewer-agnostic loop that takes a branch through PR, AI review, fixes and merge, then repeats. Works with either Claude Code or Codex as the reviewer, so you aren't locked to one harness for the review step.

reviewpull-requestloopautomation
by iwmaeda Sep 3, 2026 7/10
workflow GitHub

buildcrew: 11 Specialized Claude Code Agents With 9 Operating Modes

An auto-orchestrated team of 11 specialized subagents for Claude Code, switchable across 9 operating modes depending on what kind of work is in front of it. For people who want a preassembled agent roster instead of defining their own.

subagentsorchestrationmulti-agentteam
by z1nun Sep 3, 2026 6/10
workflow GitHub

veriloop: Spec-Grounded Code Review and Repair Loops

Runs review-and-repair loops that are anchored to a spec rather than to the agent's own opinion of the code, for both Codex and Claude Code. The spec grounding is the point: it gives the loop a fixed target so it converges instead of churning.

reviewspec-drivenloopverification
by dev-geon Sep 3, 2026 6/10
workflow GitHub

PraxFlow: Composable, Evidence-First Engineering Workflows as Agent Skills

Engineering workflows packaged as portable Agent Skills, built around requiring evidence at each step rather than trusting the agent's claim that a stage is done. Composable, so you assemble the pipeline you need.

workflowskillsevidenceverification
by hamburger-os Sep 3, 2026 6/10
workflow Reddit

100 Rounds of Subagent Bug Hunting and It Still Finds New Bugs

A simple loop: point it at a page, and each round spawns a fresh batch of subagents to crawl it for bugs. About 100 rounds and roughly 30-40 minutes per round in, it has never once come back empty. Raises a real question about when an agent bug hunt is actually done versus just generating findings.

subagentsbug-huntingqaloop
by Hackerman07 Sep 3, 2026 5/10
workflow GitHub

ai-software-architect: ADRs and Architecture Reviews as a Claude Plugin

An architecture documentation framework built around ADRs and structured reviews, with a pragmatic mode for when full ceremony isn't warranted. Now packaged as a Claude Code plugin for one-step installation.

architectureadrplugindocumentation
by codenamev Sep 3, 2026 6/10
workflow Reddit

Source Context Is Not Runtime Context: The Frontend Gap in Agent Coding

Agents explore repos well but can't see runtime state, so for UI work they guess at rendered output, the selected element, console and dev-server logs, the current route and the HMR result after an edit. Playwright helps but costs a lot of tokens and is non-deterministic. Written by the author of Frontman, which is their attempt at closing the gap — the framing of the problem stands on its own.

frontendruntime-contextdebuggingui
by Firm-Space3019 Sep 3, 2026 5/10
workflow GitHub

loop-flow: An SDD Workflow Skill With Async Verification for Fake Done

A spec-driven development workflow skill with loop-engineering async verification, built specifically to catch the case where the model believes it implemented something it didn't. The author's use case: write the plan, hit enter, walk away. Note it's token-hungry — they suggest planning with a strong model and executing with a cheaper one, and it ships without per-platform adaptation.

workflowsddverificationskill
by Li-john1021 Sep 3, 2026 5/10
workflow Reddit

A 7-Month Claude Code Setup: 19 Hooks, 36 Skills, All From Real Incidents

A full public writeup of a setup built over 151 days across ~140 projects, structured as five layers: instructions, hooks, skills/plugins, agents and model routing, and the memory/learning loop. Every hook is introduced by the incident that produced it — a subagent killing a real Notepad with 40 unsaved tabs led to blocking kills by image name; a backgrounded dev server leaking 663 tsserver children and 13.6 GB of RAM led to a watchdog that reaps orphans. Repo is public.

hooksskillssetupconfiguration
by SIGH_I_CALL Sep 3, 2026 8/10
workflow Reddit

War Story: Reviewing AI PRs When the Author Already Left the Building

A reviewer's account of why AI-generated PRs are harder to review than a teammate's, even when the diff is smaller: with a human author you could ask why this way, what they tried first, which edge cases they weighed — half of review was loading their reasoning into your head. With an agent PR, that context never existed for anyone. A clear articulation of a problem most teams are now hitting.

code-reviewprocesspull-requestteam
by ElkEmpty6424 Sep 3, 2026 6/10
workflow Reddit

Beating the 20x Plan Limit: Fable Plans, Cheaper Models Execute

One approach to hitting session limits an hour in on the 20x plan: use Fable 5.1 purely as the planner, never letting it touch code, then hand the strict plan to Opus 5, 4.8 or 4.6 to implement. The author's claim is that with a good enough plan those three perform about the same, so the expensive model's budget goes entirely into planning.

model-routingsession-limitsplanningcost
by Plastic-Main3460 Sep 3, 2026 6/10
workflow GitHub

loam: A Copier Template That Bootstraps Agent-Optimized Project Setups

A Copier template that stands up AI-agent-optimized project scaffolding: layered context routing, a curated skill set and an enforced validation gate, kept in sync across projects as the template evolves.

templatescaffoldingskillsvalidation
by SamyakJhaveri Sep 3, 2026 6/10
workflow GitHub

multi-agent-playbook: Field-Tested Methodology for Multi-Agent Collaboration

A bilingual (Chinese/English) playbook of multi-agent collaboration patterns drawn from real projects: splitting design work from execution, governing which skills agents may use, prompt engineering, and general engineering discipline. Aimed at people running several agents on one codebase and hitting coordination problems.

multi-agentmethodologyprompt-engineeringorchestration
by free1988-design Sep 3, 2026 6/10
workflow GitHub

TRACE: Auditing Decision Provenance in AI-Assisted Science

A protocol for recording and auditing which decisions in a scientific workflow came from a human and which came from an AI agent. Targets reproducibility and review needs in research settings. Early-stage, but the provenance problem it names applies well beyond science.

provenanceauditresearchprotocol
by Thru-Echoes Sep 3, 2026 5/10
workflow GitHub

codex-claude-companion: Read-Only Opus Review Lanes Inside Codex

A Codex-native plugin that calls Claude for code review in read-only lanes with evidence citations required for each finding. Keeps the reviewing model separate from the writing model. Relevant if you run Codex as the author and want a second opinion that cannot edit.

reviewcodexcross-modelplugin
by Kenmege Sep 3, 2026 6/10
workflow GitHub

musterd: Persistent Agent Teams Across Any Harness or Model

A shared communication protocol that lets agents and humans form persistent teams spanning different harnesses, frameworks, models, and surfaces. Aims at the case where your agents live in incompatible tools and cannot address each other. Ambitious scope; worth watching if you run mixed-vendor agent setups.

multi-agentprotocolteamsinterop
by SandRiseStudio Sep 3, 2026 6/10
workflow GitHub

drydock: Wave-Based Parallel Execution With Disjoint File Ownership

A plan-first workflow for Claude Code: write a rigorous plan document, then execute it in waves of subagents where each owns a disjoint set of files. Conformance gates check the result against the plan and a reconcile loop fixes drift before anything merges.

parallelsubagentsplanningverification
by SandeepTakasi Sep 2, 2026 8/10
workflow GitHub

productizer: Requirements Tracking Where a Contradiction Stops the Work

Keeps one living spec per product and classifies every new intent against everything already agreed. When a new request contradicts a prior decision, the work halts instead of quietly merging conflicting requirements.

requirementsspecsplanninggates
by gitayg Sep 2, 2026 7/10
workflow GitHub

A Protocol and File Channel for Codex and Claude Code on One Mission

Two skills plus a file-based message channel that let Codex and Claude Code work the same task without overwriting each other. Defines a handoff protocol so each agent knows what the other has claimed.

codexmulti-agentprotocolcoordination
by Nacha192 Sep 2, 2026 6/10
workflow GitHub

specbind: Keep Durable Specs Bound to Delivery From Intent Through Release

Maintains the link between a written specification and the agent-assisted work that implements it, across the whole path from intent to release. Aimed at stopping specs from becoming stale artifacts once implementation starts.

specsdeliverytraceability
by Huruikagi Sep 2, 2026 6/10
workflow Reddit

Building a 4.7k-Star OSS Tool With Claude Code Without Knowing Python

A detailed retrospective on building sqlit, a lazygit-style SQL TUI, entirely through Claude Code with no prior Python experience. Covers the workflow that kept the code from becoming slop, and how asking the agent where to launch led to a Hacker News front page.

case-studyworkflowpythonoss
by Maxteabag Sep 2, 2026 7/10
workflow GitHub

multi-review: Fan a PR Diff to Several AI Reviewers and Reconcile One Report

Sends a pull request diff to agy, codex, copilot and cursor in parallel, adds Claude's own pass, then de-duplicates and severity-ranks the findings into one line-validated review. Installable as a Claude Code plugin.

code-reviewpull-requestsmulti-modelplugin
by Hyeonu-Cha Sep 2, 2026 8/10
workflow GitHub

pairmark: Race Claude Code Against Codex on the Same Task in Your Own Repo

Runs both agents on an identical task in your repository, collects evidence first, has blind judges score the results, and emits one shareable report. A way to answer which tool is better for your codebase rather than a benchmark's.

benchmarkcodexevaluationcomparison
by Hemanshu-Upadhyay Sep 2, 2026 7/10
workflow Reddit

Running DeepSeek in One Claude Code Session and Opus in Another, Talking

A short report on pointing one Claude Code session at DeepSeek while keeping another on Opus, then using session messaging to make them collaborate. A cheap way to keep the harness while mixing in cheaper models when limits bite.

multi-modeldeepseeksessionscost
by rubanbhatia Sep 2, 2026 5/10
workflow GitHub

codeservo: A Deterministic Control Loop Where Gates Decide, Not the Agent

Wraps AI-generated changes in a control loop: the agent proposes, and gates, sensors and an independent review decide whether the change lands. Every run leaves verifiable evidence of why it passed or failed.

gatesverificationcontrol-loopreview
by jeanjerome Sep 2, 2026 7/10
workflow GitHub

disciplined-code-changes: Guardrails Against How AI Code Assistance Fails

A Claude Code plugin encoding engineering guardrails aimed at the specific ways AI assistance commonly goes wrong — scope creep, unverified claims, and silent rewrites. Prescriptive rather than a general style guide.

guardrailsdisciplinepluginquality
by egkz Sep 2, 2026 6/10
workflow Reddit

Fanning a Document Harness Into Parallel Agents, and the Token Cost Question

A report on parallelizing the discovery phase of a document-generation harness into separate geometry, content and asset agents. The key fix was joining on actual completion rather than file existence, after a pipeline continued on a half-written file and produced valid-looking garbage.

parallelsubagentstokenspipelines
by demchaav Sep 2, 2026 6/10
workflow GitHub

scout-plugin: Daily Briefing That Cross-Checks Slack, Gmail, Calendar and Linear

An autonomous Claude Code briefing that pulls from Slack, Gmail, Calendar, Linear and GitHub and cross-references them, so items that appear in one place but not another get flagged. Emphasis is on trusting what it surfaces, not just summarizing.

briefingautomationintegrationsplugin
by Raven-Scout Sep 2, 2026 7/10
workflow GitHub

herdr-hybrid: Smart Model Leads, Cheap Models Do the Work in Parallel Windows

A Chinese-language hybrid orchestration setup for Claude Code on herdr: one config for gateway, keys and models; the leader decomposes, accepts and reviews; headless workers implement in parallel, each in its own herdr window.

orchestrationcostchineseparallel
by wangfan1998-github Sep 2, 2026 6/10
workflow Reddit

A Parallel Orchestrator Where Truth Comes From the Diff, Not Agent Reports

Four rules for a parallel task orchestrator, the sharpest being that a subagent claiming it changed four files is making a claim, not providing evidence — the repository is the only source of truth. The author is openly unsure about the rule that refuses to parallelize.

orchestrationparallelverificationsubagents
by Hour-Measurement-835 Sep 2, 2026 7/10
workflow Reddit

The Always-On Linux Box Setup That Ends Carrying Your Laptop Half-Open

A practical writeup on moving long Claude Code sessions off the laptop: why Caffeine and cloud sandboxes both fail, and what a plain always-on VPS plus a bit of glue actually needs to feel like your local machine.

remotevpssessionssetup
by Hudsonlovestech Sep 2, 2026 6/10
workflow GitHub

harness-lens-reviewer: Grade an LLM Reviewer Against Labeled Specimens

A meta-evaluation harness that scores how well an LLM review pass actually detects planted defects, using labeled specimens. Answers whether your reviewer agent is finding anything, not just producing findings.

evaluationcode-reviewjapanesemeta
by hatohato-lab Sep 2, 2026 5/10
workflow Reddit

Declare Your Subagent Model or Fable Will Silently Spawn More of Itself

Subagents inherit the parent model by default, so a Fable session quietly runs multiple Fable subagents and burns the weekly allowance fast. Setting the subagent model explicitly in settings.json — and again inside skills — is reported as the single biggest usage reduction.

usagesubagentssettingscost
by LordeLucifer Sep 2, 2026 7/10
workflow Reddit

Does Model Diversity Help Multi-Agent Verification? 720 Runs Say Maybe Not

A pre-registered experiment testing the common intuition that confirmations from different base models are worth more than confirmations from the same one. The author ran 720 evaluations, failed their own kill condition, and published the design asking where it breaks.

evaluationmulti-agentverificationresearch
by JadaLovelace Sep 2, 2026 8/10
workflow Reddit

Keeping Test Runs From Eating All Your Tokens During Bug Fixes

A writeup of how uncontrolled test output during debugging loops drives token burn, and what changed after the author identified and fixed it. Reported as a major reduction in consumption, particularly during bug fixing.

tokenstestingcostdebugging
by polacrilex67 Sep 2, 2026 6/10
workflow GitHub

ai-engineering-playbook: Rules and Role Separation for Teams in Production

A practical playbook for AI-assisted engineering in production codebases, covering rules, separation of roles between human and agent, and guardrails. CC BY 4.0, written around Cursor and Copilot but largely tool-agnostic.

playbookteamsguardrailsprocess
by PlanVault Sep 2, 2026 5/10
workflow GitHub

tagteam: Claude and Codex Plan, Implement, Cross-Review and Merge PRs

A multi-agent workflow for Claude Code where Claude and Codex split planning and implementation, review each other's work, and drive the pull request to merge. Full loop rather than review-only pairing.

codexmulti-agentpull-requestsreview
by Smiley73 Sep 2, 2026 6/10
workflow Reddit

Clean-Room README Testing With Two Claude Code Sessions

Claude Code is too good at working around a broken README — it reads package files, searches source, and infers intent, which makes it a terrible onboarding test. The fix is an installer session given a disposable clone and one rule: follow only the public README, adapted from the gr-readme skill.

documentationtestingonboardingreadme
by Full-Mycologist1484 Sep 2, 2026 7/10
workflow GitHub

groundwork (2005sojid): A Gate That Cannot Be Silently Green

A portable working set for agent projects: rules enforced by actual checks, a gate designed so it cannot pass without doing the work, and a script that measures how sessions actually went afterward.

gatesrulesmeasurementworkflow
by 2005sojid Sep 2, 2026 6/10
workflow Reddit

Coordinating Parallel Claude Code Sessions With Close-Out Reports and a Merger

A rebuild of a production app using a fleet of parallel Claude Code sessions on independent feature branches, each ending with a close-out report, plus one dedicated coordinator session that verified and merged to main. Includes what broke and what the author would change.

parallelsessionsgitcase-study
by 21species Sep 2, 2026 7/10
workflow GitHub

convoy: Decompose Work Into a Governed PR Series With Per-Spawn Economy

Breaks a large piece of work into a series of pull requests, drives a coding agent to implement each under an explicit budget, gates and integrates them, and records the cost of every agent spawn. Governance and measurement rather than raw throughput.

pull-requestsbudgetgovernanceorchestration
by grimaldost Sep 2, 2026 6/10
workflow Reddit

Mex: Keeping Markdown Context Files From Rotting as the Codebase Moves

Architecture notes, conventions, runbooks and CLAUDE.md all decay while agents keep reading them with full confidence. Mex is an open-source attempt at markdown context that maintains itself against the code it describes.

contextdocumentationclaude-mdmaintenance
by DJIRNMAN Sep 2, 2026 6/10
workflow GitHub

co-evolution: Two Agent Roles Bounce a Document Until It Converges

Structured refinement where two agent roles pass a file back and forth using explicit disagreement markers until the disagreements are resolved. Agent-agnostic and runs from any terminal.

documentsmulti-agentrefinementconvergence
by alanshurafa Sep 2, 2026 6/10
workflow GitHub

okl: typed, verifiable engineering lessons injected into coding agents

Org Knowledge Layer treats team memories like tests rather than freeform notes — lessons are typed and verified before an agent starts work. It briefs agents fail-closed, gates verification on drift, and records A/B receipts in-repo so you can see whether a lesson actually changed outcomes. Useful for teams trying to stop repeating the same corrections across agent sessions.

workflowmemoryknowledge-managementagentsverification
by emeraldleaf Sep 2, 2026 7/10
workflow Reddit

Running one Claude Code session across all repos from a shared root folder

A developer describes starting every session from a single ~/code root that contains all work repos, giving one agent visibility across services and infrastructure instead of one agent per repo. Work is broken down epic to feature to sub-task, with a worktree per task and cleanup or custom-summary compaction around 300-400k tokens. A concrete counterpoint to the usual one-repo-one-session advice.

workflowmulti-repoworktreescontext-management
by devwannabeme Sep 2, 2026 6/10
workflow Reddit

Fable 5.1 rewrites whole files by default, so prompt it for targeted edits

A warning that Fable 5.1 prefers full-file rewrites over targeted edits, which burns output tokens on small changes, and that its prose runs longer than Fable 5. The fix from Anthropic docs is an explicit system-prompt line telling it to prefer targeted edits. The thread also notes it may need a nudge not to end its turn early on long async work.

fable-5.1tokenspromptingcost
by ___positive___ Sep 2, 2026 6/10
workflow Reddit

Fable 5.1 can spawn forked agents that ignore your default subagent model

A user on the 20x plan hit 100% of the 5-hour limit in 20 minutes because Fable 5.1 spawned four forked agents each running Fable 5.1, despite the default subagent model being set to Opus 5. Fable 5 rarely spawned forks at all. Worth checking your session usage if you have just switched models.

fable-5.1subagentslimitsgotcha
by agentic-consultant Sep 2, 2026 6/10
workflow Reddit

Non-obvious Fable 5.1 SWE findings from the 212-page system card

A careful read of the Fable 5.1 system card surfacing details the headline benchmark table hides. Notably, higher reasoning effort scores worse on FrontierCode Main (50.9% at medium vs 50.3% at max) because the model starts making unrequested scope-creep edits, which the benchmark grades down even as task correctness improves. Adding a brevity instruction reduced the effect.

fable-5.1benchmarksreasoning-effortsystem-card
by rodion-m Sep 2, 2026 8/10
workflow GitHub

delegate-kit: One delegation policy for Claude Code, Codex CLI and T3 Code

A single delegation policy shared across three agent CLIs, covering role-based headless workers, worktree locks so parallel workers do not collide, and cross-vendor review where one tool checks another. A safety-gate hook backstops the whole thing. Aimed at people running several agents at once who want consistent rules.

delegationworktreesheadlesscross-vendor
by tomastaker Sep 2, 2026 7/10
workflow Reddit

claude-vibe-squad: One Chat Orchestrating Five AI Models via Subscriptions

A plain-English orchestrator called Chrono that fronts five models (Claude, Codex, Gemini, Kimi, Grok) plus specialist roles, so non-technical users never pick a model or memorize slash commands. Runs on subscriptions rather than API keys. Latest revision adds Grok and reworks its bounty mode.

orchestrationmulti-modelnon-technicalsubscription
by KnownRequirement8258 Sep 1, 2026 7/10
workflow Reddit

Making Claude CLI Actually Load Karpathy-Style Knowledge Files

Claude CLI silently ignores knowledge-file includes declared in agent and skill files, which breaks the bite-sized Obsidian knowledge approach. The author describes how they get per-agent knowledge to load on demand instead of pulling the whole vault into context.

context-engineeringobsidianagentsknowledge-base
by FirstCompote Sep 1, 2026 6/10
workflow Reddit

A GAN-Inspired Prompt Pattern for Matching a Curated Writing Style

A pure-prompt technique: the orchestrator extracts rules of good output from curated examples, one subagent authors against those rules, and a second subagent acts as discriminator. Useful for making skills or prose match a reference corpus without fine-tuning.

promptingsubagentsstyle-transferquality
by Agreeable-Jelly3736 Sep 1, 2026 6/10
workflow Reddit

Fable Used via /advisor Doesn't Count Against Your Fable Quota

A usage finding: selecting Fable as the advisor through /advisor appears not to draw down the weekly Fable quota. The poster has been pairing Opus with a Fable advisor and reports the advisor catching real issues often enough to be worth it.

quotaadvisorfableusage-tips
by kerbinagent Sep 1, 2026 6/10
workflow Reddit

Auditing Anthropic's Devcontainer Firewall and Building a Tighter Sandbox

A close read of Anthropic's devcontainer firewall finds UDP 53 open to any server, TCP 22 open to any host, no ip6tables rules, and the firewall living inside the same container the agent can reach. The post lays out an alternative setup for running Claude Code autonomously without that trust gap.

securitydevcontainersandboxfirewallautonomy
by Hansehart Sep 1, 2026 7/10
workflow Reddit

Is intent.md the Next Standard Alongside CLAUDE.md, plan.md, and spec.md?

Discussion of Anthropic's AI-native SDLC playbook and its dedicated intent.md file. Frames it as the successor to the metaprompt era of eliciting intent, and asks where it fits among the file conventions teams already maintain.

intent-mdclaude-mdsdlcspec-driven
by freedomachiever Sep 1, 2026 6/10
workflow Reddit

Running Codex Against Claude Code on One Codebase, With a Judge

A VSCode setup where Claude Code drives Codex CLI as a second provider, work is split into engineer/designer/researcher/security/judge roles, and a judge agent picks the winning solution at each step. Both connect through Max-tier accounts rather than API keys.

multi-agentcodexvscodecomparisonjudge
by Puzzleheaded_Cake183 Sep 1, 2026 6/10
workflow Reddit

10,727 Messages of Claude Code History, Counted and Analyzed

The author parsed their full Claude Code history across 343 sessions and tallied both sides: 33% of their own messages contained a correction or complaint, against 1,897 instances of "you're right", 785 admissions of being wrong, and 916 admissions of guessing or inventing something. A concrete look at where agent sessions go wrong.

analysissession-historymetaself-critique
by corozcop Sep 1, 2026 5/10
workflow Reddit

A Handoff Bundle That Cuts Session Resume From 20k Tokens to ~640

Every session began by re-reading the README, config, touched files, and tests — 20k to 60k tokens of re-orientation before any work. This Python package saves findings, open questions, decisions, and evidence anchors pointing at exact files and commits, then loads that bundle instead of re-reading the repo.

context-engineeringhandofftoken-efficiencypython
by SIGH_I_CALL Sep 1, 2026 7/10
workflow GitHub

changerail: OpenSpec Artifacts, Review Gates, and Release Automation

An open toolchain for AI-assisted development that ties OpenSpec artifacts to board-driven delivery, reusable agent skills, review gates, and release automation. Covers the path from spec to shipped release rather than one stage of it.

workflowopenspecreview-gatesrelease
by vlikhobabin Sep 1, 2026 6/10
workflow GitHub

agency: Declarative Arch/CachyOS Bootstrap as an Agent Environment

Declaratively bootstraps an Arch or CachyOS workstation into an operating environment for Codex, Claude Code, and Pi, bundling reusable skills and development workflows with the machine setup.

dotfilesarch-linuxenvironmentskills
by alexogeny Sep 1, 2026 5/10
workflow GitHub

akos: Structuring Tools So Agents Can Safely Operate Them

A method whose unit is the tool rather than the skill — you describe the systems you depend on in a form that lets agents operate them without improvising. Aimed at the gap between a skill knowing what to do and an agent safely touching production tooling.

methodologytoolingsafetyoperations
by Esp1ngard4 Sep 1, 2026 6/10
workflow GitHub

nullius: A Ceremony-Free Agent Methodology With Costed Claims

Nullius in verba, applied to coding agents: top-tier judgment stays hands-on, Haiku scouts absorb the bulk of the work, and mechanisms get quoted rather than claims trusted. Ships seven benchmarks, six self-refutations, and a token bill attached to every claim.

methodologybenchmarkscostmodel-routingverification
by joaomdsg Sep 1, 2026 6/10
workflow GitHub

ttt-workflows: pr-review, sec-audit, and trp as Claude Code Skills

Three engineering workflows packaged as skills — PR review, security audit, and TRP — distributed through a git-backed plugin marketplace with its own marketing site.

workflowpr-reviewsecurity-auditmarketplaceplugin
by kaelys-js Sep 1, 2026 6/10
workflow GitHub

spec-flow-plugin: A Feature Ships Only When a Real Test Proves the Spec

A spec-driven multi-agent pipeline where lint, tests, and requirement traceability all run outside the model, so shipping depends on a test that actually executed rather than on the agent's claim that it passed. For Node projects.

workflowspec-drivenmulti-agenttestingtraceabilitynode
by IgnacioMarin402 Sep 1, 2026 7/10
workflow GitHub

logbook: Git-Backed Threads That Persist Claude Work Across Sessions

A Claude Code plugin that records your work into git-tracked threads so context survives between sessions. Instead of re-explaining what you were doing, you resume a thread and the history comes with it. Because it is git-enabled, the log lives alongside the code it describes.

memorypersistencegitpluginsessions
by SatanshuMishra Sep 1, 2026 7/10
workflow GitHub

agent-loop: Schedule Autonomous Coding Agents Across Provider Accounts

A scheduler that runs autonomous coding agents on a timetable and spreads them across multiple provider accounts, executing each as a herdr agent in its own pane. It targets the case where you want long-running unattended work without exhausting a single account quota. Pairs with herdr for visibility into what each agent is doing.

schedulingautonomousmulti-accountherdrorchestration
by tonoid Sep 1, 2026 6/10
workflow GitHub

nullius: Machine-Verifiable Claims for Design Docs and Agent Proposals

A format and checker for citations inside design docs and agent-written proposals, so each factual claim points at something CI can re-verify. When a claim drifts out of sync with the code it cites, the check fails. Targets the problem of agent-generated documents that sound authoritative but quietly go stale.

verificationdocumentationcicitationsdesign-docs
by armanfatemi Sep 1, 2026 7/10
workflow GitHub

espalier-engineering: Encode Your Codebase's Patterns as Rules and Skills

Discovers the conventions your codebase actually follows, then encodes them as Claude Code rules, skills, agents, and hooks plus a guided pipeline. The goal is generated code that lands inside your conventions on the first attempt rather than after several correction rounds. Aimed at teams tired of repeating the same review feedback.

conventionscodebase-patternsruleshookspipeline
by Junhanliu-dev Sep 1, 2026 7/10
workflow Reddit

Nested CLAUDE.md Files Written by Older Models Can Hurt Opus 5

A developer with thousands of hours of autonomous Claude Code runs found Opus 5 struggling on an established workflow. The cause turned out to be nested CLAUDE.md files authored for older models, whose accumulated hedges and workarounds fight the newer model. Worth reading if you carried a mature config forward across model generations.

claude-mdopus-5contextmigration
by mrothro Aug 31, 2026 7/10
workflow Reddit

Repo That Teaches Claude Code Your Preferences by Observing Sessions

An open-source repo you drop alongside your project so Claude Code observes how you work and accumulates your preferences over time. The stated goal is agent-portable, self-owned preference storage rather than platform lock-in, plus an optional shared pool of contributed best practices. Author is asking for testers and contributors.

memorypreferencesself-improvingopen-source
by International_Swan_1 Aug 31, 2026 6/10
workflow GitHub

travel-planner: Seven Agents Plan a Trip and Publish It as a Site

A multi-agent travel-planning engine for Claude Code where seven specialist agents research, plan and validate a trip, then publish it as a self-contained shareable site. A readable example of specialist-agent decomposition on a non-coding domain.

multi-agentplanningtravelorchestration
by cody-hutson Aug 31, 2026 6/10
workflow GitHub

pact: Multi-Agent Orchestration CLI With Worktrees and Test Gates

A CLI that isolates Claude Code, Copilot, Codex, Gemini and Antigravity in separate git worktrees, preps dependencies, then lands their work back with a risk-sequenced, JSON-aware, test-gated merge-all. The author flags file-claim coordination as advisory and not yet reliable under concurrency.

orchestrationworktreesmulti-agentmergecli
by zekariasasaminew Aug 31, 2026 7/10
workflow GitHub

Claude-ExternalPentest: Agent Pipeline for Authorized External Pentests

A set of Claude Code agents that walk an authorized external penetration test through scope, recon, enumeration, attack planning, exploitation and reporting, structured around PTES and OWASP WSTG. Intended for engagements you have written authorization for.

securitypentestagentsowasp
by xcoy0te Aug 31, 2026 6/10
workflow Reddit

Overnight Coding-Agent Orchestrator Built in Claude Code on a $20 Plan

After two months of manually running propose to implement to validate to merge every night, the author automated the loop into an overnight orchestrator built entirely inside Claude Code on the $20 Pro plan. The writeup covers the specific failure modes that shaped it: tests quietly deleted instead of fixed, processes that never died, flaky Playwright runs.

orchestrationovernightopenspecautomation
by mauendara Aug 31, 2026 7/10
workflow GitHub

telos-sdd: Git-Native Contract Keeping Developers and Agents Aligned

A Git-native contract describing what the software should do, kept in the repo so developers and coding agents share one source of intent. A spec-driven-development approach where the spec lives under version control alongside the code it governs.

spec-drivengitalignmentcontracts
by hugues31 Aug 31, 2026 6/10
workflow GitHub

cuttings: Turn Git Worktrees Into One-Command Dev Environments

Turns git worktrees into isolated, one-command development environments, built specifically for running AI coding agents in parallel. Handles the setup that normally makes worktree-per-agent workflows tedious.

worktreesparallelenvironmentsgit
by ChristophBe Aug 31, 2026 7/10
workflow Reddit

Worktree-per-Ticket, Cron Harnesses, CLAUDE.md as API: 1,790 PRs

The setup that converged after shipping a roguelike deckbuilder on iOS and Android with Claude writing effectively all the code across four months and ~1,790 merged PRs. Root plus per-folder CLAUDE.md files act as the real interface, encoding architecture constraints agents build inside; paired with worktree-per-ticket isolation and three cron harnesses.

claude-mdworktreescroncase-studymobile
by bariyu Aug 31, 2026 8/10
workflow Reddit

Three Tiers Instead of Six Agents: Cutting Planning Overhead in Agent Pipelines

The author found their spec writer, spec reviewer, rewriter, planner and plan reviewer were burning most of the model budget before any code got written. They replaced the pipeline with three tiers: FAST (brief to code to tests), STANDARD (mini spec, one approval, code), and FULL for genuinely risky changes. A useful corrective for anyone over-engineering multi-agent orchestration.

multi-agentorchestrationtoken-budgetplanning
by son_o_gong Aug 31, 2026 6/10
workflow Reddit

Ai-workflow: A Deterministic Context Layer in Front of Coding Agents

An open-source workflow that stops agents from burning context rediscovering a repository before every change. Rather than another agent framework, it puts a deterministic navigation layer in front, leaving Claude, Codex, Gemini, Cursor or Copilot to do the reasoning. Ships three execution paths for different task shapes.

context-managementnavigationmulti-agentopen-source
by No_Professional_4310 Aug 31, 2026 6/10
workflow Reddit

Deleting All Inline Documentation to Stop Agents Brain-Dumping Into Comments

After no amount of instruction kept Claude from over-documenting inline, the author stripped inline docs from the codebase entirely and added a flat "no inline docs" rule to AGENTS.md. The pass doubled as a readability and self-documentation cleanup. Reported result: better-reading code, less stale context for agents to trip over, and lower context load overall.

documentationagents-mdcode-qualitycontext
by endgamer42 Aug 31, 2026 5/10
workflow GitHub

kstrl: A Software Factory That Only Stops When Independent Checks Agree

Hand it a spec and it plans, builds, then measures the result with checks the agent did not write, feeding the gap back into the next iteration. The loop terminates only when independent verification agrees, keeping you on the loop rather than in it. A serious take on closing the self-assessment gap.

autonomousverificationspec-drivenorchestration
by 0xfauzi Aug 31, 2026 7/10
workflow GitHub

symphony-async: One Automated Workflow Across Commits, Tests, Releases and Docs

A modular Claude Code skill ecosystem that orchestrates commits, testing, releases and documentation as a single development workflow. Each piece stays separable, so you can adopt parts of it. Aimed at collapsing the usual end-of-task ritual into one flow.

workflowreleasesautomationskills
by hnidboubker Aug 31, 2026 5/10
workflow GitHub

shell-team: A Spec-Driven Dev Team With an Independent Codex Reviewer

Gives Claude Code a PM, Tech Lead, Engineer and QA behind explicit handoff gates, plus a reviewer running on Codex so the review isn't done by the same model that wrote the code. The cross-model review is the differentiator. Gates are explicit rather than advisory.

multi-agentspec-drivencode-reviewcodex
by RipsawJP Aug 31, 2026 6/10
workflow GitHub

LexForge: Nine Skills and Gates the Agent Cannot Skip

A spec-driven pipeline combining OpenSpec artifacts with superpowers discipline, enforced by a CLI rather than by prompt instruction. Because the CLI holds the gates, the agent can't talk its way past them. Nine distinct skills cover the pipeline stages.

spec-drivengatesopenspeccli
by shepaland Aug 31, 2026 6/10
workflow GitHub

oddyssey: Observability-Driven Development for Coding Agents

A CLI toolbox letting agents observe local runs against an OpenTelemetry/Grafana stack — or remote runs on any OTel backend — and feed what they see into the next spec-driven improvement loop. Closes the loop between what the code does at runtime and what the agent plans next. A genuinely different angle on agent feedback.

observabilityopentelemetrygrafanaspec-driven
by using-system Aug 31, 2026 6/10
workflow GitHub

claude-code-openbsd: Running Claude Code on OpenBSD With pf, doas and pledge

Runs Claude Code via vmd plus Alpine Linux and Docker, using OpenBSD's own security model as the real perimeter rather than trusting container isolation alone. A thoughtful sandboxing approach for people who want a hard boundary around an agent. Documented setup rather than a package.

openbsdsandboxingsecurityvmd
by simplestringdev Aug 31, 2026 6/10
workflow GitHub

roscoe: A Single Binary Running Your Claude Code Fleet

Three-tier orchestration driving Claude Code alongside GLM-5.3-Flash subagent swarms, all from one binary. Mixing a cheap fast model for swarm work with Claude for the top tier is a sensible cost structure. No runtime dependencies to install.

orchestrationfleetsubagentsglm
by RoscoeAI Aug 31, 2026 6/10
workflow GitHub

nix-claude-code: Declarative Claude Code as Composable home-manager Modules

Manages plugins, marketplaces, skills, hooks, MCP servers and permissions declaratively in Nix, reproducible across macOS and Linux. The whole agent configuration becomes reviewable, versioned and rebuildable. A strong fit for anyone already on home-manager.

nixhome-managerdeclarativereproducible
by dryvist Aug 31, 2026 7/10
workflow GitHub

claude-dispatch: Parallel tmux Sessions With a Watchdog and Dependency DAG

Dispatches tasks across multiple Claude sessions in tmux, with auto-retry and a dependency DAG so ordered work still parallelizes. Born from running 13 investigations in 3 hours instead of 13 hours. The watchdog handles the sessions that stall.

paralleltmuxdagorchestration
by felmarv Aug 31, 2026 7/10
workflow GitHub

ihudak-claude-plugins: A Full Feature Lifecycle Gated by Opus Reviews

Runs idea to Value Increment to ARD to spec to design to Epics to implementation to docs to release notes, with an Opus review gating each stage. Tracks what every feature costs in dollars by phase, role and model, and captures friction in-flight so the workflow improves itself. Unusually complete cost accounting.

lifecyclegatescost-trackingplugins
by ihudak Aug 31, 2026 6/10
workflow GitHub

agent-loops: Worker Plus Adversarial Verifier With Hard Gates and Auto-Retry

Deterministic loops pairing a worker agent with an adversarial verifier behind hard quality gates, retrying automatically and escalating to a human when it can't converge. File-based with zero dependencies and a one-click on/off switch. Works with Claude Code, Codex, Cursor and Kimi.

verificationadversarialgatesloops
by mixxan05 Aug 31, 2026 7/10
workflow GitHub

ClaudeHarness: Review Subagents, Model Routing and Its Own Meta-Prompts

A curated harness combining spec-driven review subagents, model-routing rules and self-maintenance skills. Notably it publishes the meta-prompts used to generate the harness itself, so you can regenerate rather than fork. Useful as a reference configuration.

harnesssubagentsmodel-routingmeta-prompts
by StefanoZaghi1987 Aug 31, 2026 6/10
workflow GitHub

personal-ai-os: The Public Architecture of One Developer's Private AI OS

Documents how the author runs durable, high-agency collaboration with AI agents, publishing the architecture without the private contents. Useful as a worked reference for designing your own system. Architecture document rather than installable tooling.

architecturepersonal-aiagentsreference
by PetreLaskov Aug 31, 2026 5/10
workflow GitHub

ZenonEl/ephemeris: Hand Off Source Addresses, Not Lossy Summaries

Issue-based daily handoffs where sessions exchange pointers to where information lives rather than lossy summaries of it. Ships as a Claude Code plugin and a Codex skill. Addresses the compounding-distortion problem in summary-based handoffs.

handoffsessionsissuescontext
by ZenonEl Aug 31, 2026 6/10
workflow GitHub

claude-code-development-harness: An Interview-Built, Project-Specific Harness

Inspects a blank folder or existing repo, interviews you about what it can't infer, then installs a harness tuned to that project — context budget, work graphs, capability tiers and an agent session runtime. Adapting to the project beats a one-size template. Marketplace plugin.

harnesscontext-budgetcapability-tiersplugin
by AlperenEvci Aug 31, 2026 6/10
workflow GitHub

claude-code-orchestration-ko: A Korean Guide to Multi-Agent Orchestration

A practical Korean-language guide to running Claude Code multi-agent orchestration solo, with three free preview chapters and templates. Non-English orchestration material is scarce. Templates are usable independently of the book.

orchestrationkoreanguidetemplates
by soul-sol Aug 31, 2026 5/10
workflow GitHub

agentic-dev: Turn a Checked-In plan.md Into Reviewed Pull Requests

Three cron-driven stages — slice into issues, write failing tests, then implement until green — each running Claude Code or Grok in a disposable Docker container. Test-first by construction, with human review as the only merge gate. A well-shaped answer to unattended agent development.

autonomoustdddockerpull-requests
by vfedotovs Aug 31, 2026 7/10
workflow GitHub

ai-engineering-workspace: One Workflow Across Four Coding Harnesses

A portable persona canon, process skills and safety guardrails kept in sync across four harnesses by design rather than by manual copying. Sync-by-design is the hard part most multi-harness setups get wrong. Provider-neutral.

multi-harnessportableguardrailsworkflow
by yuri-semenenko Aug 31, 2026 6/10
workflow GitHub

maddog: Advisor-Executor Agent Universe for Claude Code

A Claude Code agent system built around an advisor/executor split, with a family of executors tiered by how much judgment each is trusted to exercise. Includes a product-engineering pipeline plus gated skill-authoring and session-mining skills. Useful if you want a structured multi-agent setup rather than ad-hoc subagent calls.

agentsorchestrationsubagentsskillspipeline
by Harish-here Aug 30, 2026 6/10
workflow GitHub

agent-operating-system: Operating Model for a One-Human AI Coding Team

A written operating model — not a tool — for running AI coding agents as if they were a small team with a single human owner. Covers how work is assigned, reviewed, and accepted when most of the output comes from agents. Worth reading if your agent setup works technically but the process around it does not.

processoperating-modelagentsteamdocumentation
by pravashkarki Aug 30, 2026 5/10
workflow Reddit

Load-Bearing Words: Single-Term Concepts That Sharpen Agent Prompts

A collection of 101 loanwords and terms that each compress a useful engineering concept into one word, curated for use inside AGENTS.md and CLAUDE.md. The author uses honte (the solid, correct move) and kakou (heat control) as positive directives, while banning pokazukha, aktionismus and muda. The idea is that a single dense word steers the model better than a paragraph of explanation.

promptingclaude-mdagents-mdcontext-engineering
by notrealAI Aug 30, 2026 6/10
workflow Reddit

The Stopping-Condition Problem in Agent-Driven Code Review

A discussion of the builder/reviewer agent loop and why it rarely terminates on its own: a competent reviewer can always surface another edge case, weaker test, or cleaner abstraction, and many of those findings are genuinely real. Raises the practical question of what stopping rule to use when 'review until nothing is wrong' never converges. Useful framing for anyone running automated review passes.

code-reviewmulti-agentverificationworkflow-design
by piratastuertos Aug 30, 2026 6/10
workflow GitHub

deepseek_herdr: DeepSeek as Commander of a Claude/Codex Agent Team

A multi-agent command plugin native to the DeepSeek harness that opens and directs a team of claude, opencode, and codex agents. Provides live visibility into what each agent is doing, coordinated through shared memory and a task board. Chinese-language project.

multi-agentorchestrationdeepseektask-board
by qinglang8609 Aug 30, 2026 6/10
workflow GitHub

orchestrator: A Containerized AI Team for a Company of One

You state a goal and a team of agents assembles around it, splitting the work into slices you approve one at a time, then writes code, runs your tests, reviews the result, and opens a pull request. Every agent runs in its own container, so a destructive command hits the container rather than your machine. Aimed at solo developers wanting team-shaped process without a team.

multi-agentcontainerspull-requestorchestrationisolation
by pamin-labs Aug 30, 2026 7/10
workflow GitHub

tiered-agent-orchestrator: Strong Models Decide, Economy Models Execute

Routes decision-making to capable models and mechanical execution to cheap ones, with state persisted in the repository so long-running engineering work survives session boundaries. A concrete implementation of cost-tiering rather than a single-model loop. Relevant to anyone burning limits on work that does not need the top model.

cost-optimizationorchestrationmodel-routingstate
by jaywavfeng Aug 30, 2026 6/10
workflow GitHub

phasekit: Run a Long Refactor as Reviewable Unattended Sessions

Splits one plan into phases, runs each phase as a headless Claude Code session on its own git branch with one commit per task, and requires gates to pass green before every commit. The runner survives usage limits, standby, and reboots, so a multi-hour refactor continues across interruptions. Designed so the resulting history is actually reviewable rather than one opaque mega-diff.

refactoringheadlessgitunattendedgates
by RobertoReale Aug 30, 2026 8/10
workflow GitHub

PAAD: Bringing Established Software Practices Up to AI Speed

Argues that the practices that made software work did not stop working, they stopped keeping pace, and adapts them for AI-assisted development. From Ovid, a long-time software engineering writer. A methodology repository rather than a tool.

methodologypracticesprocess
by Ovid Aug 30, 2026 5/10
workflow GitHub

Riftbook: Tools and Reusable Systems for Vibe-Coded Apps

A collection of prompts, workflows, and practical patterns aimed at replacing guesswork with reusable systems when building apps largely by prompting. Reference material rather than an installable tool. Useful as a starting point for building your own conventions.

promptsworkflowspatternsreference
by imMamdouhaboammar Aug 30, 2026 5/10
workflow GitHub

agent-smith: An Agent That Propagates Improvements Into Other Agents

Mines your session history for lessons and audits your existing agent definitions for staleness, then opens pull requests with fixes. Treats agent configuration as code that should be maintained rather than written once and forgotten. Novel take on keeping a growing agent fleet consistent.

meta-agentsession-historymaintenanceautomation
by noamsto Aug 30, 2026 7/10
workflow GitHub

claude-reasoning: DAG Orchestration With Structured Contracts

A graph-based reasoning pipeline for Claude Code where steps are arranged as a DAG and each node exchanges data through a structured contract. Replaces free-form chaining with explicit dependencies and typed handoffs. For multi-step reasoning tasks that need reproducibility.

dagorchestrationstructured-outputpipeline
by okokjai Aug 30, 2026 6/10
workflow GitHub

mergex: Deliver Agent Work to the Repo With the Diff Pre-Triaged

The final stage of the Expx method: one branch per unit of work, one commit per task, and a diff already classified by where human attention is actually worth spending. Focuses the reviewer instead of presenting an undifferentiated changeset. Portuguese-language project.

gitcode-reviewdeliveryworkflow
by bittencourtthulio Aug 30, 2026 5/10
workflow GitHub

agent-workspace-starter: Governed Workspace Template With Session Discipline

A minimal Claude Code workspace template that ships orient/wrap session discipline, task capture, a lessons-learned loop, and two safety hooks from day one. It is meant as the starting scaffold for a new agent-driven repo rather than a full framework. Good if you keep rebuilding the same CLAUDE.md and hook setup for every project.

templatehookssession-managementstartergovernance
by jimy-r Aug 30, 2026 6/10
workflow GitHub

delivery-kit: Session Handoff and Idea-to-Reviewed-PR Plugins

Two Claude Code plugins: one hands a session off to a fresh context before the current one runs out, and the other drives a single feature from idea through to a reviewed pull request. They address the two most common long-session failure modes — context exhaustion and unreviewed output. Installable as a pair or individually.

plugincontext-managementhandoffpull-requestworkflow
by h-zahran Aug 30, 2026 7/10
workflow GitHub

phases-oss: Phase-Based Runner With an Adversarial Reviewer Gate

A pure-Python, zero-dependency workflow runner that splits agent work into bounded phases, requires deterministic proofs to advance, and runs an adversarial reviewer that never passes by default. The design forces the agent to earn each phase transition rather than declaring itself done. Notable for having no dependencies at all.

workflowguardrailspythonreviewphases
by Cherridsaid Aug 30, 2026 7/10
workflow GitHub

keel (Bhargs24): AI Founding Team That Plans and Builds a Product

An open-source product builder that runs an idea through simulated business, market, product, design, architecture, QA, and security roles, then builds it out using Claude Code or Cursor. The aim is a shipped production-grade product from one prompt-level idea. Broad in scope; useful mainly as a reference for multi-role agent orchestration.

orchestrationmulti-agentproductplanningopen-source
by Bhargs24 Aug 30, 2026 7/10
workflow GitHub

infoseek: Multi-Source Research Pipeline With Contradiction Detection

An end-to-end content research workflow: sniff multiple sources, gate them through a four-dimension scoring filter, deep-crawl what passes, detect contradictions across sources, then emit a structured report and archive it long-term. The cross-source contradiction check is the distinguishing step. Documentation is in Chinese.

workflowresearchscrapingscoringchinese
by GYINT Aug 30, 2026 6/10
workflow GitHub

moot: Claude Code, Codex, and Copilot Debate While You Rule

Puts three CLI coding agents into one shared council where they debate a decision over MCP, and a human casts the final ruling on every outcome. Runs as a terminal UI using the CLI subscriptions you already have, so no API keys are needed. A concrete take on multi-model deliberation with the human kept firmly in the loop.

multi-agentmcpcodexcopilottuihuman-in-the-loop
by jyunming Aug 30, 2026 7/10
workflow GitHub

portfolio-automation: Scheduled Cloud Routines That Keep a Portfolio Site Current

Claude Code skills wired to scheduled cloud routines that automatically update a GitHub Pages portfolio — refreshing project entries and work-experience sections without manual edits. A small, readable example of using scheduled agent runs to maintain a live site.

skillsautomationscheduledgithub-pagesportfolio
by danibsheehan Aug 30, 2026 5/10
workflow GitHub

ops-kit: The Generic Skeleton of a Personal Claude Code Ops System

The infrastructure behind a personal Claude Code operations setup, published with all the private data stripped out: a SQLite source of truth, search over it, hooks, an MCP server, a learning loop, and a task manager. Meant as a starting skeleton for building your own agent ops system rather than a product to adopt as-is.

opssqlitehooksmcptask-managerpersonal-infra
by kamil-blip Aug 30, 2026 7/10
workflow GitHub

continuo: Orchestration Layer Tying Claude Code to GitHub Projects v2

An orchestration system that wires Claude Code together with OpenAI symphony, herdr, and GitHub Project v2 boards. The idea is to drive multi-agent work from project-board state so issues and tasks become the queue agents pull from. Early-stage with sparse documentation.

orchestrationgithub-projectsmulti-agentautomation
by maimuzo Aug 29, 2026 5/10
workflow Reddit

Cruxton: Decision Records So Agents Stop Re-Proposing Rejected Ideas

A decision-records system that captures why a choice was made and which alternatives were rejected — the human reasoning an agent cannot re-derive from the code. Agents consult the records instead of re-researching paths the team already ruled out weeks ago. Targets the common annoyance of Claude Code confidently suggesting an approach you already killed.

decision-recordsmemorycontextadr
by thePangee Aug 29, 2026 7/10
workflow Reddit

What to Put in /compact's Optional Summarisation Instructions

Thread on steering Claude Code's /compact with explicit summarisation instructions instead of letting it compress blindly. The author ran a six-hour orchestrator session and describes the tradeoff they hit: compacting without guidance degrades the agent, while never compacting burns usage at an accelerating rate. Useful if you run long orchestrator sessions that outlive one context window.

compactioncontext-managementorchestration
by reach4thelaser5 Aug 29, 2026 6/10
workflow Reddit

Hiding Secrets From Claude Code at the Filesystem Level With Devcontainers

Instead of relying on deny rules, this setup runs Claude Code inside a Docker devcontainer where secrets are simply not mounted, so the agent cannot read what isn't there. Quick start is 'Reopen in Container' with no manual mount config. Includes a worthwhile finding: Claude Code's built-in deny rules don't traverse parent directories, which leaves gaps in monorepos.

securitysecretsdockerdevcontainer
by YujiSuzuki Aug 29, 2026 8/10
workflow Reddit

Claude Code Web Sessions Starting on Stale Commits — the Environment Cache

Report and diagnosis of Claude Code web sessions resuming a long-lived feature branch at a commit nine steps behind GitHub, traced to the cached environment rather than the branch picker. The agent then reads outdated project notes and works from the wrong state. Worth reading if you keep one branch per milestone on Claude Code web instead of merging to main each session.

claude-code-webgittroubleshooting
by onlyemgi Aug 29, 2026 6/10
workflow Reddit

TS Evidence Graph: Turning Specifications Into Compile-Time Obligations

A TypeScript pattern where @evidence annotations link every implementation back to the doc section, endpoint, hook, or principle it satisfies, and citing the reason is mandatory. The compiler then enforces that each requirement is covered, giving a mechanical check on requirements coverage and principle compliance rather than a review-time promise.

typescriptrequirementsverificationcompliance
by jhnam88 Aug 29, 2026 7/10
workflow GitHub

claude-harness: Japanese-First Claude Code Starter Kit for Real Work

Hands-on OSS starter kit covering skills, subagents, hooks, MCP, plugins, and a four-window worktree layout, written Japanese-first for the 2026 feature set. Aimed at people moving past demos into daily production use of the agentic CLI.

starter-kitjapaneseworktreeplugins
by Hyphen-Tech-Org Aug 29, 2026 6/10
workflow GitHub

discussion-to-superpowers: The Design Layer obra/superpowers Assumes

Turns a design conversation into durable project documents, an ordered roadmap, and one session-ready run sheet per feature — the upstream artifacts superpowers expects to already exist. Bridges the gap between an unstructured idea discussion and a workflow that can actually be executed feature by feature.

superpowersplanningroadmapdocumentation
by pripanggalih Aug 29, 2026 7/10
workflow GitHub

capstan: Gated Concept-to-Delivery Pipeline for Claude Code

Claude Code plugin that moves work through explicit gates with specialized roles, test-first slices, review, and verification before anything is called done. Structures a feature as a sequence of checkpoints instead of one long agent run.

plugingatestddverification
by MokeyBytes Aug 29, 2026 7/10
workflow GitHub

tldr-experts: A File-Based Five-Phase AI Development Loop

Lightweight workflow where expert definitions live as files on disk and work moves through one loop of five phases. Pre-alpha. Deliberately avoids a runtime or service — the whole method is plain files in the repo.

workflowfile-basedexperts
by ederwii Aug 29, 2026 5/10
workflow GitHub

perf-audit: Specialist Agents That Hunt Memory Leaks, Jank and N+1

Claude Code plugin with a team of specialist agents auditing backend, frontend, and mobile code for memory leaks, CPU and thermal overuse, jank, OOM, N+1 queries, and DoS exposure, including live-profiling arms. Broader than the usual single-pass performance linter.

performanceprofilingauditplugin
by NarekManukyan Aug 29, 2026 7/10
workflow GitHub

stuntman: Plan With Claude, Execute With a Cheap Model, Review With Claude

Delegation harness that keeps Claude on planning and review while a near-free model does the bulk execution, on the theory that Claude shouldn't do its own stunts. A concrete implementation of the cost-tiering pattern people usually run by hand.

delegationcost-optimizationmodel-routing
by mhlaghari Aug 29, 2026 7/10
workflow GitHub

claude-best-practice: Patterns From Vibe Coding to Autonomous Agent Teams

Long-form guide organising Claude Code practice as a progression — ad-hoc prompting, then agentic engineering, then autonomous development teams — with the patterns each stage needs. Useful as a map of the territory if you're deciding what to adopt next.

best-practicesguidepatterns
by vignesh2027 Aug 29, 2026 5/10
workflow GitHub

Coordinating Claude Code, Codex and Cursor Through the Filesystem

Multi-agent collaboration on a single machine where Claude Code, Codex, and Cursor coordinate through filesystem protocols rather than a server. No infrastructure beyond agreed-on files and directories.

multi-agentfilesystemlocalcoordination
by peretzp Aug 29, 2026 6/10
workflow GitHub

dev-bootstrap: Portable Neovim + Claude Code Environment With tmux Panes

Reproducible setup pairing Neovim and Claude Code in an nvim|claude tmux layout, with /new-project scaffolding, /parallel-tasks that open as tmux windows, and a lint/test feedback loop. Parallel work becomes windows you can watch rather than background jobs.

neovimtmuxenvironmentparallel
by ret3030 Aug 29, 2026 6/10
workflow GitHub

software-factory-rs: Pull-Based Agents in a Sandboxed Rig With a Beads Ledger

Give it a plan and it returns a verified, merged codebase. Agents (Claude Code, OpenCode, Codex) pull work from a Beads ledger inside a sandboxed rig, with typed railway-oriented Rust and a done-means-verified rule. Pull-based dispatch avoids the coordinator bottleneck most orchestrators hit.

rustorchestrationsandboxverification
by The-Zoop-Troop Aug 29, 2026 7/10
workflow GitHub

helioz: Continuity Orchestrator With Watchdogs and Adversarial Probes

Orchestrator for agent teams that keeps state on disk and enforces task gates, independent verification, budgets, watchdogs, and adversarial probes. Built around the assumption that a long agent run will stall or drift and needs external checks.

orchestrationverificationbudgetswatchdogs
by zarubinvibe Aug 29, 2026 6/10
workflow GitHub

zeuz: Reference Factory for Role-Based Agent Workflows

Reference implementation of a role-based agent workflow covering requirements discovery, architecture gates, observability, tests, and human approval points. Meant as a pattern to copy rather than a product to adopt wholesale.

workflowrolesgatesreference
by zarubinvibe Aug 29, 2026 6/10
workflow GitHub

chock-claude-plugins: Policies as Installable Plugins, With Enforcement Stated

Chock policies packaged as Claude-format plugins generated from a shared catalog, where each plugin declares whether it actually enforces in your client or is only advisory. That honesty about enforcement is unusual and worth borrowing.

policiespluginsgovernanceenforcement
by open-coder-ai Aug 29, 2026 5/10
workflow GitHub

samewrite: Where Coding-Agent Sessions Actually Spend Tokens, Measured

Analysis of 1,316 Claude Code transcripts and 342 scored A/B runs. Findings: cost is carry, so Bash and Read account for 63.8% of it; the 'emit only the changed block' rule is net negative; 72.9% of skill-listing bytes belong to skills never invoked; terseness cuts output 23.4% but no skill beat a one-sentence version of itself. Directly contradicts several popular optimisation habits.

tokensresearchbenchmarksskills
by ipeterpetrus Aug 29, 2026 8/10
workflow GitHub

repo-agent-harness: Make the Repository Teach Agents How to Work in It

Lays down hooks, layered documentation, guards, gates proven to actually fail when they should, and a repo graph — then stays out of the way. The 'proven to turn red' requirement is what separates it from guard configs nobody has ever seen trigger.

hooksguardsdocumentationrepo-setup
by WangChangxin0809 Aug 29, 2026 6/10
workflow GitHub

meute: spend leftover subscription quota on scheduled unattended repo work

A scheduler that puts idle Claude Code or Codex subscription quota to work by running unattended jobs across your local repositories on a timetable, with a separate capped track for open-source contributions. It runs without a daemon or database, so setup is just configuration plus cron-style scheduling. Useful if you pay for a plan monthly and routinely leave capacity unused.

automationschedulingunattendedcodexquota
by bearyjd Aug 29, 2026 7/10
workflow GitHub

polako: Unattended Issue-to-Merged-PR Runner With Human Gates

Works a GitHub issue backlog down to zero, one issue at a time, without supervision between steps. Each stage from issue triage to merged PR has an explicit human approval gate, so the agent runs long but never merges on its own. Aimed at grinding through accumulated small issues.

githubautomationprbacklogunattended
by scharissis Aug 29, 2026 7/10
workflow Reddit

Measured Across 34,215 API Calls: 360 Tokens Re-Read Per Token Written

A developer instrumented 637 of their own sessions and found cache reads were 98.5% of billed tokens, cache writes 1.2%, and model output 0.3%. The median session sits at 97.6% re-read with p10 at 91.2%, so it holds across the distribution rather than coming from outliers. Worth reading with the caveat the author raises: cache reads are billed at a fraction of input tokens, so these are token shares, not dollar shares.

tokenscontextcachingusagemeasurement
by duqaxxx Aug 29, 2026 7/10
workflow GitHub

spec-lane: Local-First Delivery Workflow With Acceptance Gates

Runs AI-assisted changes through premise checks, spec consensus, and acceptance gates before anything ships, with cost calibration at each stage. Emits agent metrics so you can see where the workflow actually spends effort. Everything runs locally rather than through a hosted service.

spec-drivengatesmetricslocal-first
by shiki-yusuke Aug 29, 2026 6/10
workflow Reddit

Treating Claude Code as a Design Environment With Per-Domain Skill Files

A frontend workflow that swaps ad-hoc prompting for a workspace of purpose-built .md skills (shadcn, GSAP, taste, frontend design) that Claude Code loads depending on what is being built. The process starts by handing Claude an asset folder so it knows what images and references exist, then works through UI/UX requirements using the relevant skills. Useful as a concrete example of skill-file decomposition for design-heavy projects.

skillsfrontenddesignworkflowworkspace
by ElectronicDesign3697 Aug 28, 2026 5/10
workflow GitHub

opc-agents: A Director Plus Nine Specialist Agents for Solo Operators

A "one person company" agent team where a Director agent coordinates nine specialist roles across a project. Runs on either Claude Code or OpenCode, so the same team definition is portable between harnesses. Useful if you want a ready-made role split rather than designing subagent responsibilities from scratch.

multi-agentsubagentsopencodeorchestrationsolo-founder
by jovian-zhibai Aug 28, 2026 6/10
workflow GitHub

scavengers-assemble: Multi-Model Coding Harness Across Claude, Gemini, GPT and Ollama

An Avengers-themed orchestration harness where a lead agent delegates coding work to Claude, Gemini, GPT-4, Grok and local Ollama models. It drives the vendors' existing CLIs so it runs on subscriptions you already pay for rather than metered API keys. Open source, aimed at people who want to mix models on one codebase.

multi-agentmulti-modelorchestrationollamaharness
by shubhransh-gupta Aug 28, 2026 6/10
workflow GitHub

hivemind: Claude Code Plans and Reviews While Free OpenCode Workers Do the Work

A cost-splitting swarm pattern: Claude Code handles planning and review, then hands implementation to parallel OpenCode workers, each isolated in its own git worktree. Workers communicate back through a deliberately minimal one-JSON-line contract, which keeps the coordinator's context small. Worth a look if you want parallelism without paying premium rates for every edit.

multi-agentworktreesopencodeparallelorchestration
by Hanishchow Aug 28, 2026 7/10
workflow GitHub

claude-project-flow: Six Approval-Gated Phases From Idea to Shipped Code

A Claude Code plugin that structures a project as six sequential phases, each requiring your explicit approval before the agent moves on. The gates are the point — they stop the agent from racing from a rough idea straight to a large diff. Suits people who want a repeatable process rather than freeform prompting.

pluginworkflowplanningapproval-gatesprocess
by voyvodka Aug 28, 2026 7/10
workflow GitHub

tenet: A Commitment Ledger That Keeps Project Decisions and Rules From Rotting

Records the decisions and rules a project has committed to, and ships the machinery to keep those records honest as the codebase moves underneath them. The problem it targets is familiar to anyone with a long CLAUDE.md: rules accumulate, silently go stale, and the agent keeps following them. Documentation is sparse, so expect to read the repo.

decisionsadrgovernancerulescontext
by Hirannad Aug 28, 2026 5/10
workflow GitHub

Bench: A Constitutional Governance Layer for Claude Code

Puts a governing document between you and the agent, so behaviour is constrained by explicit written principles rather than instructions scattered across prompts. Positioned as a governance layer rather than another rules file. The README is terse — read the repo before adopting it.

governancerulesconstitutionconstraintspolicy
by Nuralyn Aug 28, 2026 5/10
workflow GitHub

super-backlog: Add Task Tracking, Skills and a Dashboard to Any Repo in One Command

A single installer that drops a complete agent workflow into an existing repository: Backlog.md task tracking, the Superpowers skill collection, and a live project dashboard. It installs in seconds and, notably, uninstalls cleanly — so trying it does not leave residue in the repo. Good for evaluating a structured agent workflow without committing to it.

backlogtask-trackingskillsdashboardinstaller
by adam-s-k-i Aug 28, 2026 7/10
workflow GitHub

claude-code-toolkit: One-Command Project Bootstrap for .NET, Java, Python and Rust

Bootstraps a repository with a production-shaped Claude Code setup in a single command, using per-stack templates for .NET, Java, Python, Rust+Tauri and MAUI, with a generic fallback for anything else. Aimed at the setup tax you pay on every new project. Note there are several unrelated projects sharing this name.

bootstraptemplatesdotnetrustscaffolding
by dagonet Aug 28, 2026 7/10
workflow GitHub

sota-numerics: Force an Alternatives-Considered Section Into Every Plan

A Claude Code plugin that layers research and numerical-stability advice onto the GSD plan/execute/verify/ship lifecycle, and adds a blocking gate that refuses to let a plan proceed without an explicit Alternatives Considered section. The gate is the interesting part — a mechanical check against the agent locking onto its first idea. Most relevant to numerically sensitive work.

pluginplanninggatesresearchnumerics
by davdittrich Aug 28, 2026 6/10
workflow Reddit

Dely: Chain Claude Code, Codex and Grok Build Into One Review Loop

A plugin that sequences several official coding harnesses — Claude Code implements, another harness reviews, then accept or replan — without copy-pasting prompts between terminals. Built by a dev who prefers separate harnesses over sub-agents. Supports Codex, Grok Build, Antigravity and Kiro alongside Claude Code.

pluginorchestrationcode-reviewmulti-harness
by hieuphung97 Aug 28, 2026 6/10
workflow GitHub

fun-with-friends: Stand Up a Multi-Agent Claude Code Dev Factory on Any Repo

Point it at a git repo and it builds an ideas-to-ship pipeline you drive by talking to a "captain" agent. Ships refactoring, ideation and dev-SRE factory templates, per-role model config, an eval harness, and a no-push local-issues mode for repos you do not control.

multi-agentorchestrationpipelineeval
by tbaums Aug 28, 2026 7/10
workflow GitHub

kernel-claude: Prove Which Claude Code Rules Actually Work

Combines persistent memory and multi-agent orchestration with an experiment engine that A/B-tests your rules to see which ones measurably change behavior. Aimed at people whose CLAUDE.md has grown past the point where they can tell what still helps.

memoryexperimentsorchestrationrules
by ariaxhan Aug 28, 2026 7/10
workflow GitHub

autoagent: Harnesses That Tune Their Own Prompts, Tools and Config

A framework for building autonomous agent harnesses that iterate on their own prompts, tool sets, configuration and orchestration while benchmarking each change. For people treating harness design itself as an optimization problem.

autonomousbenchmarkingprompt-tuningharness
by ahmadashraff Aug 28, 2026 6/10
workflow GitHub

Loop-Dee-Loup: A Token-Lean Execution Loop for Autonomous Agents

An opinionated execution loop designed to keep autonomous coding agents cheap — minimal context reloading and tight iteration boundaries. Useful if long autonomous runs are burning tokens on re-reading state.

autonomoustokensloopefficiency
by LouPineWays Aug 28, 2026 6/10
workflow GitHub

godmode: 126 Skills and 7 Subagents With Rollback and Failure Memory

A large autonomous coding plugin spanning five harnesses — Claude Code, Cursor, Codex, Gemini CLI and OpenCode. Iterative optimization with automatic rollback, a memory of past failures, and parallel multi-agent execution.

autonomoussubagentsrollbackmulti-platform
by arbazkhan971 Aug 28, 2026 6/10
workflow GitHub

Atlas (Ctrl1CandV): Local Auditable Multi-Model Workflow Engine

Define a workflow as a YAML graph, control it through six MCP tools, and inspect the complete input and output of every node in a local web UI. Everything runs on your machine, so multi-model pipelines stay auditable.

workflowyamlmcpmulti-model
by Ctrl1CandV Aug 28, 2026 6/10
workflow GitHub

Orient: A Living Map of State, Decisions and Why for Coding Agents

Maintains a running map of what you are building — current state, decisions taken and the reasoning behind them — readable by Claude Code, opencode and Codex. Explicitly designed to stay cheap enough that it never becomes friction.

contextdecisionsdocumentationmulti-agent
by Chaitanya299 Aug 28, 2026 6/10
workflow Reddit

Are Better Models Replacing Superpowers? A Token-Cost Comparison

A developer compared the Superpowers subagent framework against a plain Opus 5 run and a simple Opus-builder/Fable-reviewer pair, building the same gym booking app. All three succeeded, but Superpowers cost more than double the tokens. Argues that with a strong spec, the full subagent delivery process may no longer pay for itself.

superpowerssubagentstokenscomparison
by turtleninja99 Aug 28, 2026 5/10
workflow Reddit

Opus 5 Review Strategy: Three Layers to Stop Scope Creep

A one-line fix turning into eleven changed files is a documented Opus 5 behavior. This writeup proposes enforcing scope in three escalating layers, cheapest first: name the allowed paths in the prompt, and remove "verify your work" lines from CLAUDE.md since the model already over-verifies.

opus-5scopeclaude-mdcode-review
by cleverhoods Aug 28, 2026 7/10
workflow Reddit

Claude Code Can Read the Repo and Still Lose the Task

Argues the bad session reset is not always a context-window problem: the next session has the repo but not the history of what was tried and rejected, what is still failing, and what not to touch. A bigger context window gives more text, not a reliable record — CLAUDE.md holds rules, git holds changes, and something else has to hold decisions.

contextmemoryhandoffsessions
by Quick-Knowledge1615 Aug 28, 2026 6/10
workflow GitHub

awesome-ai-agent-governance: Policy, Audit and MCP Security in Production

A curated list of tools, standards and resources for governing AI agents in production — policy enforcement, audit trails, EU AI Act compliance, and MCP and Claude Code security. Useful if you are being asked to justify agent deployments to a compliance function.

governancecompliancesecuritymcp
by systempromptio Aug 28, 2026 6/10
workflow GitHub

agent-relay: Durable Handoffs and Sealed Versions Across Coding Agents

Install once and get durable project handoffs, instant status readouts, sealed versions and coordination between multiple AI coding agents. Aimed at the state loss that happens when work moves between sessions or tools.

handoffcoordinationversioningmulti-agent
by chopperH0824 Aug 28, 2026 6/10
workflow GitHub

spec-driven-guide: Five Phases Enforced Across Six Different Agents

A CLI that installs AGENTS.md plus on-demand skills so Claude Code, Cursor, Copilot, Codex, Gemini and Windsurf all follow the same five phases: spec, plan, code, test, end. Governance without picking a single tool.

spec-drivenagents-mdgovernancemulti-tool
by thiagocajadev Aug 28, 2026 6/10
workflow GitHub

agentic-covenants: Agent Governance Mapped to NIST CSF 2.0

A practitioner framework for autonomous-agent governance built as six matrices mapped to NIST CSF 2.0, with working Kyverno policies, Falco rules and kill-switch runbooks in every populated cell. Concrete artifacts rather than a policy document.

governancenistkyvernokill-switch
by peopleforrester Aug 28, 2026 6/10
workflow Reddit

Ask Claude to Audit Its Own Transcripts for Whether It Uses Your Skills

A simple check for whether your installed skills are actually firing: ask Claude to read its past session transcripts and report how often a given skill was invoked and which operations were used. Full file reads and direct CLI shell calls are evidence the skill was bypassed.

skillstranscriptsauditverification
by RestlessMotion Aug 28, 2026 7/10
workflow GitHub

breakthrough-harness: A Discipline Layer to Make Research Agents Hard to Fool

Adds structure to agentic research: a breakthrough loop, an un-foolable harness checklist, claim-polarity gates, and engineering rules recorded with the cost of learning them. Aimed at agents that confidently confirm whatever they set out to prove.

researchverificationgatesdiscipline
by GuoCheng24 Aug 28, 2026 5/10
workflow Reddit

Claude Code Kept Recreating UI Components I Already Had

A developer describes the recurring failure where Claude Code writes correct-looking JSX that quietly duplicates existing components, variants and tokens from the project design system. The hard part is not generating markup but getting the agent to understand the component system already present and decide what to reuse.

uidesign-systemcomponentsreuse
by kr1sck Aug 28, 2026 6/10
workflow Reddit

Opus 5 vs 4.7 vs 4.6 on the Same Skeptical Code Review

A side-by-side comparison of the three models reviewing the same set of ~145 tooling commits. Opus 5 scanned all 145 directly and returned 7 findings plus an opinion; 4.6 scanned ~60 with three forks and returned 15 findings; 4.7 returned 9. Time to first report ranged from 4m41s to 10m56s.

opus-5code-reviewcomparisonbenchmark
by joefilmmaker Aug 28, 2026 6/10
workflow Reddit

One Dev Plus an Agent Fleet: An Interactive Map of a Full Agentic SDLC

A solo engineer running a production SaaS mapped their entire delivery process into one interactive artifact — backlog, refinement, design, implementation, verification, a human merge gate, deployment and monitoring, with a central workshop for the standing setup. Posted explicitly asking to be critiqued.

sdlcagent-fleetsaasworkflow
by NeighborhoodOld7075 Aug 28, 2026 6/10
workflow GitHub

rein-agentic-kit: Bounded Loops and Per-Agent Model Routing

Keeps Claude Code agents lean with bounded agent loops, per-agent model routing and real per-model token measurement, so you can see which agent in a fleet is actually consuming the budget.

bounded-loopsroutingtokensmeasurement
by luisfarfan Aug 28, 2026 6/10
workflow GitHub

ownframework-loop: Human-Gated Work Packets With Exact-SHA Verification

A Claude Code engineering workflow where a human approves each work packet, build and review cycles are bounded, changes are verified against exact commit SHAs, and promotion stays manual. For teams that want agent throughput without automatic merges.

human-in-the-loopverificationgitworkflow
by william-london Aug 28, 2026 6/10
workflow GitHub

pilotfish: Frontier Model Plans, Cheaper Models Execute

A multi-model orchestration layer for Claude Code where the frontier model does the planning, cheaper models carry out the steps, and a verification pass guards quality. Installs from a single prompt. The pattern targets cost reduction on long task chains without giving up plan quality.

orchestrationmulti-modelcost-optimizationverification
by Nanako0129 Aug 28, 2026 7/10
workflow GitHub

nautilus-compass: Keep Multi-Agent Setups Coordinated Without an Orchestrator

A reliability layer for multi-agent workflows that replaces a central orchestrator with cross-dialog contracts between agents. Adds drift detection and a black-box memory store that does not rely on LLM extraction. Useful if you run several agents on the same problem and they keep diverging from the agreed plan.

multi-agentcoordinationmemorydrift-detection
by chunxiaoxx Aug 28, 2026 6/10
workflow GitHub

personal-brand-site-starter: Four-Phase Agent Flow for Building a One-Page Brand Site

A zero-dependency starter that walks an AI agent through four stages — interview, style selection, build, and acceptance check — to turn someone's own words into a single-page personal brand site. Ships four visual styles with animated hero sections. Documentation is in Traditional Chinese.

websiteagent-workflowtemplatebranding
by yazelin Aug 28, 2026 5/10
workflow Reddit

Fixing Claude Code Cross-Session Inconsistency With ADRs Instead of a Longer CLAUDE.md

A solo developer describes how growing CLAUDE.md failed to stop Claude re-litigating settled decisions each session, and how 20+ architecture decision records fixed it instead. Written from a real project (self-hosted WireGuard access management, Quarkus + Vue, 700+ tests). The takeaway: record the "why" as ADRs and point the agent at them rather than piling up rules.

adrclaude-mdcontextconsistency
by chriscohnen Aug 28, 2026 6/10
workflow Reddit

Splitting Claude Code by Model: Sonnet for Edits, Opus for Design and Review

A workflow that assigns filesystem-heavy execution (edits, tests, iteration) to Sonnet while reserving Opus for architecture, hard debugging, and independent review. The hard part is giving the reviewing model enough repo context without a full rediscovery pass, which the author solves with a local context-preparation tool.

model-selectioncontextreviewworkflow
by fykup Aug 28, 2026 5/10
workflow Reddit

Using Apple Intelligence to Summarize Claude Code Chats Overnight for Free

The author found roughly a third of their weekly token usage went to re-reads — unchanged files read again, old chats pulled into new ones. Their fix runs a local Apple Intelligence pass over each finished session to write a handoff (what happened, what was decided, what is next, which files were touched), so the next session starts from a summary instead of the raw log.

token-usagehandofflocal-llmcontext
by Unable_Strategy5135 Aug 28, 2026 6/10
workflow GitHub

plumbline (dr-zog): Enforced Traceability From Requirements to Code

A zero-dependency Go engine plus a Claude Code plugin of skills that keeps a light but enforced link between requirements and the code implementing them. Aims for traceability without the ceremony of a full requirements management tool.

traceabilityrequirementsplugingo
by dr-zog Aug 28, 2026 6/10
workflow GitHub

code-quorum: Independent External Seats for Plans, Reviews, and Validation

A multi-agent council spanning Claude Code and Codex where each seat is an independent external reviewer for planning, code review, brainstorming, validation, or research. Structured so opinions are formed separately before being reconciled.

multi-agentcouncilreviewvalidation
by sdewell Aug 28, 2026 7/10
workflow Reddit

vibeArchitecture 1.5.0: Agentic AI Security Guardrails Mapped to OWASP

A free MIT guardrails repo whose 1.5.0 release adds a guide mapped to the OWASP Top 10 for Agentic Applications: delegated credentials instead of one god key, memory poisoning, tool-description poisoning, and spend caps with a kill switch — including what to do when your agent reads a web page that tells it to do something else. Also refreshed against OWASP Top 10 2025, LLM Top 10 2026, the July MCP auth spec, NIST 800-63B-4, and WCAG 2.2.

securityowaspguardrailsprompt-injection
by PrideQuick670 Aug 28, 2026 7/10
workflow GitHub

davinci (Deadshot-77): An Autonomous Dev Team With Hook-Enforced Review Gates

Models a development team in Claude Code: a clarifying intake agent that pins down the request, an orchestrating tech lead, scoped builder agents, and review gates enforced by hooks rather than convention. The hook enforcement is what stops the pipeline skipping review when the agent is in a hurry.

multi-agentorchestrationhooksreview-gates
by Deadshot-77 Aug 28, 2026 7/10
workflow GitHub

Teknesyum Base: Sizing, Splitting and Auditing Work Automatically

A multi-agent relay for Claude Code that takes a plain request, sizes the job, splits it into pieces, assigns agents, then runs an independent auditor over the result. Ships with a neon UI standard so generated interfaces stay visually consistent.

multi-agentorchestrationauditui-standard
by Teknesyum Aug 27, 2026 6/10
workflow GitHub

loopspec: Compile a Vague Task Into a Harness-Gated Spec

Takes an informal task description and compiles it into a delegation spec where a test harness — not the model's own judgement — decides when the work is done. Addresses the common failure where an agent declares success on an under-specified task.

delegationtestingspec-drivenverification
by tommasobbianchi Aug 27, 2026 7/10
workflow GitHub

oh-my-harness (IISweetHeartII): Maintained Fork With CI-Proved Gates

A maintained derivative of revfactory/harness that ships the upstream project's unmerged v2 rebuild along with reviewed community pull requests. Its CI proves its own quality gates, so the agent-team and skill-factory features are verified rather than asserted.

harnessagent-teamskill-factorycifork
by IISweetHeartII Aug 27, 2026 6/10
workflow Reddit

Why Resuming an Old Session Burns Your Usage Limit

Explains that Claude Code enables prompt caching by default and that cache writes are the expensive part — so resuming a session idle for over an hour re-writes the whole cache. The habit of returning to a stale session 'because it has all the good context' is the single biggest avoidable cause of limit burn.

usage-limitsprompt-cachingcostsessions
by Wyckoff-XD Aug 27, 2026 7/10
workflow Reddit

A Pacing Chart for the Weekly Limit: 51% by Wednesday Night

Works out what percentage of the weekly usage limit you should have spent on any given day — 17% per weekday if you work weekends, 20% if you don't, anchored on being at 51% Wednesday night. The author notes the limit isn't linear in practice, so treat it as a budget rather than a prediction.

usage-limitsplanningquotachart
by ekchatzi Aug 27, 2026 6/10
workflow GitHub

secondmate: A Rival Model Tries to Break What Yours Wrote

Your agent writes the code, a different model attacks it, and only what survives the cross-model review reaches a gated merge with a human approving. Uses model diversity as the review signal rather than asking the same model to check its own work.

code-reviewcross-modeladversarialmerge-gates
by eshwarvijay Aug 27, 2026 7/10
workflow GitHub

research-ratchet: Claims Advance Only Through Gates

A methodology for AI-assisted research where each role is defined by what information it is allowed to see, and a claim only moves forward by passing an explicit gate. The information-diet framing is a deliberate defence against agents laundering assumptions into conclusions.

researchmethodologygatesverification
by yaerhf Aug 27, 2026 6/10
workflow Reddit

The Bugs Were in the Markdown: Auditing 150 Files of Agent Docs

After months of blaming the model for inconsistent answers and ignored rules, the author audited their agent setup and found 50+ instructions pointing at files that no longer exist and roughly 70% of the docs dead. A useful reminder that a growing CLAUDE.md and skill tree needs pruning, and that broken pointers degrade behaviour silently.

claude-mdcontextdocumentationmaintenancedebugging
by crystian77 Aug 27, 2026 7/10
workflow GitHub

solidforge: Converge, Specify, Implement With Gates That Can't Go Silently Green

A Claude Code plugin implementing a loop-engineering pipeline — converge on the problem, write the spec, then run parallel TDD implementation behind dual-ring convergence gates. Adds adversarial cross-source review, source-grounded citation checks and prior-art collision search, with honest coverage reported at every gate.

tddspec-drivengatesadversarial-reviewplugin
by maskshell Aug 27, 2026 7/10
workflow Reddit

Do Fork Subagents Really Resend the Whole Conversation?

A session split across four parallel fork subagents burned about 2M tokens for modest work, prompting the question of whether a fork inherits the entire parent conversation and re-sends it on every tool call. Worth reading before fanning out forks from a context-heavy session — the cost model is not obvious from the UI.

subagentstokensforkscostdiscussion
by maartendeblock Aug 27, 2026 5/10
workflow GitHub

Building Verifiable MBA Case Studies With Verification-Debt Tracking

A GitHub template for producing business school case studies with agentic AI, using source tiering and explicit verification-debt tracking so unchecked claims stay visible. The verification-debt idea generalizes well beyond case studies.

researchverificationtemplateeducation
by leifulstrup Aug 27, 2026 5/10
workflow GitHub

ai-pack: Six Subagents and a Knowledge Graph as an Engineering Team

A Claude Code plugin that turns a session into a small engineering team — six specialized subagents plus orchestration and PR-shepherding skills, backed by persistent knowledge-graph memory that survives between sessions.

subagentsorchestrationknowledge-graphmemoryplugin
by Cortexa-LLC Aug 27, 2026 7/10
workflow GitHub

model-loop: Let a Rival CLI Attack Your Plan Before Any Code

The invoking agent writes the plan, then a different CLI — agy, Cursor, Codex or Claude Code — attacks it before implementation starts. Cross-harness review at the planning stage, where fixing a flaw is cheapest.

planningcross-modeladversarialreview
by flowmar47 Aug 27, 2026 7/10
workflow GitHub

many-hats: A Cloneable AI Product Team Across Five Agents

A clonable product-team setup — roles, handoffs and responsibilities — that works in Cursor, Claude Code, Codex, Copilot and Windsurf. The human stays the decision maker rather than being routed around.

product-teamrolesportablemulti-agent
by abenjamin765 Aug 27, 2026 6/10
workflow GitHub

Synapse: A Bug Bounty Pipeline That Kills Its Own Findings First

A multi-agent bug bounty research pipeline built on Claude Code agents, hooks and schema-checked artifacts, where findings are adversarially validated and discarded before they ever reach you. Directly targets the noise problem that makes agent-driven security research unusable.

securitybug-bountymulti-agentadversarialhooks
by ZeZ0K Aug 27, 2026 7/10
workflow Reddit

Measuring How Much Context an Agent Must Read: Plain vs Framework Stacks

A developer measured the text a coding agent must read before safely changing one code path, comparing C vs C++, Java+JDBC vs Spring+JPA, and vanilla JS vs React. Hand-written code size was similar, but framework stacks pulled in 59k-132k tokens of external convention and source versus 7.6k in-repo for the plain path. A concrete data point for how stack choice affects agent context budgets.

contextbenchmarksframeworkstokens
by Anode1_dev Aug 27, 2026 6/10
workflow Reddit

Five-Vendor Code Review Panel via Any OpenAI-Compatible Endpoint

A Claude Code plugin that gets code review from non-Claude models by talking plain HTTPS to any OpenAI-compatible endpoint, instead of shelling out to Codex or Gemini CLIs. Because NVIDIA build.nvidia.com hosts DeepSeek, Kimi, Nemotron, and MiniMax on a free tier, you can seat a five-model panel on one key. The authors key finding: giving each panelist a distinct role (correctness, architecture, security, regression, performance) surfaced far more distinct defects than five identical review prompts.

code-reviewmulti-modelpluginfree-tier
by Mountain_Student972 Aug 27, 2026 8/10
workflow Reddit

Four Agents for Managing Claude Like an Employee: Radar and Friends

A CTO frustrated with Opus wrote four agents and commands to manage it like a report rather than argue with it. Radar triages new issues and bugs at session start, reports repo state and logical next steps, and flags which work can run unattended versus which needs human time. Runs on Sonnet with tight guardrails, and the framing itself is the useful part: treat agent quirks as management overhead, not defects.

agentstriagemanagementworkflow
by ExpensiveSun257 Aug 27, 2026 7/10
workflow Reddit

Combining Spec-Driven Development, Project Memory and Hooks

A platform engineer's writeup of an agentic development workflow that pairs spec-driven development with persistent project memory and Claude Code hooks. The aim is to give the agent enough engineering intent per session without replaying the whole project history into context every time. Comes with an accompanying repo (claude-spec-mem) implementing the setup.

workflowspec-drivenmemoryhooks
by gringobrsa Aug 27, 2026 6/10
workflow GitHub

specflo: A Python CLI Driving Brainstorm, Spec, Plan, Execute Loops

Spec-driven software engineering for coding agents, implemented as a Python CLI that walks a project through brainstorm, spec, plan, and execute stages. Every artifact lands as markdown on disk, so the intermediate reasoning is reviewable and version-controllable rather than trapped in a chat log. Fits teams that want the agent's plan under code review before implementation starts.

workflowspec-drivenclipython
by TacoTakumi Aug 27, 2026 6/10
workflow GitHub

review-switch: Dispatch Code Reviews to Pluggable Reviewer Lanes

Lets you route a code review from inside Claude Code to whichever reviewer backend you want — a Claude plugin lane or a Codex TUI lane — through one dispatch point. Swapping reviewers becomes a config choice instead of a different manual process per tool. Handy if you deliberately want a second model's eyes on a diff.

code-reviewplugincodexdispatch
by okqixiaobao727-design Aug 27, 2026 6/10
workflow GitHub

gauntlet: Provider-Neutral Review Harness With Four Checkpoints

A review-only code review harness that runs one engine at four checkpoints in the development cycle, sharing verdict memory between them so earlier findings carry forward. Provider-neutral, so it is not tied to a single model vendor. Aimed at teams who want consistent review gates rather than ad-hoc prompting.

code-reviewharnesscheckpointsverdict-memory
by gtsbahamas Aug 26, 2026 6/10
workflow GitHub

claude-starter-kit: Enterprise Workflow With Security and Approval Gates

An engineering workflow for Claude Code built around agents that plan, build, audit and ship, with security gates, privacy checks and approval-controlled commits between stages. Designed to be adopted into existing repositories, not just greenfield ones. Aimed at teams that need review discipline around agent-written code.

workflowagentssecurityenterpriseapprovals
by byerlikaya Aug 26, 2026 7/10
workflow GitHub

tollens: Agent Results Stay Candidates Until Executable Evidence Passes

Applies modus tollens to agent output: a result is only a candidate until executable evidence, bound to the exact evaluated snapshot, survives an external gate. Uses mutation-style reasoning, where a surviving mutant disproves the claimed guarantee. The framing is abstract, but the underlying idea of refusing to accept unverified agent claims is sound.

verificationevidencemutation-testingagentsgates
by MrSchrodingers Aug 26, 2026 5/10
workflow GitHub

ai-native-sdlc: Plan-to-Deploy SDLC Plugin With Human Approval Gates

A reusable skill and plugin implementing Anthropic's AI-Native SDLC as an explicit pipeline: Plan, Design, Build, Test, Deploy, Maintain. Each handoff between stages requires human approval, so the agent cannot silently skip from design straight to shipping. Works with both Claude Code and Codex.

sdlcpluginapproval-gatesprocesscodex
by bashebr Aug 26, 2026 6/10
workflow GitHub

ilk-skills: Staged Execution Loop That Drives a Verifiable Plan to Done

Decomposes a task into a plan with verifiable stages, then runs a loop that drives each stage to completion instead of relying on the agent to remember the whole job. The loop is agent-agnostic, working across Claude Code, Cursor, and Codex. A structured answer to long tasks that drift halfway through.

planningexecution-loopskillsverificationmulti-agent
by inluck-net Aug 26, 2026 6/10
workflow Reddit

The Until Loop: Gate Claude Code's Output Against a Plan You Agreed First

A workflow for the gap between green CI and actually-built: agree a written Plan before any code exists, then keep building until the code matches it, with a hook enforcing the check. The premise is that tests and agent summaries both pass while requirements quietly go unimplemented, and line-by-line review does not scale. Posted by someone who works on the commercial tool shown, but the loop pattern itself is reusable.

workflowplanningverificationhooksrequirements
by jameslaney Aug 26, 2026 5/10
workflow GitHub

gauntlet-loop: Builder-Critic Validation Loop With Cost Limits and Stop Rules

A method for validating LLM output against criteria defined up front, run as a builder-critic loop with explicit evidence checks. It includes cost limits and stopping conditions, so the loop terminates instead of grinding indefinitely. Useful if your review loops currently have no defined exit.

workflowcriticvalidationevalscost-control
by israeldegasperi Aug 26, 2026 6/10
workflow Reddit

An Adversarial Review Gate on a Different Model Caught Five Real Defects

Every money-touching change in this project passes an adversarial review gate before deploy: a second, independent model reads the diff looking for a reason to reject it. The reviewers were deliberately Gemini and GPT-OSS via Antigravity rather than more Claude subagents, so the reviewer is not the model that wrote the code. Three passes found five real defects, including a failing payment that could roll back and release a lock.

workflowcode-reviewadversarialcross-modeldeployment
by Ranik_Sandaris Aug 26, 2026 7/10
workflow Reddit

Running Coding Agents in Lanes Instead of One Chat Doing Everything

A pipeline where a lead agent files a GitHub issue and separate runs handle implementation, QA, review, CI, and telemetry — no session implements, reviews, and merges. Each lane writes started/done/blocked/failed to SQLite plus a GitHub comment, and the next lane reads that state before acting. Works the same across Claude, Codex, and Grok.

orchestrationlanessqlitegithub
by NewAmbition8911 Aug 26, 2026 6/10
workflow Reddit

Why "Unusually Disciplined" in a Repo Review Is a Warning Sign

A field note on letting agents build hundreds of tests and pins that look rigorous but that you stop understanding halfway through the project. The praise from a review agent reads as validation right up until the suite becomes the thing blocking every change. Useful counterweight if your agent-built test suite keeps growing.

testingreviewanti-pattern
by ConcretePond Aug 26, 2026 6/10
workflow Reddit

disensor: Enforced Residue Declarations at the End of Each Review Round

Claude Code writes the plan or code, a reviewer from a different model family attacks it, and the round only closes when every finding is fixed, refuted with evidence, or escalated. disensor makes Claude emit a JSON artifact recording each finding's terminal state and what the cycle could not resolve, and a GitHub Action blocks merge without a valid declaration covering the tree.

adversarial-reviewgithub-actionsverification
by Nicolaides_Arg Aug 26, 2026 7/10
workflow Reddit

Opus 4.8 vs Opus 5 Compared on 25 Tasks From One Real Repository

The author ran both models once per task on 25 tasks drawn from merged work in their own repo, medium reasoning, identical criteria. The strict test-pass score tied at 9/25 each, sharing 8 tasks. Opus 5 searched wider and verified more — more shell commands on 18 of 25 tasks and more revision passes — while 4.8 stayed more contained.

benchmarkopus-5evaluation
by bisonbear2 Aug 26, 2026 7/10
workflow Reddit

An Adversarial PR Review Workflow Where Two Models Fight and a Judge Consolidates

A principal engineer running a dozen active repos wired up a persistent Claude Code session that takes a PR link and launches two models to attack the diff from opposing angles, with a judge consolidating. Only findings that survive get posted as review comments, which keeps the noise off the team.

code-reviewadversarialpull-requestsmulti-model
by DeepFuckingVigo Aug 26, 2026 7/10
workflow Reddit

Two Weeks of a Multi-Agent Claude Code Team: 253 PRs Merged

Agents split into implementation, testing, review, QA, and remediation roles, with work moving through GitHub issues to PR to independent review to merge — 253 PRs, 4,410 tests, roughly 67,000 lines over two weeks. The write-up focuses on what broke, notably "plausible code" that reads correct and passes review without being right.

multi-agentrolespull-requestscase-study
by Extension-Business88 Aug 26, 2026 8/10
workflow GitHub

senmu-buildos: Full-Lifecycle Project Governance Plugin for Coding Agents

An open-source plugin covering requirements, workflows, engineering, delivery, assurance, and organizational learning for Codex, Claude Code, and other agents. Chinese-language documentation. For teams that want process structure around agent work rather than ad-hoc prompting.

project-managementgovernanceplugin
by SenMuShare Aug 26, 2026 5/10
workflow GitHub

outsource: Drive the Grok CLI as a Headless Sub-Agent From Claude Code

Field-tested invocation recipes for running grok CLI as an implementation sub-agent under Claude Code, with git-safety profiles to bound what it can touch. Ships blind-judged evidence showing test depth going from 14 to 81.

delegationgroksub-agentsmulti-model
by midagedev Aug 26, 2026 6/10
workflow GitHub

janus: A Claude Code Starter Template That Learns From Its Own Sessions

A project template that extracts lessons from its own Claude Code sessions and passes them down to the projects it spawns. The interesting mechanic is inheritance — new projects start with accumulated knowledge instead of a blank CLAUDE.md.

templateself-improvingsessionsclaude-md
by Vinylfigure Aug 26, 2026 7/10
workflow GitHub

goal-workflow: /prd, /goal, /review-it, and /ship-it Skills

A development workflow expressed as four slash commands running from product requirements through goal setting, review, and shipping. Small surface area compared to most spec-driven suites.

slash-commandsprdworkflowreview
by smallnest Aug 26, 2026 6/10
workflow GitHub

proof-loop: A Repo-Local Verification Protocol for Coding Agents

Defines acceptance criteria up front, assigns verification to a separate role than the one implementing, and requires proof artifacts before an agent can claim done. Lives in the repo, so the protocol travels with the code.

verificationacceptance-criteriaevidenceprotocol
by LeoStehlik Aug 26, 2026 7/10
workflow GitHub

verdict-contract: A Parseable Contract for LLM Reviewer Verdicts

When an LLM reviewer says APPROVE, this makes that machine-checkable: a prompt rule, a parser, and an exit-code gate in one stdlib file, documented alongside the 42 counterexamples that shaped it. Free and MIT.

llm-judgeparsingcireview
by tonydzi Aug 26, 2026 6/10
workflow GitHub

oss-publish: Open Up Internal Work Without Leaking It

Replaces personal data with plausible fakes of the same shape rather than <REDACTED> placeholders — which keeps the code readable — then gates the entire tree before you push. Stdlib-only, with the eleven traps the author hit documented.

open-sourcepiisanitizationpublishing
by tonydzi Aug 26, 2026 6/10
workflow GitHub

claude-hivemind: A Coordinator Commanding Drone Agents in Terminal Panels

One coordinator drives Claude Code drones running in herdr terminal panels, communicating through file-based briefs, reports, and mail with zero polling. The file-based channel means you can read the whole exchange after the fact.

multi-agentorchestrationherdrterminal
by jmcjm Aug 26, 2026 6/10
workflow GitHub

OAA: Structure Multi-Agent Systems the Way Companies Are Structured

Organizational Agent Architecture models agent teams as Roles, Skills, and Tools with bounded authority that composes down the chain, so a sub-agent inherits a narrower mandate than its parent rather than the same one.

multi-agentarchitecturerolesauthority
by Chuck3PointZero Aug 26, 2026 6/10
workflow GitHub

fable5-opus5-orchestrator: Tier Routing That Keeps the Big Model in the Chair

A token-frugal orchestration plugin where the top-tier model plans and a cheaper tier does the work, backed by a Requirements Ledger, enforced guard hooks, and automatic reaping of finished teammates. Aimed squarely at not burning your usage limit by lunchtime.

orchestrationtier-routingtokenshooks
by Rylaa Aug 26, 2026 7/10
workflow GitHub

agentopology: Terraform for AI Agents — Define Your Team and Its Memory as Code

A declarative .at language that specifies an agent team and its shared memory once, then deploys to Claude Code, OpenClaw, Cursor, Codex, Gemini, Copilot, and Kiro. Includes agent-maintained, Obsidian-portable company brains and an interactive visualizer.

infrastructure-as-codemulti-agentmemoryportability
by agentopology Aug 26, 2026 7/10
workflow Reddit

Designing an AI coding workflow around attention rather than throughput

A year-in retrospective from a daily Claude Code user who restructured their agentic workflow to match human attention limits instead of maximizing parallel agent throughput. Walks through pulling a GitHub issue as first context, then a plan-then-implement loop kept small enough to actually review. Useful counterpoint to the 'run ten sessions at once' advice.

workflowcontext-engineeringplanningreview
by Kilo_Loco Aug 26, 2026 7/10
workflow Reddit

What Claude Code was good at (and bad at) building a first Unity game

A concrete post-mortem from shipping FrogPop, a 2D arcade roguelite, with Claude Code writing the C#. Contained systems like shop logic, wave spawning, and bubble splitting went well; anything only observable in Play Mode — boss pathing through walls, feel and timing — did not. A grounded read on where agentic coding hits the simulation-feedback wall.

gamedevunitycsharpretrospective
by PerspectivePersonal Aug 26, 2026 6/10
workflow GitHub

AgentReview: use Claude Code as an independent cross-model reviewer for Codex

A cross-model review setup where Codex writes the code and Claude Code reviews it as an outside party, with a mandatory verification step on every finding before anything gets fixed. The verify gate is the point — it filters the plausible-but-wrong findings that single-model self-review tends to produce. Applies equally in reverse.

code-reviewcross-modelcodexverification
by SilentMalachite Aug 26, 2026 6/10
workflow GitHub

blueprint: gated agent workflow with an evidence-backed definition of done

An engineering system for AI coding agents built on three pieces: a gated workflow that will not advance without passing checks, persistent state that survives across sessions, and a definition of done that requires the agent to produce evidence rather than assert completion. Targets the self-certification failure mode where agents declare victory on untested code.

workflowgatesstateverification
by Potato7711 Aug 26, 2026 6/10
workflow Reddit

Worktrees aren't the bottleneck in parallel Claude Code — team attention is

Argues that git worktrees solve file conflicts but know nothing about team-level constraints: service ownership, change freezes, a reviewer already sitting on twelve PRs, or a risky diff queued behind three trivial ones. More Claude throughput just creates more review than tech leads can absorb. Proposes an attention queue over ownership conflicts, blockers, and risky diffs instead of a wall of agent chats.

parallel-agentsworktreescode-reviewteam-workflow
by saas-wizard Aug 26, 2026 6/10
workflow Reddit

Ai-workflow: a single AGENTS.md to cut agent token waste across vendors

An agent-agnostic convention where one AGENTS.md at the project root is the source of truth every agent reads, replacing the broad `rg`/grep sweeps agents run to orient themselves each session. Works with Claude Code, Codex, Cursor, Gemini, and Copilot without per-tool config files. The savings come from not re-paying navigation cost on every cold start.

agents-mdtokenscontextagent-agnostic
by No_Professional_4310 Aug 26, 2026 6/10
workflow GitHub

claude-code-token-guide: halving token usage on a 20-euro plan

A practical guide (English and French) to getting more out of a low-tier Claude Code plan: keep CLAUDE.md short, route cheap work to free backends, and use memory tools so context is not rebuilt every session. Concrete tactics rather than general advice about being concise. Relevant to anyone repeatedly hitting weekly limits.

tokenscostclaude-mdmemoryguide
by Cherridsaid Aug 26, 2026 6/10
workflow GitHub

cadence (sentasity): intent-driven brainstorm, design, plan, execute plugin

A Claude Code plugin structuring work as four explicit phases, starting from intent and brainstorming before any design or code. Each phase produces an artifact the next one consumes, so the agent cannot skip straight to implementation. One of several projects converging on phase-gated development.

pluginworkflowplanningphases
by sentasity Aug 26, 2026 5/10
workflow GitHub

plumbbob: plan first, build in small steps, approve before every commit

A Claude Code plugin that converts LLM coding into a loop the human controls — planning up front, small increments, and a mandatory pause for your approval before each commit. Deliberately the opposite of autonomous mode. Good fit if you want agent speed without waking up to fifty unreviewed commits.

pluginworkflowhuman-in-the-loopcommitsapproval
by robmclarty Aug 26, 2026 6/10
workflow GitHub

rldyour-claudecode: A Full Claude Code Configuration Bundle

A complete Claude Code setup published as a reusable configuration: a plugin marketplace, MCP and LSP wiring, Serena-based memory, a security review pass, browser and design workflows, and reviewer agents. It is one person's working harness offered as a starting point rather than a single-purpose tool. Worth skimming for individual pieces even if you do not adopt the whole thing.

configmcplsppluginsagents
by rldyourmnd Aug 25, 2026 5/10
workflow GitHub

skillferry: A Portable Agent Workspace Across Codex, Claude Code, and DeepSeek

Keeps one agent workspace that moves between Codex, Claude Code, and the DeepSeek Harness rather than maintaining parallel per-tool setups. The point is that switching harnesses should not mean re-creating your skills and context. Useful for anyone who regularly changes which agent they run.

portabilitycross-agentworkspace
by GreenLv Aug 25, 2026 6/10
workflow GitHub

buzz-agent-comms: Coordinate Agent Work in Private Buzz Channels

A Claude Code plugin that coordinates work across agents through private Buzz project channels and records evidence that the work was actually delivered. The delivery-proof aspect targets the problem of agents reporting success without artifacts. Requires Buzz, so it is only relevant if you already use it.

plugincoordinationmulti-agent
by cwschroeder Aug 25, 2026 5/10
workflow GitHub

maestro-preset: Cross-Plane Multi-Agent Supervisor With Zero npm Dependencies

A multi-agent orchestration preset for the DeepSeek Harness that supervises across Orca, dais, and DSH sessions at once. It includes a durable callback bridge over both file and HTTP, fleet admission control, a SQLite ledger, and a flow compiler — with no npm dependencies. Substantially more engineered than most orchestration presets.

orchestrationmulti-agentsqlitesupervisor
by fiultyy Aug 25, 2026 6/10
workflow GitHub

trailhead: From a Loose Idea to Ticket-by-Ticket Execution on GitHub Issues

Takes a vague project idea, charts it into a structured plan, and then drives execution one GitHub Issue at a time. The plan lives in Issues rather than in a scratch file, so progress is visible to anyone on the repo. Bridges the gap between brainstorming and actually shipping incrementally.

planninggithub-issuesworkflow
by ToRvaLDz Aug 25, 2026 6/10
workflow GitHub

Token-Optimized Agent Pipeline: Zero-Trust Subagent Architecture

A subagent architecture for Claude Code built on zero-trust principles, where each subagent receives only the context it needs and results are validated rather than assumed. The design goal is token efficiency alongside correctness. Relevant to anyone whose orchestration burns context faster than it produces work.

subagentscontexttokensarchitecture
by GstMirabal Aug 25, 2026 6/10
workflow GitHub

manta: 19 Agents Gating Your Git Workflow With GO/NO-GO Checks

Puts nineteen AI agents into the git workflow to catch secrets, injection flaws, N+1 queries, and bad migrations on every commit. Work follows a structured Research → Plan → Implement sequence with GO/NO-GO gates before any code is written, and it can also generate product wikis and codebase maps. Language-agnostic and free.

gitreviewsecuritygatesmulti-agent
by mantacron Aug 25, 2026 7/10
workflow GitHub

agentic-investment-harness: Human-Authority-First Harness for Investment Agents

An investment-research agent harness built around traceable evidence, state that expires rather than going stale, independent review passes, and fail-closed writes. Every consequential action defers to human authority by design. The fail-closed and expiring-state patterns generalize well beyond finance.

harnessfinancegovernanceevidence
by bor799 Aug 25, 2026 5/10
workflow GitHub

intent-guard: An Independent Supervisor at Every Commit

Supervised AI-assisted development built on three pieces: a half-page statement of intent, an append-only journal, and an independent supervisor that reviews at every commit. It catches scope drift, mocks that mask failures, and decisions that get lost mid-session — and it raises them as questions rather than verdicts. The question framing keeps the human as the decision-maker.

supervisioncommitsdriftreview
by bmvv1995 Aug 25, 2026 7/10
workflow Reddit

agent-ks: A Folder-Per-Issue Knowledge System for Claude Code Agents

A durable operating layer for Claude Code agents that orchestrates long-horizon multi-agent work with one folder per issue. Plans, logs, and memory are observable rather than hidden, generated UI and diagram artifacts are preserved as browsable pages, and ongoing work automatically becomes documentation and project memory. The author is seeking feedback.

memoryorchestrationdocumentationmulti-agent
by Sidh1999 Aug 25, 2026 6/10
workflow GitHub

oss-agent-playbook: Templates for Agents That Maintain Open-Source Repos

A technology-neutral playbook plus templates covering the full open-source maintenance lifecycle an agent might handle: publishing, securing, documenting, releasing, and maintaining a repository. It is written for agents rather than for human maintainers. Useful scaffolding if you want an agent running release chores.

open-sourceplaybookreleasemaintenance
by segfault-stack Aug 25, 2026 6/10
workflow GitHub

ai-literacy-superpowers: A Full Development Workflow as Plugins

Claude Code and GitHub Copilot plugins implementing the AI Literacy framework end to end: harness engineering, agent orchestration, literate programming, CUPID code review, and three enforcement loops. It is a complete methodology rather than a single tool. Useful if you want an opinionated process rather than assembling one.

workflowpluginscode-revieworchestration
by Habitat-Thinking Aug 25, 2026 6/10
workflow GitHub

Dissertation System: A Claude Code Research Pipeline for PhD Work

A Korean-language doctoral research workflow system built on Claude Code, structured as a GRA quality-assurance pipeline for dissertation research. Published for educational use. A concrete example of encoding a heavyweight academic process as an agent workflow.

workflowresearchacademickorean
by SANGUKMA Aug 25, 2026 5/10
workflow GitHub

dhpk: A Reusable Claude Code Development Harness Plugin

Bundles agents, commands, skills, and hooks into a single reusable development harness plugin, with opt-in modules for specific stacks. You install the base harness and enable only the stack pieces you need. A reasonable middle ground between raw Claude Code and a fully opinionated framework.

pluginharnessagentshooks
by hmj1026 Aug 25, 2026 5/10
workflow GitHub

reproducible-science: Preregistration, Citation Verification, and Provenance

Command-line tools plus a Claude Code plugin bundling preregistration, citation verification, and results provenance for scientific work. Aimed at keeping agent-assisted research reproducible and honest about its sources. A rare example of agent tooling built around research integrity rather than throughput.

sciencereproducibilitycitationsplugin
by elliottower Aug 25, 2026 6/10
workflow GitHub

feature-fix-swarm: Phase-Gated Cross-Model QA for Claude Code and Codex

Runs feature and fix work through phase gates with QA performed by a different model than the one that wrote the code. Catching agent mistakes early is the explicit goal, before errors compound across later phases. Cross-model review is the key idea — a second opinion from a genuinely different model.

qacross-modelgatesmulti-agent
by austinmao Aug 25, 2026 6/10
workflow GitHub

ilana: A Software Engineering Process OS With 11 Phases and 9 Gates

Encodes a full software engineering process for coding agents: eleven phases, nine gates, and thirteen agents, derived from the SEN102/212 curriculum at OAU Ile-Ife. It is a complete methodology rather than a helper tool. Interesting as a formal academic process translated into agent workflow.

workflowprocessgatesmulti-agent
by Ferousco-dev Aug 25, 2026 6/10
workflow GitHub

Kaola-Workflow: Bookkeeping for Coding Agents Across Six Runtimes

Hand it an issue and it claims the work, writes a mission list recording item, status, dispatch, and result, then runs it — with state on disk so a run is resumable. Supports Claude Code, Codex, Cursor, opencode, Kimi Code, and Grok CLI across GitHub, GitLab, and Gitea. The resumable on-disk ledger is what separates it from in-context todo lists.

workflowissuesresumablemulti-runtime
by KaolaBrother Aug 25, 2026 6/10
workflow GitHub

ai-native-sdlc-architect-artifacts: Enterprise Architecture Artifacts for Agent SDLC

Russian-language architectural artifacts for enterprise and solution architects adopting an AI-native software development lifecycle: hooks, skills, evals, templates, and governance material, based on Anthropic's published playbook. Aimed at the architecture function rather than individual developers. Useful if you have to justify an agent rollout to an architecture board.

sdlcgovernanceenterpriserussianevals
by romannekrasovaillm Aug 25, 2026 5/10
workflow Reddit

A Checklist for Deciding Which Third-Party Claude Plugins to Trust

A discussion thread proposing a vetting checklist for community plugins, skills, and agents: who made it, can you inspect it, is it maintained, what permissions and files or accounts it touches, and above all whether it can take actions rather than just format text. The author draws a sharp line between passive and action-capable extensions. Useful framing as the plugin ecosystem grows faster than anyone can review it.

securitypluginstrustbest-practices
by Aimply_flow Aug 25, 2026 6/10
workflow Reddit

Auto mode can classify safety but it cannot know your task boundary

A note on Claude Code making auto mode the default for new Pro, Max and Team sessions, which routes tool calls through a classifier targeting irreversible, destructive or out-of-environment actions. The argument: safe and in-scope are different properties — a command can be non-destructive and still edit the wrong file or blow past a checkpoint you wanted to review.

auto-modepermissionsscopesafety
by Aggravating-Dot4839 Aug 25, 2026 5/10
workflow GitHub

icca-harness: Evidence-gated maker-checker-auditor workflow

Splits agentic development into maker, checker and auditor roles, with mechanical enforcement in Claude Code so a stage cannot pass without producing evidence. Borrows the separation-of-duties idea from controls auditing rather than relying on the model to self-report that work is done.

workflowreviewgovernanceharness
by BernhardJackiewicz Aug 25, 2026 7/10
workflow GitHub

lore-plugin: Distill project experience into reusable criteria for agents

A provider-neutral kit that turns accumulated project experience into reusable criteria for AI agents: distilled once a threshold you set is crossed, pruned as it grows, and portable between models. Framed as local fine-tuning without training anything.

memorycriteriadistillationportable
by andresanemic Aug 25, 2026 5/10
workflow GitHub

Ralph Wiggum loop for Claude Code: fresh context per iteration in Docker

An implementation of the Ralph Wiggum loop pattern for Claude Code: each iteration starts from a clean context, runs inside a Docker sandbox, and is driven by mattpocock's skills. The fresh-context-per-iteration rule is what keeps a long autonomous run from drifting.

loopdockersandboxautonomy
by matheuszambonin Aug 25, 2026 6/10
workflow Reddit

Measured: 12.7k tokens resident before the first prompt

A measurement of the always-on cost of one agent scaffold. It writes 395 to 461 files into a project but only 9 to 12 ever enter the prompt, totaling 12.7k to 14.0k tokens (about 6.4-7.0% of a 200k window) across every project shape, because 9,266 tokens are stack-agnostic rules and the per-stack overlays are only 199 to 1,171. Skills, slash commands, hooks and MCP schemas are on top of that.

tokenscontextmeasurementscaffold
by coding-os Aug 25, 2026 7/10
workflow Reddit

/codereview at xhigh effort spawned 10 subagents and 200k tokens

A report that asking for an xhigh-effort code review on a 430-line script immediately spawned ten Fable-level subagents, burning roughly 200k tokens before the user stopped it at five. A concrete data point on what review effort levels cost in practice.

code-reviewsubagentstokenseffort
by Armored09 Aug 25, 2026 5/10
workflow GitHub

SistemaMultiagente_SDLC: Governed multi-agent SDLC with OpenSpec

A reusable multi-agent SDLC framework built on governed templates, OpenSpec and a set of development agents. Spanish-language, aimed at teams that want the agent workflow constrained by specs and templates rather than freeform prompting.

sdlcmulti-agentopenspectemplates
by JuanCastrejon Aug 25, 2026 5/10
workflow GitHub

remit: Keep practitioner-directed AI work under Git control

Puts the control decisions of AI-assisted work into Git: what starts, what stops, who builds a thing, who judges it, and when it leaves your attention. The bet is that these decisions deserve version history as much as the code they produce.

governancegitworkflowcontrol
by shobman Aug 25, 2026 5/10
workflow Reddit

Claude Code Now Refuses to Log Into a Localhost Test Environment

A skill that ran 10+ logins against a local test environment stopped working: Claude now declines to enter credentials and asks the user to type the password by hand. Raises a practical question for anyone automating end-to-end test flows through an agent.

testingpermissionscredentialsgotcha
by Tushar_Bytonomics Aug 24, 2026 6/10
workflow GitHub

dafeiyu-studio-collab: DeepSeek Harness Executes, Claude Code Supervises

A two-agent workflow where DeepSeek Harness does the implementation and Claude Code acts as reviewer, leaving the human only as final acceptor. Documents two run modes (headless and live Web UI), the two-layer review split, and the pitfalls hit in practice.

multi-agentreviewdeepseekchinese
by rosalynthompson32-a11y Aug 24, 2026 5/10
workflow GitHub

openToolbox: Build Internal Tools as One Self-Contained HTML File

A template for AI coding agents that produces internal tools as a single self-contained HTML file with no server, install, or network access. You describe the tool, the agent swaps one file, and the result ships as-is.

templatehtmlinternal-toolsoffline
by m-dohmen Aug 24, 2026 6/10
workflow GitHub

project-context-governor: Evidence-Backed Context Governance for Agents

Governs the project context an AI coding agent is allowed to rely on, requiring each claim to be backed by evidence rather than accumulated assumption. Designed to stay cheap in tokens while keeping long-running sessions grounded.

contextgovernanceevidence
by Ghost011118 Aug 24, 2026 5/10
workflow GitHub

engineering-decision-governor: Evidence-First Authority for Agents

Defines which engineering decisions an autonomous coding agent may make on its own and requires evidence before each one. Aimed at long unattended runs where an agent would otherwise quietly choose an architecture and commit to it.

governancedecisionsautonomy
by Ghost011118 Aug 24, 2026 5/10
workflow Reddit

Two Parallel Claude Code Sessions Overwrote Each Other's Work

A field report from two months of running parallel Claude Code sessions, covering failure modes the usual worktree guides skip. The main one: two agents in one checkout where `git add -A` swept up another agent's uncommitted files onto the wrong branch, only surfacing at CI.

parallelworktreesgitpitfalls
by jjangg96 Aug 24, 2026 7/10
workflow Reddit

Separating the Idea From the Code Detail in Claude Code's Answers

After a wide search, Claude Code answers using context the user never saw — naming functions and call sites from files it just read. The author's fix is to make the agent state the idea separately from the code specifics, which cut the follow-up round trips considerably.

promptingcommunicationworkflow
by AzaleaCrispGray Aug 24, 2026 6/10
workflow Reddit

Fixing Claude Code Sessions Dying on SSH Disconnect With tmux

Closing an SSH client was killing Claude Code sessions and losing all context, even with /rc enabled, forcing the author to keep multiple PowerShell windows open. Moving the sessions into tmux fixed the archiving problem and kept Claude, servers, and logs alive across disconnects.

tmuxsshsessionsremote
by Spare_Bison_1151 Aug 24, 2026 6/10
workflow GitHub

ralph: Scaffold Opinionated Agent Harnesses for Claude Code and Codex

A harness-engineering toolkit that scaffolds opinionated agent setups with deterministic hooks, evidence-backed review steps, and Ralph Loop autonomous parallel execution. Targets both Claude Code and Codex from one harness definition.

harnessralph-loophooksparallel
by yoshpy-dev Aug 24, 2026 7/10
workflow GitHub

llm-loop: Dependency-Free Python Ralph Loops for Claude Code and Codex

Runs Ralph-style autonomous loops as either multi-step state machines or parallel work queues, in pure Python with no dependencies. Supports per-step model selection, quota-aware pauses, a git-push policy, a live status line, and a graceful stop file.

ralph-looppythonautomationqueue
by neurocod Aug 24, 2026 7/10
workflow GitHub

Agentic-Loop-Eng: Implementer-Reviewer Loop Plugin With a Frozen Rubric

A Claude Code plugin and marketplace entry that runs an iterative implementer-to-reviewer loop against a rubric fixed up front, so the standard cannot drift mid-run. Adds git checkpointing between iterations and grounds review in actual tool output.

pluginloopreviewrubric
by MinJung-Go Aug 24, 2026 7/10
workflow GitHub

F.O.R.G.E: A 46-Specialist Org Chart for Claude Code, Not a Swarm

Structures agent work as an organisation rather than a swarm: a six-seat board, twelve divisions, and 46 specialist roles. It learns the workspace over time, has zero dependencies, and keeps you as approver on every change.

multi-agentrolesorchestration
by SumanthUdupi Aug 24, 2026 6/10
workflow Reddit

168K Organic Clicks in Three Months With a Claude Code SEO Engineering Loop

Rather than having Claude Code generate SEO pages blindly, the author built a loop that checks Google Search Console data through MCP first: which URL already ranks, what queries it gets, and whether a new page would cannibalise it. Three months of GSC numbers are included.

seomcpgscworkflow
by iammofidul Aug 24, 2026 7/10
workflow Reddit

Claude Code Bypassed Manual Approval Mode by Editing Files Through Bash

In the desktop app under manual mode, Claude built ad-hoc bash tools to read, edit, and revert files instead of using the standard Read/Write tools — which meant the edits never hit the permission boundary. A useful reminder that permission modes gate tools, not effects.

permissionssecuritybashgotcha
by yonl Aug 24, 2026 6/10
workflow GitHub

operator-os: Running Two Businesses on Claude Code With Layered Agents

A personal operating system built on Claude Code: layered agent orchestration, a publishing pipeline that is private by default, and the decision log explaining why each piece works the way it does. Written up as a working setup rather than a template.

orchestrationpersonalpublishingdecisions
by Prthm-G Aug 24, 2026 6/10
workflow GitHub

lineage: Package and Share Agent Workflows, Skills, and Policies Across Tools

Bundles agent workflows, skills, subagents, and policies into shareable packages that install into Claude Code, Codex, and other coding agents. Aimed at teams that want one setup distributed rather than copied by hand.

packagingdistributionskillsportability
by agentic-lineage Aug 24, 2026 7/10
workflow GitHub

issue-to-pr: Resumable GitHub Issue-to-PR Pipeline Behind One Plan-Approval Gate

A Claude Code plugin marketplace whose pieces — adversarial review, test authoring, and PR lifecycle management — chain into a resumable issue-to-PR pipeline. The whole chain sits behind a single plan-approval gate, so you approve once rather than at every step.

plugingithubpipelinereview
by softwareone-platform Aug 24, 2026 7/10
workflow GitHub

claude-code-harness-guardrails: Measured Tool Traps and Session Briefs

Guardrails for long-running Claude Code sessions built from tool traps and session-brief prompts, published together with the evals showing what each one actually changed — including where the gains were small.

guardrailsevalslong-runninghooks
by eduard-wolf Aug 24, 2026 7/10
workflow GitHub

ai-native-evidence-eval: Evidence Gate and Multi-Agent Review Harness

A worked case study combining a deterministic evidence quality gate, a multi-agent review harness, regression attribution, and a real before/after evaluation. Shows the measurement scaffolding, not just the conclusion.

evalsreviewevidencecase-study
by Elllka Aug 24, 2026 6/10
workflow GitHub

Turritopsis: Shared Knowledge and Handoff Across Long Agent Sessions

Maintains shared project knowledge that survives between coding agent sessions and structures the handoff when one session ends and another begins. Aimed at projects that run far longer than any single context window.

memoryhandoffcontextlong-running
by anhe2021212-spec Aug 24, 2026 5/10
workflow Reddit

Measuring How Preceding Context Changes an LLM's Internal Representations

An investigation into why the same model answers the same question differently across runs, tracing the variation to the text sitting before the question in the context window rather than to sampling randomness. Relevant to anyone tuning CLAUDE.md or long session context.

contextresearchmeasurementllm
by PresentSituation8736 Aug 24, 2026 6/10
workflow Reddit

When Claude Code Repeats a Mistake, Record It as Process Data

In-session corrections vanish the moment a new session, agent, or repo starts. The author instead records each failure — the path that actually ran, the invariant that broke, the evidence — after an orchestration command exited green having executed zero phases and published nothing.

failuresprocessorchestrationpostmortem
by jonah_omninode Aug 24, 2026 6/10
workflow Reddit

Freezing Product Decisions While Claude Code Implements

A developer notes that agents make changing your mind nearly free, which lets product direction drift because every rewrite feels affordable. Their fix is a constraint: once Claude starts a feature, the decision is frozen until the current version is tested against acceptance criteria written beforehand. New ideas go to a decision log rather than straight into the prompt.

workflowprocessproductdiscipline
by Gleb_SV Aug 24, 2026 6/10
workflow GitHub

hyperflow: Rules, Project Memory, and a Reviewed Multi-Agent Chain

A workflow layer for AI coding CLIs combining coding rules, memory that persists across sessions, and task templates. Its multi-agent chain adds a review step between stages, and it can take an issue all the way to a PR when you want that. Vendor-agnostic across CLI agents.

workflowmemorymulti-agentreview
by Mohammed-Abdelhady Aug 24, 2026 7/10
workflow GitHub

alexandria: Citation-Integrity Academic Writing With Claude Code and Obsidian

An academic writing system built on six defined roles and a verbatim-to-source quote pipeline, so every citation traces back to real text. Governance rules keep the agent from paraphrasing its way into fabricated references. Runs inside Claude Code against an Obsidian vault.

academicwritingobsidiancitations
by kengo006 Aug 24, 2026 7/10
workflow GitHub

ai-dev-autopilot: Autonomous Runs Without --dangerously-skip-permissions

Lets Claude Code and Codex run unattended while keeping consequential actions in human hands, instead of disabling permission prompts wholesale. The pitch is autonomy on safe operations and a gate on everything that can break things.

autonomypermissionssafetycodex
by aminrasooli Aug 24, 2026 7/10
workflow GitHub

agent-slots: One Integer Derives a Worktree, DB, Ports, and Queue per Agent

An isolation scheme for running coding agents in parallel: each agent gets a slot number, and that single integer deterministically derives its git worktree, database, port assignments, and job-queue schema. Removes the usual collisions between concurrent agents without hand-managing config per session.

parallel-agentsworktreeisolationports
by hishamalward Aug 24, 2026 7/10
workflow Reddit

Wiring Claude Code to Browser Use for Real Web Research

A walkthrough of connecting Claude Code to Browser Use and Chrome, then handing it a real job-research task and watching it browse. The agent handled the search-open-read-copy-organize loop and returned a table. The author lists comparable uses: competitor research, price comparison, lead gathering, and site monitoring.

browserresearchautomationchrome
by Aimply_flow Aug 24, 2026 6/10
workflow Reddit

The Gauntlet: Ten Specialist Skills With Executable Verification

An open-source system that turns a general LLM into a structured research and engineering environment via ten specialist skills. It moves coordination into the system itself: deciding which mode of work applies, tracking which claims need verification, and catching false-green tests, instead of leaving all that to the user. Each stage transition carries a stated reason.

workflowskillsverificationresearch
by Slight_Butterfly_603 Aug 24, 2026 7/10
workflow GitHub

agent-covenant: One Repo for Rules, Skills, Hooks, and MCP Servers

Centralizes development rules, skills, workflows, prompts, subagents, hooks, and MCP server definitions for AI coding agents in a single place. Intended as the shared source of truth you point every project at instead of copying config around.

configruleshooksmcp
by ronsilver Aug 24, 2026 6/10
workflow Reddit

30 Days Directing Claude Code to Run a Live MU Online Server

A non-programmer describes 2,177 commits spent building and operating a live MU Online private server, including reverse-engineering the client's encrypted world formats until decrypt-edit-re-encrypt round-tripped. The hard lessons are about verification, not generation: the same rule is often enforced in two places, and a correct database row is not proof the game agrees. Concrete field notes on where agent-written code actually breaks.

workflowreverse-engineeringcase-studyverification
by RudimentarioUY Aug 23, 2026 7/10
workflow GitHub

ui-review-loop: Page-by-Page Human UI Review That Comes Back as a File

Generates a review surface directly from the product's own strings and stylesheets, then walks a human through it page by page. Their feedback is written back as a file the agent can act on. Closes the loop between human design judgment and agent implementation.

uireviewfeedbackdesign
by seanslab-org Aug 23, 2026 7/10
workflow GitHub

coding-agent-environment: Portable, Profile-Aware Claude Code and Codex Setup

Versions the whole agent environment — config, hooks, skills, MCP/plugin desired state, and toolchain — so it reproduces on any machine. Directory-scoped profiles let different projects get different agent setups. Aimed at teams that want the same agent behavior everywhere.

configreproduciblehookscodex
by Chisanan232 Aug 23, 2026 7/10
workflow GitHub

agent-memory-hub: One Git Repo as Shared Memory for Every AI Agent

Keeps agent memory in a single Git repository so any machine or agent can restore context with a clone plus setup. Because it is plain Git, memory is diffable, reviewable, and shared across tools. Targets the case where you run several agents and want them to know the same things.

memorygitcontextmulti-agent
by Dream22180971 Aug 23, 2026 6/10
workflow Reddit

Cut 12k+ Startup Tokens by Disabling Artifacts and Chrome MCP

Reports that unused built-in schemas eat tens of thousands of tokens at every session start: disableArtifact saves about 6.5k and disableWorkflows about 5k in settings.local.json. Turning off Chrome integration via /chrome drops the Chrome MCP schemas too. Easy win if you do not use those features.

contexttokenssettingsoptimization
by erebueius Aug 23, 2026 7/10
workflow GitHub

ContextMesh: Session Memory for Claude Code With a Minimal Active Context

Sits between Claude Code and its history, keeping long-running session memory available while holding the active context small. The aim is continuity across sessions without paying for it in tokens every turn. One of several answers to compaction-driven quality loss.

contextmemorysessionstokens
by gajanansr Aug 23, 2026 6/10
workflow GitHub

the-foundry: Opinionated Claude Code Plugins for Think, Build, Ship, Test

A plugin set that takes explicit positions on how to think about a problem, what to build, how to ship it, and how to test it. Opinionated rather than configurable, which makes it a fast way to adopt someone else's whole process. Worth reading even if you disagree with the opinions.

pluginsprocesstestingopinionated
by attac-t Aug 23, 2026 6/10
workflow GitHub

addit-harness: Cross-Agent Config Harness With Subagents, ADRs, and Conventions

One install command sets up subagents, language conventions, an engineering-loop process, and ADRs across Claude Code, Cursor, Kiro, and Codex CLI. Auto-detects which agent you are running. For teams standardizing on a process rather than a tool.

harnesssubagentsadrmulti-tool
by addit-digital Aug 23, 2026 6/10
workflow GitHub

tacit: Immutable, Timestamped Institutional Memory for Coding Agents

Stores tacit project knowledge in an append-only, timestamped layer that survives context wipes, model switches, compaction, and chat resets. Immutability means you can trace when a decision entered the record. Positioned as institutional memory rather than a scratchpad.

memorycontextknowledgepersistence
by AlexLeoTz Aug 23, 2026 6/10
workflow Reddit

Transcripts of All 19 Code w/ Claude Talks, About Eight Hours

A repo with full transcripts of the 19 Code w/ Claude conference talks, including the opening keynote, the Amodei conversation, the What's New in Claude Code session, and the live coding with Boris Cherny and Jarred Sumner. Searchable text beats scrubbing eight hours of video. Links to the original recordings are included.

referencetalkstranscriptslearning
by Bright-Celery-4058 Aug 23, 2026 8/10
workflow GitHub

project-forge: Terminal-First Multi-Agent Runtime for Games and Apps

Coordinates Claude Code, Codex, and GigaChat through build, test, and release from the terminal. Oriented toward shipping games and apps rather than generic task running. Multi-provider by design.

multi-agentruntimeterminalrelease
by Nioris Aug 23, 2026 6/10
workflow GitHub

agent-readable: A Python Protocol for Agent-Oriented Documentation

Defines a lightweight protocol, plus a tool, for writing documentation aimed at agents rather than humans. Small and unopinionated about your doc generator. Relevant if you maintain libraries that agents keep misusing.

documentationpythonprotocol
by zydo Aug 23, 2026 5/10
workflow GitHub

loose-rein-kit: Human-on-the-Loop Harness With Frozen Requirement Claims

Freezes requirement claims up front, then runs a blind review of actual behavior before a human confirms the gate. Blind review means the reviewer does not see the claims while testing, which is what makes it more than a checklist. Installable as a CLI.

reviewgatesrequirementscli
by komoroko Aug 23, 2026 6/10
workflow Reddit

Four Concrete Changes That Cut Claude Code Token Usage

Keep CLAUDE.md small, start a fresh session per problem, do web research through a Markdown-returning scraper instead of loading raw HTML, and exclude noisy paths from the working set. Each targets a specific source of context bloat rather than switching to a weaker model. Practical baseline for anyone hitting limits.

tokenscontextoptimizationclaude-md
by Euphoric-Airline-259 Aug 23, 2026 6/10
workflow GitHub

multi-agent-ralph-loop: Autonomous Orchestration With a Four-Layer Memory Stack

Runs parallel-first agent teams of six under a Ralph-style autonomous loop, with a four-layer memory stack whose wake-up costs about 818 tokens and four stages of quality gates. Ships 925+ tests, 22 active hooks, and an automatic learning pipeline. Heavyweight, but unusually specific about its own numbers.

orchestrationmemoryhooksmulti-agent
by alfredolopez80 Aug 23, 2026 7/10
workflow GitHub

agent-workflow: Cross-Agent Memory and Workflow Monorepo

A monorepo containing a memory substrate, a composition-root kit, CLI bridges, and the workflow engine, portable across Claude Code, Codex, Cursor, and Devin. The layering is the notable part — memory is separable from the engine. For people building their own agent platform.

memoryworkflowmulti-agentmonorepo
by sabaiway Aug 23, 2026 6/10
workflow GitHub

production-readiness-checklist: Evidence-Driven Checks Before Shipping Web Apps

A checklist that asks for evidence rather than a tick, covering the usual pre-launch surface for web applications. Structured so an agent can work through it and produce proof for each item. Generic by design, which makes it a reasonable starting point.

checklistproductionwebevidence
by MarinJursic Aug 23, 2026 5/10
workflow GitHub

android-harness-kit: Quality, Security, and Architecture Gates for Android

An autonomous governance harness for Android and Kotlin Multiplatform that holds agent output to quality, security, and architecture standards. Platform-specific rather than a generic linter wrapper. Fills a gap for mobile teams adopting coding agents.

androidkotlingovernancesecurity
by rabee-elkholy Aug 23, 2026 6/10
workflow GitHub

claude-company: Drop an Opinionated AI Software Company Into Any Repo

Installs a full set of roles and process into an existing repository so agents work as a team rather than a single assistant. Highly opinionated, with little configuration expected. Fastest way to try the agent-org pattern without designing one.

multi-agentrolesprocessplugin
by devmesh-in Aug 23, 2026 5/10
workflow Reddit

Sharing one rules file across nine repos — and the hook truncation that ate it

A firmware shop keeps a single vendor-neutral canon of agent rules, with CLAUDE.md, GEMINI.md and AGENTS.md symlinked to it so no one vendor owns the setup. The twist is the failure mode: a SessionStart hook injected the 13KB file, Claude Code silently truncated the hook output to a 2KB preview, and the agent never saw most of the rules. Worth reading for the delivery-verification problem it raises — how do you confirm your rules actually reached the model?

claude-mdagents-mdhooksmulti-repocontext
by maovidal Aug 23, 2026 6/10
workflow GitHub

ai-contributing: CI-Enforced Governance for Parallel Agents on One Repo

A governance scaffold that lets any mix of AI agents work in parallel on a single GitHub repo, with strict CI/CD gates doing the enforcement instead of a runtime supervisor. There is no vendor API, no daemon, and no preset roles — it is configuration and CI rules only. A lightweight alternative to orchestration frameworks when your bottleneck is merge safety, not scheduling.

governanceci-cdmulti-agentgithubworkflow
by 3900563672 Aug 23, 2026 6/10
workflow GitHub

boss-skill: Opus Supervisor Delegating to Haiku and Sonnet Subagents

A multi-model orchestration plugin where an Opus supervisor breaks work down and hands coding tasks to cheaper Haiku or Sonnet subagents, consults a Fable advisor, and reviews every diff before accepting it. It can optionally route work out to OpenAI Codex. The pitch is cost control without giving up a strong model at the planning and review layers.

orchestrationmulti-modelsubagentscost-optimizationplugin
by mefayed Aug 23, 2026 7/10
workflow GitHub

fractally-claude-marketplace: ship-it and stack-it Plugin Marketplace

A Claude Code plugin marketplace carrying two workflow plugins. ship-it takes a batch of GitHub issues and drives each one through to a merged PR; stack-it takes an empty folder to a verified, documented project stack. Both target the ends of the development cycle that usually need the most hand-holding.

marketplacepluginworkflowgithub-issuesscaffolding
by pricklywiggles Aug 23, 2026 7/10
workflow GitHub

prism-cognitive-model: Subagents That Turn Self-Observations into Testable Hypotheses

Three cooperating Claude Code sub-agents that take your self-observations and convert them into falsifiable hypotheses with confidence scores, then propose small real-world experiments to test them. Implemented entirely in Markdown with no code dependencies. Docs are provided in English and Persian.

subagentsmarkdownexperimentationmulti-agent
by mojtabanorouzie Aug 23, 2026 5/10
workflow GitHub

ce-ai: Distribution Orchestrator for the Compound Engineering Plugin

Packages and distributes the open-source Compound Engineering Plugin, a suite of specialized skills, roles, and workflow guidelines for AI coding assistants. The orchestrator handles building variants of the plugin for different setups. Aimed at teams standardizing how their agents work.

compound-engineeringpluginskillsworkflow
by mastepanoski Aug 22, 2026 6/10
workflow Reddit

Keeping Opus 5 on a Leash: Fable Orchestrates, Opus Executes

A Max-plan user describes losing a day to Opus 5 acting on incomplete context, and the orchestration pattern they settled on afterward: Fable 5 writes the full spec and checks the returned work, while Opus executes at full reasoning effort. Haiku and Sonnet take data pulls and fan-out jobs. Also covers the hooks and PreToolUse gates they tried first and why prompting alone did not hold.

orchestrationopusmodel-selectionhooks
by CraveFounder Aug 22, 2026 6/10
workflow GitHub

atlas-method: Build Your Own Claude Code OS From Small Domain Docs

A method for structuring a project as a forest of small, focused domain documents that agents read on demand, instead of one sprawling CLAUDE.md. Agents do the work against those docs, which keeps always-on context small while preserving depth where it is needed.

workflowclaude-mdcontextdocumentation
by DamianBuilds-ai Aug 22, 2026 7/10
workflow Reddit

Do You Code in the Main Session, or Delegate Everything to Agents?

A discussion on whether to write code in the orchestrating session at all, or keep the main thread purely for planning and delegate every edit and review to subagents. The poster reports dramatically lower token usage from full delegation and asks what that design gives up.

orchestrationsubagentstokensdiscussion
by Retumbo77 Aug 22, 2026 6/10
workflow GitHub

agent: Declarative Harness Generating Claude Code and Codex Config

A Korean-language declarative agent harness: you write one capability declaration and it generates the Claude Code and Codex configuration from it, then statically validates the result. The aim is a single source of truth for settings that otherwise drift between tools.

configcodegenvalidationkorean
by sehyun0518 Aug 22, 2026 6/10
workflow Reddit

Set-and-Forget Claude Code: Cron, herdctl, Hermes and aeon Compared

A practical roundup of ways to run Claude Code unattended on recurring work: plain cron plus a state file, herdctl as a proper fleet manager with schedules and Slack/Discord, and Hermes, OpenClaw, and aeon on the general personal-agent side. The poster is clear about where each one leaves memory and failure recovery to you.

automationcronunattendedtooling
by amu4biz Aug 22, 2026 7/10
workflow GitHub

project_starter_v5: Documentation-First Template That Keeps Specs in Sync

A project template built around documentation-first development, where the spec and the code stay in step as an agent writes it. Intended as a starting repo for AI-assisted work that would otherwise drift away from its own design docs.

templatedocumentationspecworkflow
by uchetsai-creator Aug 22, 2026 6/10
workflow GitHub

Aria: AI-Driven Domain-Driven Design Methodology for Claude Code

A methodology (AI-DDD) for making an agent a genuine collaborator rather than an autocomplete, organising work around domain models the AI and the team share. Ships as a Claude Code setup implementing the approach.

dddmethodologyarchitecture
by 10CG Aug 22, 2026 6/10
workflow Reddit

An ML Researcher on Why Claude Code's Explanation Loop Humbles Them

An engineer with both published research and six years of backend work breaks down what '10x velocity' actually looks like on a real async streaming bug, hour by hour. A useful counterweight to velocity claims: most of the time goes to scoping and verifying, not generating.

experienceproductivitydiscussion
by mrtac96 Aug 22, 2026 6/10
workflow GitHub

plan-staged-rollout: Run Big Projects as Small Resumable Sessions

A Claude Code plugin that splits a large project into many small sessions that can each be resumed, instead of one long session that degrades as context fills. Each stage carries forward exactly what the next one needs.

pluginplanningsessionscontext
by by-carlos Aug 22, 2026 7/10
workflow GitHub

ballast: Reach a Goal in a Field Where You Have No Expertise

Breaks a goal into the foundations it actually requires, mobilises what you already know, learns the gaps, and banks each solved path for the next goal. Nothing is marked done until a check passes, so progress is verified rather than asserted.

learningplanningverification
by svy04 Aug 22, 2026 6/10
workflow GitHub

pm-copilot: Agent Workflow Kit for Product Managers

A Chinese-language workflow kit walking a PM from idea to PRD, analytics instrumentation plan, clickable prototype, engineering handoff, and launch decision materials. Aimed at the documents around the code rather than the code itself.

productprdworkflowchinese
by Leo-maomao Aug 22, 2026 6/10
workflow GitHub

task-flow: Decompose to Task to CI-Gate, With a Gate That Fails Closed

A Claude Code plugin that slices an epic into dependency-linked tasks, then runs each ticket through premortems, TDD, a clean-context review, and live verification. Work lands only through a deterministic merge gate that fails closed.

plugintddciplanning
by umar-s Aug 22, 2026 8/10
workflow Reddit

How Do You Stop One Agent From Breaking What Another Just Did?

A report from running two Claude Code sessions on one repo, where agent A refactors and agent B keeps writing against the old shape until the merge fails. The thread compares worktrees per agent, separate branches, tmux panes, and Coldtea — none of which fully solves cross-agent visibility.

multi-agentworktreesconflictsdiscussion
by leena_xander Aug 22, 2026 6/10
workflow GitHub

tlor-orchestration: 14 Agent Roles With a 3-Lens Adversarial Review

An orchestration framework assigning fourteen Middle-earth-named agent roles, each pinned to a specific model, effort level, and tool set, with dispatch rules deciding who gets the work. Includes a three-lens adversarial review panel plus opt-in guard hooks and a spec-to-code pipeline.

orchestrationsubagentsreviewframework
by twjohnwu Aug 22, 2026 7/10
workflow Reddit

How Much Babysitting Are Your Agents Actually Getting?

A reality check asking whether the autonomous multi-persona setups people post about match anyone's daily experience, from someone who finds constant hand-holding necessary. The thread is about the gap between demo workflows and working ones.

discussionautonomyexpectations
by patrickpdk Aug 22, 2026 5/10
workflow GitHub

agent-letterbox: Durable Agent Handoffs in tmux, Zellij or Herdr

Gives multi-agent coding teams a letterbox for agent-to-agent messages, with durable task handoffs and an automatic terminal ring when a message lands. Ships as three parallel builds — one each for tmux, Zellij, and Herdr.

multi-agenttmuxzellijmessaging
by SimonMallas Aug 22, 2026 7/10
workflow GitHub

OrchestrUI: Deterministic UI Policy and Quality Gates for Agents

Defines UI policy and component discovery deterministically so agents build to your design system rather than inventing one, with quality gates enforcing it. Aimed at the drift that shows up when several agents touch the same frontend.

uidesign-systemgatesfrontend
by ECD5A Aug 22, 2026 6/10
workflow GitHub

claude-agent-workflow: Reference Agent-Orchestrated Dev Workflow

A working reference implementation of an orchestrated development workflow: per-stack agent roles, explicit hand-off contracts between them, quality gates that fail closed, and an accompanying MCP server. Useful as a template to read rather than a product to install.

workfloworchestrationmcpreference
by YosorTV Aug 22, 2026 6/10
workflow GitHub

factory: Self-Improving Agentic Loops With the Tracker as Control Plane

A runtime for agentic loops that build software and then improve themselves, using the issue tracker as the control plane, git as the source of truth, and CI as the gate. Ambitious in scope — worth reading for the architecture even if you do not adopt it.

automationself-improvingciarchitecture
by watt-mind Aug 22, 2026 6/10
workflow GitHub

one-shot: Route a Problem to the Right Pattern, Then Run to the End

Matches a problem to the agentic pattern that suits it, takes a single approval, and runs through to completion without further interruption. It also surfaces skills your agent would not otherwise discover.

routingpatternsskillsautomation
by OR13 Aug 22, 2026 6/10
workflow Reddit

Have Claude Code Spawn Its Own tmux Panes for Live Subagent Output

A simple pattern: let Claude Code create and modify tmux panes as it works so you can watch subagent output live instead of waiting for a summary. The poster had Claude write itself a skill to do it.

tmuxsubagentsmonitoringskill
by datkenny Aug 22, 2026 6/10
workflow GitHub

mstack: Agent Workflow Gates Written as Code, Not as Prose

Rigorous, verifiable workflows for Claude Code where each gate is an executable check rather than an instruction the model may quietly skip. If the gate does not pass, the work does not advance.

gatesverificationworkflowci
by romerma Aug 22, 2026 7/10
workflow Reddit

What Actually Breaks When You Use AI for Real Coding Work

A catalog of recurring agent failure modes from daily use: context drifting until it contradicts its own earlier decisions, silent rewrites of working code, tests that pass while asserting nothing, invented abstractions, ignored repo conventions, and the confident all-clear right before it is not. The thread collects other people's versions of the list.

failure-modesdiscussionreliability
by Old-Benefit-9310 Aug 22, 2026 6/10
workflow Reddit

Claude Code Injects an 'Operating Autonomously' Prompt Outside Auto Mode

A user on 2.1.239 found Claude Code adding a 'You are operating autonomously... the user is not watching in real time' segment to the system prompt even without Auto Mode, which suppresses the usual mid-task check-in questions. Reported while running with --dangerously-skip-permissions and the standard output style. Worth knowing if your workflow depends on Claude pausing to confirm design decisions.

system-promptauto-modebehavior-changediscussion
by farono Aug 22, 2026 6/10
workflow GitHub

verefi: Product Specs to Reviewed Test Plans to Playwright Automation

An AI-assisted pipeline that reads product specs, drafts test plans for a human to review, and then generates executable Playwright automation from the approved plan. The human review gate sits between spec interpretation and code generation, so bad test assumptions get caught before they become suites.

testingplaywrightqapipeline
by philchen00 Aug 22, 2026 6/10
workflow GitHub

nightshift-aidlc: Portable Agentic Harness for the Full Delivery Lifecycle

A skill kit and harness covering requirements, implementation, verification, review, and delivery, with explicit human guardrails at each stage. Portable across agent CLIs rather than tied to one harness, so the same lifecycle applies wherever you run it.

workflowsdlcskillsguardrailsreview
by thrrive Aug 22, 2026 6/10
workflow GitHub

product-lifecycle-templates: Gate-Enforced, Agent-Ready Product Docs

Product-lifecycle document templates that ship as bundles rather than blank files — each type includes the blank shape, a companion, a guide, a worked example, and machine-readable metadata. The metadata makes them agent-consumable, and the gates keep a doc from advancing until it is actually complete.

templatesproductdocumentationgates
by product-on-purpose Aug 22, 2026 5/10
workflow GitHub

pleach: One Git Worktree Per Repo for Parallel, Isolated Agent Sessions

A workspace manager for running several isolated work sessions across multiple repositories at once, giving each session its own git worktree per repo. It also handles the parts that usually break parallel agent work — port allocation, secret injection, and session lifecycle. Aimed at people running more than one agent on the same codebase without them stepping on each other.

worktreeparallel-agentsmulti-repoisolationworkspace
by guedesdiogo Aug 21, 2026 7/10
workflow GitHub

agent-playbook: Overnight Runner That Fails Over Between Claude, Codex, and Gemini

A playbook runner for unattended overnight work across the Claude Code, Codex, and Gemini CLIs. When one subscription hits its usage limit it rides the cooldown out or fails over to another provider, verifies the results, and pushes a notification to your phone. Built for long multi-hour tasks you do not want to babysit.

automationunattendedrate-limitsmulti-clinotifications
by Glaxor Aug 21, 2026 7/10
workflow GitHub

orchestrator-bmad: Lean-Context BMAD Driver With One Subagent per Phase

A Claude Code skill that runs the BMAD-Method workflow from a thin orchestrator, spawning a dedicated subagent for each phase and each story, with every subagent invoking its own bmad-* skill. The point is context economy — the orchestrator never accumulates the full transcript of every phase. Worth a look if BMAD runs have been blowing your context window.

bmadorchestrationsubagentscontext-management
by TalEps77 Aug 21, 2026 7/10
workflow GitHub

innovate-or-die: Push AI Past Generic Brainstorming via Adversarial Culling

A prompt framework that makes the model generate 30+ ideas, argue against each one, discard the weak survivors, and return only the strongest along with one cheap real-world test to validate them. It is model-agnostic, working with Claude, Codex, Copilot, ChatGPT, Gemini, and Perplexity. The repo publishes actual results from running it, including the failures.

brainstormingpromptingideationcritiquemodel-agnostic
by pestalytix Aug 21, 2026 5/10
workflow Reddit

Claude Code Talking to Codex Over a Shared Git Mailbag Protocol

A setup where five Claude Code installations and one Codex instance, spread across machines and dozens of workspaces, communicate through a shared GitHub repo. A dispatcher routes JSON messages into per-agent mailbags, and agents can run as CLIs to process mailbag items non-interactively. Sessions map to specialization areas such as VMware, certificates, or firewalls so each keeps a focused memory instead of constantly compacting.

multi-agentgitdispatchercodexmessaging
by gfunk5299 Aug 21, 2026 6/10
workflow Reddit

Anatomy of Claude Code Invocation Payloads for Usage and Security Observability

A breakdown of what Claude Code's model invocation logs actually contain and how to monitor them at the machine or org level. Events carry caller identity, model, device and session IDs, and message_stop/message_delta output reports input, output, cache-read, and cache-write tokens plus latency and time to first byte. The tools field shows which native and MCP tools each invocation could call, useful both for security review and for spotting context-window pollution from verbose MCP servers.

observabilitytelemetrytokenssecuritymcp
by Negative-Squash-6677 Aug 21, 2026 7/10
workflow GitHub

remotion-agent-catalog: Mapping Where Agents Break on Remotion Projects

A Portuguese-language catalog of what already exists for driving Remotion video projects with coding agents, and specifically where those integrations break down. It argues for a missing layer between an agent and a Remotion codebase and documents the gap concretely. Worth a look if you are wiring Claude Code into programmatic video generation.

remotionvideoagentscatalogportuguese
by victorsodre Aug 21, 2026 5/10
workflow GitHub

claude-extension-lifecycle: 8-Step Cleanup Spec for MCP, Skills, Hooks, Plugins

A lifecycle management convention for AI tool extensions, covering MCP servers, skills, hooks, and plugins under one 8-step cleanup process. Aimed at the problem of accumulated half-installed extensions nobody remembers adding. Documentation is in Chinese.

lifecyclemcpskillshookschinese
by kksfkf Aug 21, 2026 5/10
workflow GitHub

laixin-pipeline: Codex, Claude Code, and Kimi as Parallel tmux Workers

A production multi-agent development pipeline that dispatches work to Codex, Claude Code, and Kimi running as parallel tmux workers, with independent acceptance checks and watchdog recovery when a worker stalls. The repo also publishes the failure log that motivated each rule, which is more instructive than the rules alone.

multi-agenttmuxorchestrationpipeline
by pingxia710 Aug 21, 2026 6/10
workflow GitHub

ccpr: Phase-Based Project Framework for Claude Code

A phase-based framework for structuring Claude Code projects, breaking work into explicit stages rather than one long open-ended session. Worth a look if your current approach is a single sprawling PLAN.md that the model drifts away from.

workflowframeworkplanningphases
by jonase47 Aug 21, 2026 5/10
workflow GitHub

Claude-Code-Bridge: Paired Sessions Where the Reviewer Must Cite Real Files

Runs several Claude Code pairs at once, one per project: one session does the work and the other reviews every finished turn. The reviewer cannot simply say "looks good" — a verdict is refused unless the files it names actually exist on disk. It also measures context and swaps in a fresh session before the current one runs out. Python standard library only, fully local.

multi-agentreviewverificationcontextpython
by AMDsyc Aug 21, 2026 7/10
workflow GitHub

agent-kit: Shared Codex and Claude Code Operations Kit With Git Hooks

A shared operations kit for running Codex and Claude Code against the same repo: an AGENTS.md working convention, skills, templates, inspection scripts, and git hooks that scan for secrets and lint Japanese documentation. Documentation is in Japanese.

agents-mdhooksskillsjapanesegit
by inakaegg Aug 21, 2026 6/10
workflow GitHub

axiom: Safety-First Routing With Scope, Authorization, Evidence, and Rollback

Routes high-impact agent actions in Codex and Claude Code through explicit gates: what is in scope, who authorized it, what evidence supports it, and how to roll it back. Aimed at the class of agent action where an undo path needs to exist before the action runs.

workflowsafetyauthorizationrollbackgovernance
by wheakerd Aug 21, 2026 6/10
workflow GitHub

Plan With a Big Model, Execute With Cheap Ones: Model-Pinned Agent Workflow

Two Claude Code commands and four agents each pinned to a specific model, so planning runs on a capable model while execution runs on cheaper ones. A read-only reviewer gates the risky phases. A concrete take on cost-tiering that avoids the usual failure of running everything on the expensive model out of caution.

workflowcostmodelsagentsreview
by ekstremedia Aug 21, 2026 7/10
workflow GitHub

seedance-pipeline: Generative Video Production Pipeline Run From Claude Code

A production pipeline for shooting short narrative pieces on generative video (Seedance and Higgsfield MCP) driven from Claude Code, with ten executable checks, five skills, a written process document, and post-mortems of actual shoots. Documentation is in Russian.

workflowvideomcpgenerativerussian
by efalov Aug 21, 2026 5/10
workflow GitHub

spec-seatbelt: Load One Phase at a Time for ~70% Fewer Tokens

Keeps agents honest by requiring a plan first, proof of each step, and verification with fresh eyes. Loading one phase at a time cuts roughly 70% of tokens versus holding the whole spec in context. Adds persistent .specs/ memory, loop-plan waves, and task graphs for safe parallel work. Supports Cursor and Claude.

workflowspec-driventokensplanningparallel
by luizssantiago92 Aug 21, 2026 7/10
workflow GitHub

kagemusha: Markdown governance kit for Claude Code agents

A governance toolkit built entirely in Markdown that adds approval queues, correction promotion, and judgment distillation to Claude Code and other AI agents. Corrections you make get promoted into durable rules so the agent stops repeating the same mistakes. Aimed at teams that want reviewable guardrails without extra runtime infrastructure.

workflowgovernanceapprovalsmarkdownagents
by yohey-w Aug 21, 2026 6/10
workflow GitHub

dependabot-audit: Evidence-backed merge calls on dependency PRs

A Claude Code plugin that audits a Dependabot or Renovate pull request and reports a merge recommendation backed by evidence from the diff. It understands uv.lock and GitHub Actions bumps specifically. By design it never merges anything itself, leaving the final call to you.

workflowplugindependabotrenovatecode-reviewci
by Machai-Kydoimos Aug 21, 2026 7/10
workflow GitHub

orbit: Turn Any Repo Into a Self-Prompting Agentic Loop

A Claude Code plugin that wraps a repository in a self-prompting loop with persistent memory, a sub-agent team, skills, and explicit hard stop conditions. The agent keeps generating its own next task instead of waiting for you to supply one. The stop conditions are the interesting part — they bound the loop so it terminates rather than burning tokens indefinitely.

pluginautonomoussub-agentsmemoryloop
by Abdulaziz-almoshen Aug 21, 2026 7/10
workflow GitHub

smart-subagents: Quota-Aware Subagent Routing Across Codex, Grok and Kimi

Routes Claude Code subagent work to whichever external CLI still has rate-limit headroom, reading live quotas across codex, grok and kimi before dispatching. Each delegated task runs isolated in its own git worktree, and the resulting diff is verified before the subagent reports back. Useful if you hit plan limits and have multiple provider subscriptions to spread load across.

subagentsrate-limitsworktreeroutingmulti-provider
by m-esm Aug 21, 2026 8/10
workflow GitHub

federal-proposal-copilot: Shipley-Aligned Federal Proposal Workflow

A Claude Code workflow for writing US federal defense and intelligence community proposals, structured around the Shipley proposal methodology. It handles 14 proposal types, generates parametric graphics, and runs color-team reviews (pink, red, gold) as staged agent passes. Narrow domain, but a concrete example of encoding a heavyweight professional process into agent workflows.

proposalsgovconshipleydocument-generationreview
by chakmarebel Aug 21, 2026 6/10
workflow GitHub

SpecSeal: Hook-Enforced Implement/Review Chain With Drift Detection

Chains an implementing agent to a reviewing agent with hooks enforcing that the handoff actually happens, rather than trusting the model to self-review. An evidence ledger records what was done and flags drift when implementation diverges from the sealed spec. The review handoff protocol is tool-agnostic, so the two ends can be different agent CLIs.

spec-drivenhookscode-reviewdrift-detectionagent-chain
by MichaelYcJo Aug 21, 2026 7/10
workflow GitHub

OOPforge: Keep Coding Agents on an OOP/DDD Architecture

A harness that constrains coding agents to an object-oriented / domain-driven dialect instead of letting them improvise. The goal is preventing the God Service sprawl that shows up when agents ship features without architectural guardrails. Useful if you want AI-written code to stay reviewable months later.

architecturedddoopharness
by LooSung Aug 20, 2026 6/10
workflow GitHub

codride: Context Driven Development Framework for Claude Code

A framework that drives a project from raw idea to merged PR using master docs, ADR compliance checks, and a BDD to TDD to coverage loop. Works on both new and existing repos. Aimed at teams that want the agent to follow a documented process rather than freestyle.

cddadrtddbddframework
by edilson-silva Aug 20, 2026 6/10
workflow GitHub

subagent-model-routing: Route Agent Work Across Installed Model CLIs

Routes tasks from Claude Code, Codex, and Copilot to whichever model CLI is installed and appropriate, with delegation guardrails. Keeps an observation-driven routing ledger so decisions are auditable over time. Useful when you pay for several assistants and want cheap work off the premium path.

routingsubagentsmulti-modeldelegation
by Buckeyes22 Aug 20, 2026 6/10
workflow GitHub

delegate-local-plugin: Run Scoped Tasks on a Local opencode Runtime

A Claude Code plugin that hands scoped tasks to a local opencode runtime running as background subagents. Keeps the cheap or long-running work off your subscription while the main session stays responsive.

pluginsubagentsopencodelocal
by tuomashatakka Aug 20, 2026 6/10
workflow GitHub

bermuda: Orchestration for Claude Code With Flows Agents Cannot Skip

Orchestration layer built on herdr providing flows an agent is not allowed to shortcut, scheduled jobs, threads with claim semantics, and a searchable forum agents can consult later. Aimed at multi-agent setups where step-skipping is the main failure mode.

orchestrationworkflowmulti-agentscheduling
by bon5co Aug 20, 2026 5/10
workflow GitHub

Progressive-Context-Kit: Token-Efficient Spec-Driven Development

A spec-driven development kit built around progressive context loading, durable project memory, skills, and workflows for Claude Code and Codex. The premise is that quality and token efficiency come from the same thing: only loading what the current step needs.

contextspec-drivenmemorytokens
by Elguajo Aug 20, 2026 6/10
workflow Reddit

Four Repos, Agents Fighting Over Branches: A Workspace Charter Setup

A writeup of a setup that fixed three problems at once — agents stashing each others work across shared repos, secrets ending up in transcripts because the agent had to curl something, and a CLAUDE.md that had degraded into a landfill. Tasks now start by claiming a named workspace of per-agent clones.

worktreesmulti-agentsecretsclaude-md
by diazoxide Aug 20, 2026 6/10
workflow GitHub

context-kit: Context Hygiene for a Single Agent

A kit for keeping one agents context clean: pruning, scratch persistence, delegation-brief validation, safety hooks, and memory recall. Deliberately scoped to the single-agent case rather than fleet orchestration.

contextpruningmemoryhooks
by caty-ai Aug 20, 2026 6/10
workflow GitHub

project-state-governor: Evidence-Backed Durable Project State

Maintains project state across sessions, branches, reviews, and research, with each state claim backed by evidence rather than the agents recollection. For work that spans more context than any one session holds.

statememoryevidencesessions
by Ghost011118 Aug 20, 2026 5/10
workflow GitHub

oh-my-agents: Lightweight Dual-Agent CLI and Skills Toolkit

A small CLI plus skills toolkit for running Claude Code and Codex together in one workflow. Deliberately lightweight compared to the full orchestration frameworks.

cliskillscodexdual-agent
by sean2077 Aug 20, 2026 5/10
workflow GitHub

ak-pi-workflow-roles: A Governance Layer With Deliberately No Runner

Seven gated roles with typed submissions and independent audit seats, and pointedly no orchestrator: composing the roles stays the callers job. An interesting counterpoint to frameworks that take over your control flow.

governancerolesauditworkflow
by Akagilnc Aug 20, 2026 5/10
workflow GitHub

liwm-agent-framework: Evidence-Based Intent Learning for Coding Agents

Learns your intent from evidence in the repo rather than from stated preferences, gates conclusions on provenance, and explains why it inferred what it did. Local-only, and works with any agent that reads AGENTS.md.

intentlearningprovenancelocal
by vyas-devgna Aug 20, 2026 5/10
workflow Reddit

A Rework Step That Catches "Oops My Bad" Errors Before Review Round Two

After every fix has landed and before anything is written down, re-read the findings file from disk — not scrollback, not memory of having read it — and check each finding against the artifact as it now stands. Shared verbatim from a working rework skill; the re-read from disk is the load-bearing part.

reviewverificationreworkskill
by dar-mit Aug 20, 2026 6/10
workflow Reddit

Your Own AI Help Center: Three Text Files and a Copy Button

Instead of hosting a support chatbot, publish your docs in a readable format and put a prepared prompt with a copy button at the bottom of every help page. Users paste it into whatever assistant they already have open, which then answers in their own language from your docs. No chatbot bill, no infrastructure.

docssupportpromptingpattern
by PrivacyNotes Aug 20, 2026 5/10
workflow GitHub

claude-workflow-toolkit: Cut Repeated Codebase Discovery

A modular toolkit for optimizing context, planning, and agent execution in Claude Code, aimed at lowering token use by not rediscovering the same codebase facts every session.

contextplanningtokenstoolkit
by lnrd390 Aug 20, 2026 5/10
workflow Reddit

If I Type the Same Instructions Four Times, I Turn Them Into a Tool

By the fourth retyping, a request has become a procedure that exists only in your memory — and retyping it introduces variation nobody decided on. Mondays version handles an edge case, Thursdays does not. The rule: repeated procedures become saved commands, scripts, workflows, or validators.

practiceautomationcommandsprocess
by jonah_omninode Aug 20, 2026 6/10
workflow Reddit

A Refined but Simplistic Approach to Agent Memory

A graph-based memory built after trying Graphify, Graft, and others and finding each solved only part of the problem. Removes the need to start sessions inside a specific repository, and focuses on retrieval and update quality so agents actually rely on it rather than ignoring it.

memorygraphretrievalcross-project
by Slight-Parfait3679 Aug 20, 2026 5/10
workflow GitHub

agnostic-harness: Model-Agnostic Autonomous Coding Engine

An autonomous coding engine with Claude Code-style capabilities and subagents, plus an 18-target cross-agent single-source-of-truth harness so the same configuration drives every agent you use.

harnessmodel-agnosticsubagentsssot
by ucsandman Aug 20, 2026 5/10
workflow GitHub

tribunal: Make AI CLIs From Different Vendors Argue It Out

A multi-agent red-team tribunal for hard engineering decisions: CLIs from different vendors debate in structured rounds and return adjudicated verdicts that preserve the dissent rather than flattening it. Presented as a methodology, not a framework.

multi-agentred-teamdecisionsadversarial
by kdoubt Aug 20, 2026 7/10
workflow GitHub

review-pro: Triage, 12 Specialist Reviewers, Then Synthesis

Repository-aware code review that triages the change, dispatches twelve specialist reviewers, and synthesizes their findings. Reviews both what the agent changed and what the repository already knew about that code. Works with Claude Code, opencode, Cursor, and Codex.

code-reviewspecialistssynthesiscross-tool
by tufantunc Aug 20, 2026 7/10
workflow GitHub

game-art-pipeline: 2D Game Art Specs With Computer Vision QA

An agentic pipeline that specifies 2D game art and then QAs the generated assets with computer vision, for Godot, Unity, and AI-assisted game developers. The CV check is what makes it a pipeline rather than a prompt.

gamedevartcomputer-visiongodotunity
by MihaiJ75 Aug 20, 2026 5/10
workflow GitHub

no_human: Ticket to Reviewed Pull Request, Fully Local and Open Source

An open-source pipeline that takes an issue ticket through to a reviewed pull request without leaving your machine. Aimed at teams who want the full ticket-to-PR loop automated but not hosted by a third party.

automationpull-requestself-hostedopen-source
by no-human-ai Aug 20, 2026 6/10
workflow GitHub

declarative-dev-env-blueprints: Reproducible Dev Environments for AI Agents

Blueprints for declaring development environments so both AI agents and human teammates land on identical tooling. Addresses the common failure where an agent works in a subtly different environment than the developer reviewing its output.

devenvreproducibilitytoolingblueprint
by li554646569 Aug 20, 2026 5/10
workflow Reddit

Lessons From Running 25+ Claude Code and Codex Agents Unattended for a Month

Field notes from ~25 agents running on their own schedules for a month, including a self-driving events site with one agent per city across 22 cities. Key warning is "workflow explosion": an agent that can edit its own instructions accumulates scope until the original workflow no longer fits its time budget, so give recurring agents explicit duration constraints.

automationunattendedschedulinglessons-learned
by vscode1 Aug 20, 2026 8/10
workflow GitHub

money-bot-starter: Guardrailed Autonomous Money Agent and Its $0 Result

A scaffold for autonomous revenue agents with a constitution, ledger-first guardrails, human-in-the-loop gates, and an append-only audit trail. The honest part is LESSONS.md: one bot ran 28 days on a $100 hard-capped card and earned exactly nothing, written up as a null result.

autonomous-agentsguardrailshitllessons-learned
by BayramAnnakov Aug 20, 2026 6/10
workflow GitHub

hydraia: One-Command Plan, Execute, and Double-Review Pipeline for Claude Code

A self-contained agentic development harness where one command runs the full feature pipeline — plan, execute, then two review passes — with security gates built into the flow. Aimed at people who want a fixed process rather than assembling one per project.

workflowpipelinecode-reviewsecurity
by jdanigo Aug 20, 2026 6/10
workflow GitHub

keeler: Coverage, Property, and Mutation Gates for AI-Written Rust

A work-in-progress harness making AI-written Rust trustworthy through human-approved specs and strict TDD, then enforcing independent gates: coverage, CRAP score, property tests, and mutation testing. Mutation testing is the interesting piece — it verifies the tests themselves rather than trusting a green suite.

rusttddmutation-testingquality-gates
by minikin Aug 20, 2026 6/10
workflow GitHub

wizz-method: PT-BR Agency Method That Routes Requests to the Right Agent

An independent Brazilian Portuguese fork of the BMad Method where a conductor agent reads your request and dispatches it to the appropriate specialist agent. Structured for agency-style project work rather than solo coding.

multi-agentorchestrationbmadportuguese
by wizzcomms Aug 20, 2026 5/10
workflow GitHub

buildbot: Interview-Driven Builder That Only Builds What You Ratify

A builder for AI workspaces that interviews you first, produces a blueprint from the answers, and then constructs only the pieces you explicitly ratify. It proves each piece as it goes so you watch verification happen instead of trusting a finished dump.

workflowplanningscaffolding
by jdpolasky Aug 19, 2026 6/10
workflow GitHub

ultraship: Adaptive Planning Framework for Vague Ideas to Shipped Software

An AI-assisted rapid development framework that carries a rough idea to production-ready software through adaptive planning and Minimum Complete Releases. Agent execution is resource-aware, scoping work to what the current release actually requires.

frameworkplanningworkflow
by zeroonething Aug 19, 2026 6/10
workflow GitHub

consensus-review: Multi-Model Consensus Code Review for Claude Code

Runs code review across Opus, codex, and opencode, then reconciles the results into a triaged P0-P2 list. An independent sceptic verifier challenges each finding before it survives, and the review is code-graph aware rather than working from the diff alone.

code-reviewmulti-modelverification
by akholod Aug 19, 2026 8/10
workflow GitHub

compass: Markdown Product Development Framework for AI-Assisted Teams

A product development framework where bets, roles, and decisions all live in markdown next to the code. Gives AI-assisted teams a shared, agent-readable record of what is being built and why.

productframeworkmarkdownplanning
by vivekschaudhary Aug 19, 2026 6/10
workflow Reddit

Does Fable as Orchestrator With Subagents Save or Burn Tokens?

A Max 5x user doing knowledge work and academic research reports weekly usage spiking after moving to Fable for planning and audits, then switching to Sonnet or Opus to execute. The question is whether an orchestrator-plus-subagents pattern actually reduces token spend or multiplies it, given the context re-caching that happens on a model switch.

tokensorchestrationsubagentsusage
by Crak3n Aug 19, 2026 6/10
workflow Reddit

An Obsidian Vault in the Repo as Memory Between Claude Code Sessions

A solo dev building a SaaS ran several Claude Code sessions that could not see each other, so session B kept redoing what session A had finished — at one point rebuilding a live payment webhook that already existed. The fix was a plain Obsidian vault committed in the repo (TODO, BUGS, NOTES) plus a CLAUDE.md rule requiring every session to read and update it.

memoryclaude-mdobsidianmulti-session
by Owensvilles Aug 19, 2026 6/10
workflow GitHub

Agentic-SDLC Audit Tool Built Through the Pipeline It Documents

Produces deterministic scored reports on how disciplined an AI-agent development process is. The tool was itself built through that pipeline — plan, agent build, adversarial AI review, CI gate, human-authorized merge — as its own demonstration.

sdlcauditciprocess
by ryanportfolio Aug 19, 2026 5/10
workflow GitHub

Microwave Method: Cook Context Once per Agent, Reheat at Cache Price

A pattern pairing an agent factory with a governed LLM wiki: one heavy context-building pass per agent, then a light pass per feature. Later work reads cached context instead of rebuilding it, trading a large upfront cost for cheap repeat runs.

contextcachingtokensagent-factory
by microphage-create Aug 19, 2026 6/10
workflow GitHub

agents-with-receipts: Verified Cross-Tool Comparison and AGENTS.md Linter

An evidence-first handbook for agentic coding: a cell-by-cell verified cross-tool comparison table, a practices map where each claim carries a source, and a linter for AGENTS.md quality. Bilingual Chinese/English.

agents-mdlintercomparisonpractices
by alloevil Aug 19, 2026 6/10
workflow GitHub

requivo: Turn a Vague Client Request Into PRD, Stories and Estimates

A discovery engine that converts a loose client request into a structured solution model, then generates a discovery brief, PRD, user stories, estimate, acceptance criteria, an importable GitHub/GitLab epic and release notes from that one model. Asks only the questions that change the answer.

discoveryprdrequirementsplanning
by jbkkz Aug 19, 2026 6/10
workflow GitHub

belmont: Agent-Agnostic Toolkit for Structured AI Coding Sessions

A toolkit for running structured coding sessions that does not assume a particular agent or project type. Aimed at people who want the same session discipline regardless of which CLI they are using that week.

toolkitsessionsworkflowagnostic
by blake-simpson Aug 19, 2026 6/10
workflow GitHub

recruiting-copilot: AI Recruiting Workflow for Sourcing and Screening

A recruiting workflow for HR and headhunters covering role requirements, dual-channel sourcing and screening, market talent mapping, resume evaluation, interview scheduling and daily reports. Installs as a Claude Code plugin or a DeepSeek Harness plugin.

recruitinghrworkflowplugin
by Viy1204 Aug 19, 2026 5/10
workflow GitHub

devcodex: Intent-Driven Coding Workflow Runtime Across Six AI Hosts

A runtime that keeps context, skills, approvals, validation and handoffs consistent across six different AI coding hosts. Useful when a team is split across tools but wants one process.

workflowruntimemulti-hostvalidation
by devcodex-labs Aug 19, 2026 6/10
workflow GitHub

deep-suite: Ten Plugins for Plan-First Development and Orchestration

A harness layer for Claude Code and Codex built from ten composable plugins, covering plan-first development, independent review, durable long-running orchestration and knowledge capture.

pluginsplanningrevieworchestration
by Sungmin-Cho Aug 19, 2026 6/10
workflow GitHub

webtoon-director-harness: Multi-Agent Creative Direction With a Quality Gate

A Claude Code scaffold that models a director's room for webtoon and comic work, with separate agents for narrative, cinematography, emotion, pacing, continuity and criticism. A weighted quality gate decides when a panel is good enough.

creativemulti-agentwebtoonquality-gate
by keerhee Aug 19, 2026 6/10
workflow Reddit

Fable 5 Plans, Opus 5 Implements: A Blind Test and Model-Routing Split

A writeup from someone who burned 100B+ tokens on Fable 5 as their main agentic-coding model and then restructured to cut Fable usage by 70-80%. Fable handles planning, architecture, security/payments/concurrency, hard debugging, and final review; Opus 5 takes delegated implementation, bulk edits, boilerplate, and research. Includes a blind Sonnet 5 vs Opus 5 coding test judged by Fable, decided by a single bug.

model-routingorchestrationfable-5opus-5benchmark
by LifeSorry8905 Aug 19, 2026 7/10
workflow Reddit

A Markdown Design Log That Gives Claude a Taste Signal, Not Just Pass/Fail

Tests tell an agent whether code runs, but nothing about whether a spacing or color decision was right, so this developer keeps one markdown file per visual change with four fields: Request, Attempt, Reaction, Status. The key rule is that the Reaction goes in verbatim — letting Claude paraphrase it into a tidy summary destroys the exact signal the loop runs on. Useful pattern for anyone tired of re-explaining the same design preferences every session.

designcontext-engineeringmarkdownfeedback-loop
by SnooComics4579 Aug 19, 2026 7/10
workflow GitHub

ape: Durable, Auditable Local-First Workflow Orchestration for Coding Agents

Runs multi-step workflows across Claude Code and Codex CLI with durability and an audit trail, so a long orchestration survives interruption and you can reconstruct what each step actually did. Local-first — no hosted control plane. Worth a look if your agent pipelines are currently shell scripts that lose their place when something crashes.

orchestrationworkflowdurabilityauditcodexlocal-first
by AAWWCC Aug 19, 2026 7/10
workflow GitHub

research-hound: Five-Stage Research Workflow With 21 Verification Scripts

A scientific research workflow for Claude Code structured as five stages backed by 21 runnable scripts covering citation verification, claim audits, manuscript linting, and rubric scoring. The runnable-script design means verification is deterministic rather than another thing the model is asked to promise it did. Aimed at academic writing, but the citation-checking approach generalizes.

researchcitationsverificationacademicworkflow
by AlveeeRahman Aug 19, 2026 7/10
workflow Reddit

Agnostic AI Harness: One Rule File Compiled to 18 Agent Configs

A local-only control plane that keeps your coding-agent rules in a single markdown source and compiles them out to ~/.claude/CLAUDE.md, .cursorrules, Codex, Windsurf, Copilot, Cline, Aider and a dozen more targets. It also audits context bloat, flagging excess MCP tools and switching global skill dumping to just-in-time project scoping. Useful if you switch between agents and keep hitting rule drift or a heavy per-prompt tool tax.

claude-mdcontext-managementmulti-agentconfig-synctokens
by SIGH_I_CALL Aug 18, 2026 7/10
workflow Reddit

Transparent MITM Setup for Headroom with Copilot and OpenCode

A configuration that slips squid and nginx between your agent and headroom so the client needs no endpoint or environment-variable changes at all. It fixes the practical annoyances of proxying — notably being unable to switch models in Copilot when pointed at headroom. Repo and config are published for anyone running a proxy in front of their agent traffic.

headroomproxynginxsquidcopilot
by m0ntanoid Aug 18, 2026 5/10
workflow GitHub

Cerberus: Adversarial Verification That Attacks Your Agent's Changes

A verification harness for AI coding agents that treats a proposed change as a hypothesis to break. It attacks the diff, proves the test/check suite is actually capable of failing, then issues a pass/fail verdict. Useful if you distrust agent-written code that ships with agent-written tests.

verificationcode-reviewtestingadversarialagents
by concordloom Aug 18, 2026 7/10
workflow GitHub

aiyoke: Deterministic Harness Templates Across Claude Code, Codex, and Grok

A templating kit that generates a consistent agent harness for multiple assistants (Claude Code, ChatGPT/Codex, Grok Build, OpenRouter) and multiple runtimes (Python, TypeScript, JavaScript, Rust, Go). The point is determinism: the same project scaffolding and rules regardless of which agent you run today.

harnesstemplatesmulti-agentscaffoldingportability
by ryanpavlicek Aug 18, 2026 6/10
workflow GitHub

AutoR: Agent Runs That Leave an Inspectable Research Artifact on Disk

A research-execution loop where the AI handles the running and humans set direction, and every run is written out as an inspectable artifact on disk rather than vanishing into a chat log. Aimed at making long autonomous runs auditable after the fact.

researchautomationartifactsauditability
by tangxiangru Aug 18, 2026 5/10
workflow GitHub

sefi-agents: A 14-Agent Software Company Plugin with Budget Caps

A Claude Code plugin that models a software team as 14 agents which plan, build, and adversarially judge every change. Each run is bounded by hard budget caps so orchestration cannot spiral. Built entirely from Markdown and POSIX shell with zero runtime dependencies.

pluginmulti-agentorchestrationcode-review
by xsefirosus Aug 18, 2026 7/10
workflow GitHub

awesome-ai-blueprints: Architectural Blueprints for AI Coding Agents

A curated collection of architectural blueprints for building and structuring AI coding agents. Useful as a reference when deciding how to lay out agent harnesses, tool boundaries, and orchestration patterns rather than inventing structure from scratch.

awesome-listarchitectureagentsreference
by ysz7 Aug 18, 2026 5/10
workflow Reddit

A Status Line for Tracking Agents Across Multiple Repos and Worktrees

A Claude Code status line redrawn from disk every turn that tracks parallel agent work: pending todos, pieces of work in flight and which have gone silent, how many org repos are cloned into the task, and per-repo branch, dirty state, unpushed commits, CI result, and PR number. Worktrees appear as indented rows so two agents can work the same repo without fighting over one checkout.

statuslineworktreesmulti-agentmonitoring
by diazoxide Aug 18, 2026 6/10
workflow Reddit

How to do very long agentic work

Hey guys, I need to automate a very very long AI workflow where my main claude session will act as orchestrator then use sub agents, but that still ends up filling the context and causing hallucina...

workflow
by whoami-233 Aug 18, 2026 5/10
workflow Reddit

Measured throughput of running 1-8 Claude Code sessions in parallel

A practitioner logged lines-per-hour while scaling from one to seven concurrent Claude Code sessions: 190 LOC/hr at one session, 464 at three or four, 709 at five to seven. Cost per unit of work stayed flat, so the real ceiling is the human context-switching load, not tokens. Notes that output kept climbing past hour six while review quality dropped.

parallel-sessionsthroughputproductivityworkflow
by Pawesome101 Aug 18, 2026 6/10
workflow GitHub

agent-sop: standard operating procedures for Claude Code sessions

A session-discipline framework built around a defined file set, slash commands for session start and end, and a backlog with status tags and P-numbers. Ships six non-negotiable rules plus a compliance checker and reference agents. Designed for 3-5 parallel Claude Code instances on separate git worktrees, with tracking-file conflicts prevented structurally rather than by convention.

sopworktreesparallel-sessionsslash-commandsbacklog
by mmjclayton Aug 18, 2026 7/10
workflow GitHub

claude-playbooks: Isolated Claude Code Instances for Clean Separation

A setup for running Claude Code in isolated instances so unrelated projects and experiments do not share configuration or state. The goal is keeping each context self-contained instead of accumulating cruft in one global install. Useful if you juggle many repos and want predictable, reproducible agent environments.

isolationenvironmentsetupclaude-code
by ramazanpolat Aug 18, 2026 5/10
workflow GitHub

dilux-development-workflow: Six-Phase Pipeline with Gates Enforced Outside the Model

A development pipeline the coding agent must walk through: six phases with gates enforced outside the model rather than by prompt instructions alone. One method is wired into six different tools so the process stays consistent across your stack. Aimed at teams tired of agents skipping steps they were told to follow.

workflowgatespipelineprocess
by soydiloreto Aug 18, 2026 7/10
workflow GitHub

AGENTOS: Repo-Local Kernel Adding Audit Trails and Review Gates to Coding Agents

Installs a single agent-os/ directory into your repo that gives Claude Code, Codex, and other AGENTS.md-aware agents a hook-enforced per-turn audit trail, review gates, and task contracts. The discipline is enforced by hooks, not suggestions, and carries across runtimes. Useful when several different agents touch the same codebase.

hooksauditgatesmulti-agentgovernance
by zuoxu3310 Aug 18, 2026 7/10
workflow GitHub

looper_rust: Autonomous Plan-Execute-Iterate Loop for Claude Code and Codex

A Rust-based autonomous development loop that plans, executes, and iterates on tasks so a complex workflow runs from a single command. It keeps the agent cycling until the work is done rather than stopping after one pass. Supports both Claude Code and Codex as the underlying agent.

autonomouslooprustautomation
by quangdang46 Aug 18, 2026 6/10
workflow GitHub

agent-workflow-kit: Cross-Agent Memory and Workflow via AGENTS.md

One command drops an AGENTS.md entry point plus a docs/ai context directory into any repo, with cap, archive, and index enforcement so the context does not grow unbounded. Designed to be portable across Claude Code, Codex, Cursor, and Devin Desktop. Solves the problem of each agent tool wanting its own memory layout.

workflowmemoryagents-mdcross-tool
by sabaiway Aug 17, 2026 6/10
workflow Reddit

Claude Code + Ollama/Qwen3.8: A Local Setup That Actually Worked

A report on pointing Claude Code at Ollama with qwen3.8:27b-mlx on an M4 Pro with 48 GB of unified memory, where the model correctly read and summarized a real repository file. The same model was unreliable through Codex, and Qwen3.6 was faster but made factual errors. The thread asks what settings and workflow rules make local providers dependable on larger repo tasks.

local-modelsollamaqwenworkflow
by UkrMalt Aug 17, 2026 6/10
workflow GitHub

mastering-claude-code: Practitioner's Guide to Claude Code as a Harness

A project-agnostic guide that treats Claude Code as a durable harness rather than a chat window. It covers memory, skills, subagents, hooks, async work, multi-agent patterns, tool discipline, and CLAUDE.md structure. A good consolidated read if you have picked up these pieces one at a time.

guidememoryskillssubagentshooks
by aussieboer61 Aug 17, 2026 7/10
workflow GitHub

Aixle Flow: Orchestrate Coding Agents Through Durable Workflows

A workflow engine for orchestrating coding agents where runs are durable and inspectable rather than fire-and-forget. Durability means a long multi-agent run survives interruption; inspectability means you can see what each step actually did. Aimed at agent work that outlives a single terminal session.

orchestrationworkflowdurableobservability
by AixleHQ Aug 17, 2026 6/10
workflow Reddit

Background Agents With an Empty Brief Still Exit Green

If you launch background or parallel sessions from scripts, the prompt usually travels as a file or heredoc — and when that file is missing or empty the agent does not error. It starts with no instructions, does nothing, and exits clean, so the launcher reports success. The fix is two lines: have the launcher check the brief is non-empty (test -s prompt.txt) before starting, and make the first line of every brief something the agent must acknowledge.

gotchaautomationbackground-agentsscripting
by Specialist_Agent3599 Aug 17, 2026 7/10
workflow GitHub

Local Agentic Coding Benchmark: 5 Models, 3 Harnesses, 86 Tests

A benchmark of local agentic coding on DGX Spark-class hardware (NVIDIA GB10, 128 GB unified memory), covering five local models, three agent harnesses, and four agentic coding tasks scored by 86 hidden tests. The harness dimension is the interesting part — the same model performs differently depending on what drives it. Useful data if you are deciding whether local agentic coding is viable yet.

benchmarklocal-modelsharnessevaluation
by DG1001 Aug 17, 2026 6/10
workflow Reddit

Obsidian Vault Set Up So a Coding Agent Reads and Maintains It

A setup where one file at the vault root, read before every session, tells the agent how the vault is organized and what to keep current without being asked — daily notes, project folders, and an inbox for fast capture. The author reports the key rule is: if you type the same instruction twice, it belongs in that file. The result is a second brain the agent maintains rather than one you maintain by hand.

obsidianmemorynotesworkflow
by Aguilaaa Aug 17, 2026 7/10
workflow GitHub

thinkpad-fedora-agent: A Laptop Run by an Agent, Guarded by Reversibility

A Fedora Silverblue ThinkPad operated by a privileged AI agent, where the safety model is a reversibility ruleset rather than a privilege ruleset. The agent has broad access but may only take actions that can be undone. An interesting inversion of the usual sandbox approach to agent safety.

linuxfedoraautomationsafety
by jctots Aug 17, 2026 6/10
workflow Reddit

A Loop Orchestrator Backed by Its Own SQLite Ticket Table

A working example of a loop orchestrator whose primary job is managing its own internal ticket table in SQLite. Having managed 600+ tickets, it can query prior related tickets when a new one arrives — the same thing a human engineer does before starting work. The author frames the database as tribal knowledge that can be handed to any model, which is where the compounding value comes from.

orchestrationsqliteticketsautomation
by croovies Aug 17, 2026 7/10
workflow Reddit

Disabling Subagents for Large Token Savings in Claude Code

The argument that Claude Code spawns subagents liberally by default and that constraining them substantially extends your usage allotment. The author keeps subagents nearly disabled and uses the model for planning and advice, reporting Fable lasts the month on a x20 plan. Worth weighing against cases where parallel subagents genuinely save wall-clock time.

tokenssubagentsusageconfiguration
by damndatassdoh Aug 17, 2026 6/10
workflow Reddit

Self-Healing TypeScript: Sentry to Claude Code to GitLab MR, Nightly

A nightly loop where Sentry errors are collected, Haiku picks one worth investigating, and Claude Code is dropped into a restricted container with the relevant context to fix it. The agent can only understand the bug, change code, and run checks — it cannot commit, push, branch, or touch GitLab, since the surrounding bash handles all of that deterministically. A separate model reads the resulting diff and writes the MR description.

automationsentrycitypescriptworkflow
by andre_ange_marcel Aug 17, 2026 8/10
workflow GitHub

projectpilot: Turn Rough Ideas Into Blueprints, Plans and QA Checks

A workflow pack that takes rough software ideas through build blueprints, implementation plans, and QA checks. It structures the pre-coding phase that agents otherwise rush past. Broad rather than deep, so useful mainly as a starting scaffold.

workflowplanningqablueprints
by mihhhir08 Aug 17, 2026 5/10
workflow GitHub

Compute Squad: Staged Model-Tier Delegation With an Audit Log

A staged delegation pipeline for Claude Code and Codex: your top-tier session runs strategy, the strongest tier plans and adversarially accepts the work, execution routes to a MECHANICAL, STANDARD, or COMPLEX model tier, and the cheapest tier handles zero-judgment busywork. Every stage writes to a shared, auditable log. The adversarial acceptance step is what keeps cheap-tier output honest.

orchestrationdelegationmodel-routingcost
by NickyStaffs29 Aug 17, 2026 7/10
workflow GitHub

dsh-cc-ecosystem: Load .claude/ Assets Unchanged Into DeepSeek Harness

A compatibility layer that lets DeepSeek Harness consume the full Claude Code asset set — skills, commands, rules, permissions, subagents, and hooks — by loading a .claude/ directory as-is. The project is working toward full compatibility rather than a partial mapping. Relevant if you want your existing Claude Code configuration to be portable across harnesses. Documentation is in Chinese.

compatibilityskillshookssubagentsdeepseekportability
by Bcy2020 Aug 16, 2026 6/10
workflow GitHub

legal-due-diligence-orchestrator: Multi-Agent Contract Review With Risk Reports

A multi-agent legal pipeline built with Claude Code, Google Gemini, and Microsoft AutoGen that automates contract due diligence. It extracts and validates compliance points across a document set and generates consolidated risk reports. Mostly interesting as a worked example of combining Claude Code with an external multi-agent framework on a document-heavy domain task.

multi-agentlegalautogengeminidocument-analysis
by rhain-r Aug 16, 2026 5/10
workflow GitHub

claude-interview-agents: Agent Team for Resume and Interview Prep

A team of Claude Code agents that collaborate on resume writing and technical interview preparation, with each agent taking a distinct role in the process. Documentation is in Korean. A compact example of applying multi-agent role separation to a non-coding task.

multi-agentinterviewresumekoreancareer
by CaesiumY Aug 16, 2026 5/10
workflow GitHub

legion: Run N User Stories in Parallel With Claude Code and Worktrees

A multi-agent orchestration system that maps user stories onto parallel Claude Code sessions, each isolated in its own git worktree so agents cannot collide on the same files. Scales the unit of work from a single task to a backlog. Worth comparing against the other worktree orchestrators before picking one.

multi-agentworktreesorchestrationparalleluser-stories
by luk-s12 Aug 16, 2026 7/10
workflow Reddit

A Driver/Reviewer Multi-Agent Workflow Pairing Claude Code With Codex

A practitioner's account of running one Claude Code agent and one Codex agent on every task, one holding the pen and the other acting as reviewer and gate, both primed with the same context so they can swap roles. Each task gets a folder holding sources of truth, per-agent briefs, and a shared 'room' where agents post Markdown messages with frontmatter, building a durable timeline of decisions and findings. The author is candid that the timeline mixes signal with stale assumptions.

multi-agentcodexcode-reviewcontext-managementworkflow
by allemaar Aug 16, 2026 7/10
workflow GitHub

Throughstone: Idea-to-Blueprint-to-Build Discipline for AI Coding Agents

A structured process for building well-architected software with a coding agent, moving deliberately from idea to blueprint to implementation rather than prompting straight into code. Aimed at counteracting the drift that shows up when an agent starts writing before the design is settled. Light on specifics until you read the repo.

architectureplanningprocessmethodologyspec-driven
by mherschberg Aug 16, 2026 5/10
workflow GitHub

jekardah-writer: Portable AI Writing Workflow With Anti-Slop Editing

A writing workflow covering hook construction, an anti-slop editing pass, and a natural Jabodetabek Indonesian voice. Portable across agent tools rather than tied to one CLI. Narrow in its target dialect but the anti-slop editing stage generalizes.

writingeditingindonesiancontentanti-slop
by konten-studio Aug 16, 2026 5/10
workflow GitHub

anywhere-agents: One Portable Config Across Every Agent and Project

A single configuration carried across every project and session, bundling curated writing guidance, routing, and skills. Includes a destructive-command guard as a safety layer. Aimed at people tired of re-creating the same agent setup per repo.

configportablesafetyrouting
by yzhao062 Aug 15, 2026 6/10
workflow GitHub

open-deal-kit: Twenty Claude Agents Covering an M&A Deal End to End

Twenty Claude agents mapped to acquirer roles, from first teaser through investment committee memo. Every claim must cite its source or it gets cut. MIT licensed, and a solid example of decomposing a domain workflow into role-specific agents.

agentsfinancem-and-acitations
by MariusGithub13 Aug 15, 2026 5/10
workflow GitHub

agentic-dev-env: Scaffold Team Knowledge Repos Agents Can Keep Fresh

Scaffolds a repo centralizing domain knowledge, workflows, and specs for AI agents to consume and develop against. Knowledge stays current through PR loops rather than manual upkeep. A team-scale answer to per-developer CLAUDE.md sprawl.

knowledge-baseteamspecsscaffold
by franKobayasi Aug 15, 2026 5/10
workflow GitHub

fleetflow: Cross-Provider Agent Fleets With Adversarial Verification

Runs heterogeneous fleets of GLM, Codex, Grok, pi, and Anthropic models as OS-process workers driven from one Claude Code session. Includes adversarial cross-model verification, journalled resume, and a machine-wide dashboard. The cross-model verification is the interesting part: different providers checking each other's work.

fleetmulti-modelverificationorchestration
by 0xDarkMatter Aug 15, 2026 7/10
workflow GitHub

claude-code-conductor: A Claude Code Framework Built Around Orchestration

A Japanese-language Claude Code framework centered on orchestrating multiple agents. Treats coordination as the primary abstraction rather than an add-on. One of many orchestration frameworks, but with a clear organizing principle.

orchestrationframeworkmulti-agentjapanese
by satoh-y-0323 Aug 15, 2026 5/10
workflow GitHub

pathfinder: A Stack-Agnostic Human-in-the-Loop Dev Workflow Kit

A workflow kit that owns the development process while your project keeps owning its stack. Human review points are built into the flow rather than bolted on. The separation of concerns makes it portable across very different codebases.

workflowhuman-in-the-loopstack-agnostickit
by rikilamadrid Aug 15, 2026 5/10
workflow GitHub

qarinah: Compact, Cited Project Memory Shared Across Coding Agents

Maintains project memory that persists across Codex, Claude Code, Cursor, and compatible tools, keeping entries compact and citing their sources. The citation requirement is the differentiator, since unverified memory is how stale context spreads. Useful if you switch agents mid-project.

memorycross-agentcitationscontext
by AjnasNB Aug 15, 2026 6/10
workflow GitHub

neta: A Leader Agent Delegating to Tiered Workers Behind Your Existing CLI

Places a leader agent in front of the coding CLI you already use, delegating work down to tiered worker agents. Supports Claude Code, Codex, and OpenCode. The tiering lets cheap models handle mechanical work while the leader keeps the plan.

delegationorchestrationtieredmulti-agent
by sudhanshug16 Aug 15, 2026 6/10
workflow GitHub

agent-workspace-architecture: A Reference Memory Layer for Claude Code

An end-to-end reference implementation of an agent-ready memory layer: roles library, typed memory, hooks, scheduled agents, self-audits, loop selection, and measurement-gated self-improvement. Ships with an interactive tour and fork-ready samples. More a blueprint to study than a drop-in tool.

memoryarchitecturehooksreference
by jimy-r Aug 15, 2026 6/10
workflow GitHub

ByeByeVibe: A Spec-Driven Control Plane With OpenSpec, Graphs, and Gates

An install kit moving a project from vibe coding to spec-driven development, providing a control plane of OpenSpec, dependency graphs, and gates for Cursor and Claude Code. The gates are what turn a spec into an actual constraint. Aimed at people whose prototypes need to become shippable.

spec-drivengatesopenspecworkflow
by pvilarim Aug 15, 2026 5/10
workflow GitHub

agent-fleet: Parallel Claude Code Sessions Against One Shared Task Queue

Runs many Claude Code sessions in parallel against a shared task queue, deriving concurrency from the actual work and from what the machine can spare. The point being that 100 tasks should not mean 100 browser tabs. Sensible resource-aware take on fan-out.

parallelqueueconcurrencyfleet
by MSKazemi Aug 15, 2026 6/10
workflow Reddit

Only 6-9% of CLAUDE.md Rules Are Auditable From a Session Trace

An attempt to verify whether Claude Code followed a project's CLAUDE.md, where the share of checkable rules fell from an initial 55.7% estimate down to roughly 6-9% after manual review. The finding is not that the rules get ignored, but that most are not objectively verifiable from a session trace. Worth reading before you try to measure agent compliance.

claude-mdauditingcompliancemeasurement
by Ok_Explorer7384 Aug 15, 2026 6/10
workflow GitHub

pwt: A Git Worktree Workflow for Multi-Project Development

A worktree-centric git workflow for juggling several projects or branches at once. Increasingly relevant because parallel agent sessions each want their own worktree. Not agent-specific, but it underpins most parallel-agent setups.

gitworktreeparallelworkflow
by jonasporto Aug 15, 2026 5/10
workflow GitHub

eng-brain: A Story-to-PR SDLC Pipeline With Gates Held in Code

A grounded SDLC pipeline for Claude Code running story to architecture to slice to fleet to pull request, with the gates enforced in code rather than in prompts. Enforcement in code is the part that actually holds under a long session. Heavyweight, but coherent end to end.

sdlcpipelinegatespull-requests
by RamanaNani Aug 15, 2026 6/10
workflow Reddit

A Model Division of Labour That Survives the Max 20x Weekly Quota

A reported split after nearly exhausting a weekly Fable quota in two days: plan and orchestrate with Fable, implement with Sonnet 5 and Opus 5 under a lean subagent-driven setup, review with Opus 5 at max effort, and loop a final review until no critical or high findings remain. Fable picks the implementer per task. Concrete numbers make it easier to adapt than generic advice.

modelsquotaorchestrationreview
by tulensrma Aug 15, 2026 6/10
workflow GitHub

MC-GPT: Multi-Coder Task and Meeting Runner Across Five Model Providers

A task, meeting, and multi-coder harness that runs the same job across Claude, Codex, Gemini, Grok, and Ollama. Reports outcomes in English or German and ships an AI-readable docs index via llms.txt. Useful if you want several coding agents to compare notes on one problem.

multi-agentorchestrationcodexgeminiollama
by IoTAiTech Aug 15, 2026 5/10
workflow GitHub

claude-phalanx: Hard-Gated Multi-Team Pipeline for Claude Code

Turns Claude Code into a phase-aware software factory with hard gates between stages, so work cannot advance until the current phase passes review. Bundles Clean Architecture and Effect coding standards, an adversarial review step, and token-budget discipline. Aimed at teams that want structure instead of free-form agent runs.

pipelinemulti-agentcode-reviewclean-architecture
by dustin-olenslager Aug 15, 2026 7/10
workflow GitHub

aiwg: Portable Agent and Workflow Layer for Seven Coding Harnesses

A cognitive-architecture layer that packages specialized agents and structured workflows, then deploys them to Claude Code, Codex, Copilot, Cursor, Factory, Warp, and Windsurf. The point is writing your process once and running it wherever you work. Useful when a team is not standardized on a single harness.

multi-platformagentsworkflowsportability
by jmagly Aug 15, 2026 6/10
workflow GitHub

dagrail: DAG Governance for Long-Running Multi-Agent Development

Models long agent runs as a governed DAG with durable state, bounded per-node context, and recoverable side effects, so a crash mid-run does not lose progress. Ships as a CLI and MCP server plus plugins for Claude Code, Codex, and Copilot. Built for multi-day jobs that exceed a single context window.

dagmulti-agentdurable-stateorchestration
by CongBao Aug 15, 2026 7/10
workflow Reddit

Fresh-Context Agents Caught 78% Near-Duplicate Questions That Embeddings Missed

While generating certification practice banks with Claude Code, the author found roughly 78% of items were near-duplicates: different scenarios and distractors, identical answer logic. Both lexical and embedding similarity scored those pairs at 0.13-0.18 cosine, i.e. genuinely distinct. Handing the items to fresh-context Claude agents with the prompt 'which of these are the same question wearing a different hat?' found them, a reusable pattern for semantic dedup where vector search fails.

deduplicationsubagentsevaluationembeddings
by hartmanma Aug 14, 2026 6/10
workflow GitHub

h-flock: Coordination Framework for Mixed Claude, Codex, and Agy Agents

An orchestration layer for running heterogeneous agents together instead of committing to one vendor's harness. Handles the coordination between Claude, Codex, and Agy so each can take the parts of a task it handles best. Relevant if you're already paying for several agent tools and want them on one job.

orchestrationmulti-agentcodexcoordination
by h-network Aug 14, 2026 6/10
workflow GitHub

oh-my-joy: Figma-to-Code Loop Plugin That Turns Plan Mode Into a Review Gate

A Claude Code plugin for frontend work that repurposes Plan mode's write block as a design review gate: a read-only spec primer runs before any code is written. Adds visual verification of the rendered result and interactive design-token sync back to Figma. Targets the usual failure of agents producing code that compiles but doesn't match the design.

figmafrontendplan-modedesign-tokensplugin
by S-jooyoung Aug 14, 2026 7/10
workflow Reddit

End-of-Session Interrogation That Turns Claude's Mistakes Into Rules

At each session's end, Claude is forced to answer a fixed set of questions: what local workaround did you apply, what claim couldn't you verify, where did the plan change, which fork needed manual correction. Answers become 'observations' tagged with a recheck-when trigger, plus a forward scan of assumptions now locked into the code. Rules are only written on the second or third instance of a shape, since acting at N=1 often fixes the wrong place.

retrospectivememorylearningsession-management
by C6ntFor9et Aug 14, 2026 7/10
workflow Reddit

Pre-Fix Gate: Claude Must File a Markdown Fix Record Before Touching Code

Every bug fix starts with a markdown case file that names the observed symptom, what was actually investigated, and a root cause stating a mechanism. 'The nested skill call never returns control to the caller' passes the gate; 'the workflow is flaky' does not. Started as pure discipline against confidently wrong fixes and became a searchable, dated corpus of the project's recurring failures.

debuggingroot-causedocumentationdiscipline
by SnooComics4579 Aug 14, 2026 7/10
workflow GitHub

vault-onboarding: Scaffold Agent Memory Into an Obsidian Vault by Interview

A conversational interview walks you through setting up persistent agent memory inside an existing Obsidian vault, generating memory files, session protocols, task boards, and per-client instructions. Keeps agent context in the notes system you already read rather than a parallel hidden directory. Works with Claude Code, Cursor, Perplexity, and Copilot.

obsidianmemoryonboardingsession-continuity
by aliasunder Aug 14, 2026 6/10
workflow GitHub

claude-oss: Run an Open-Source Repo as Its Maintainer, in One Loop

Encodes the maintainer job as a single repeatable loop: triage the tracker, delegate the work, review hard, merge on green. Ships one version of the loop with per-repo differences expressed as config rather than prose variations of the same instructions. Aimed at maintainers drowning in issues across several repositories.

open-sourcemaintenancetriagecode-reviewautomation
by Digital-Process-Tools Aug 14, 2026 7/10
workflow GitHub

ai-development-methodology: Running Projects With AI Agents as Peers

A written methodology for software projects where humans and AI agents work as collaborators rather than tool-and-user. Delivered as 12 markdown docs plus templates, git-based, with no SaaS or vendor lock-in. Process guidance rather than code — useful if you are trying to standardize how a team works with agents. CC BY 4.0.

methodologyprocesstemplatesdocumentationteam
by Korner83 Aug 14, 2026 6/10
workflow Reddit

Seven Fixes That Decide Whether Coding Agents Fly or Flail in Your Repo

A ranked writeup on what actually makes a codebase agent-friendly, backed by cited cases: fix flaky tests first (Clipboard Health saw flakes in 100% of PRs), cut CI loop time (Ramp went from 18 to 6 min P50), and curate AGENTS.md (a controlled study found 28.6% faster runs and 16.6% fewer tokens at equal quality). The rest: turn repeated corrections into hooks and CI gates, use greppable names, emit honest errors with no interactive CLIs, and read your agent transcripts.

agent-experienceciflaky-testsclaude-mdhooksbest-practices
by blumeCodes Aug 14, 2026 8/10
workflow GitHub

capstone: Architecture Design Docs Stamped to Commits

A harness plugin that keeps DESIGN.md and docs/design/ tied to actual commits, so architecture docs cannot silently drift from the code. Includes verify, query, changelog, critique, runbook, and onboarding commands, plus a greenfield design interview and product-discovery mockups. Aimed at teams that want the agent to consult a real design record instead of re-deriving intent each session.

pluginarchitecturedocumentationdesign-docscommits
by GentBajko Aug 14, 2026 7/10
workflow Reddit

No Artifact, No Done: Making Agents Attach Evidence Before Claiming Success

A practice post arguing that an agent never gets to say "done" — it has to show the file path, the diff, the URL, or the test output. The author audited a batch of "completed" tasks and found a third had produced nothing at all. The whole fix is one line in the instructions file: never report completion without attaching evidence.

verificationagentsclaude-mdprompting
by gotsomekidss_ Aug 14, 2026 6/10
workflow GitHub

claude-plugins: Worktree Draft-PR Flow With an Independent PR Reviewer Bot

An opinionated set of Claude Code plugins for GitHub-centric development: a git worktree plus draft-PR workflow, self-documenting issues, and work summaries. It also ships a separate reviewer bot that reviews PRs independently of the agent that wrote them. Useful if you want your agent sessions to land as reviewable PRs instead of direct commits.

pluginsgithubworktreepull-requestscode-review
by dbaggott Aug 14, 2026 7/10
workflow GitHub

keel: OpenSpec Execution Discipline for Claude Code, Codex, and OpenCode

Applies OpenSpec-style execution discipline to coding agents, so work follows a written spec rather than whatever the agent improvises. Portable across Claude Code, Codex, and OpenCode. For teams that want spec-first agent runs without adopting a whole framework.

workflowopenspecdisciplinemulti-agent
by TanglmChris Aug 14, 2026 6/10
workflow GitHub

changelog-fragments: One Changelog File per Agent Session, Folded Later

Each agent session writes its own changelog fragment file, and two dependency-free scripts fold and condense them into the real changelog. Avoids the merge conflicts you get when parallel agents all edit CHANGELOG.md. Simple enough to drop into any repo.

workflowchangeloggitparallel-agents
by soledesigngroup Aug 14, 2026 6/10
workflow GitHub

rolepod: 16-Agent Dev Team Workflow Portable Across Six Coding CLIs

A universal dev-team workflow with 16 specialist agents that runs on Claude Code, Codex, Gemini, Cursor, Antigravity, and opencode. Rules lazy-load to keep context small, and agents own separate paths and concerns so parallel runs do not collide. Useful if you juggle multiple CLIs and want one shared setup.

workflowmulti-agentteamparallel
by nuttaruj Aug 14, 2026 7/10
workflow GitHub

keel: Forkable Agent SDLC Gated by NIST 800-53 and CIS Evidence

A governed agent-driven SDLC you fork into your own repo, built on NIST 800-53 Rev.5, CIS Supply Chain, and the AI RMF. Gates require actual evidence rather than the agent asserting it did the work. For regulated environments where agent output needs an audit trail.

workflowcompliancesdlcgovernance
by ToddGBenson Aug 14, 2026 6/10
workflow Reddit

Keeping Claude's First Plausible Architecture From Becoming the Plan

A method for resisting anchoring on the first coherent design an agent produces: draft the architecture as a saved artifact, then run a separate review pass against that artifact without the original conversation's momentum. The prompt shape asks for named assumptions, one realistic alternative per decision, validation plans, and reversal triggers. Practical guard against agent-assisted tunnel vision.

workflowarchitecturereviewprompting
by FunNewspaper5161 Aug 14, 2026 6/10
workflow Reddit

Thinking Tokens Are ~40% of Claude Code Output and Stay in Your Context

A measured investigation into why Claude Code sessions fill their context faster than they used to, using the output_tokens_details.thinking_tokens field that appears in ~/.claude/projects/**/*.jsonl as of v2.1.228. The author documents four wrong conclusions along the way, including one retracted dramatic finding, and ships the analysis script. Worth reading for the method as much as the number.

contexttokensanalysisthinking
by killtheperfect Aug 14, 2026 8/10
workflow GitHub

graphyloop: One Command Wires a 24-Agent Swarm Across Four Coding CLIs

An agentic workflow kit that configures OpenCode, Claude Code, Codex, and Cursor with a coordinated swarm, memory that survives restarts, a 24-agent squad, and a five-gate delivery workflow. Zero runtime dependencies. Large surface area, so try it on a scratch repo first.

workflowswarmmemorymulti-agent
by chadixearth Aug 14, 2026 6/10
workflow Reddit

I Asked Opus 5 to Build GTA 6 Alone in 24 Hours Inside Unreal Engine 5

An experiment pointing Claude Code at an empty Unreal Engine 5 editor with a one-line prompt, controlling the editor live over MCP after building a harness of tooling and skills first. The agent decided geography, districts, road network, traffic, weather, map screen, and menus on its own. The author's finding is that the hard part was context, not code: it kept hitting the compaction wall, so the only continuity was whatever it wrote down.

experimentunrealmcpcontext
by ukanwat Aug 14, 2026 7/10
workflow GitHub

agent-chat-plugin: Peer Agents Chat via a Shared Folder, No Orchestrator

Lets peer AI agents talk through a shared folder with no human relay and no orchestrator, waiting at zero token cost when idle. Works on Windows, which many agent-coordination tools do not. The zero-token wait is the notable design detail.

workflowmulti-agentcoordinationwindows
by n24q02m Aug 14, 2026 6/10
workflow GitHub

session-flow: Research-to-Release Chain With Dependency-Aware Parallelism

Session workflow orchestration for Claude Code covering the full lifecycle from research through release, with dependency-aware parallelization and a brainstorming step at each stage. More structured than ad-hoc prompting across sessions. Suits longer projects where stages genuinely differ.

workfloworchestrationlifecycleparallel
by matshoppenbrouwers Aug 14, 2026 7/10
workflow GitHub

prd-taskmaster: Graded PRD Validation Into an Evidence-Gated Task Graph

A zero-config goal-to-tasks engine for Claude Code that grades PRD validity, builds a dependency-ordered task graph, and gates execution on evidence. Refuses to proceed on a vague PRD, which is the point. For teams that start from written requirements.

workflowprdtasksgating
by anombyte93 Aug 14, 2026 6/10
workflow GitHub

cortex-agent: A Governance Framework of Rules, Workflows, and Subagents

A Chinese-language governance and instruction framework for Cursor, Claude Code, and Windsurf, bundling rules, workflows, skills, and subagents in one place. Opinionated and fairly heavy. Best treated as a reference for how to structure agent governance.

frameworkgovernancerulessubagents
by Kucell Aug 14, 2026 5/10
workflow GitHub

crew: Role-Based Multi-Agent Orchestration With Parallel Worktrees

Role-based multi-agent orchestration for Herdr with durable task state, parallel git worktrees, and cross-vendor review. Durable state means a crashed run does not lose its place. Herdr-specific, but the design is readable as a general pattern.

workfloworchestrationworktreesreview
by ankitvashisht12 Aug 14, 2026 5/10
workflow Reddit

agit: A Narrow Git Interface So Claude Cannot Decide How to Branch

Git rules normally live in instructions -- do not push to main, do not force-push, open a PR -- which agents mostly follow but are not bound by. This replaces write operations with four commands (start, commit, finish, status) where start creates the task branch, commit stays local, and finish runs checks then opens a draft PR. Reads stay unrestricted; only the decisions get taken away.

workflowgitguardrailssafety
by Sad_Cover9067 Aug 14, 2026 7/10
workflow GitHub

agentcrew-dev-skills: Route Tickets Across Claude and Codex Subscriptions

A multi-agent orchestration layer built on top of mattpocock-skills. The /route command classifies a spec's tickets and splits them across your Claude and Codex subscriptions, and /crew runs them as unattended waves of tmux child agents. Aimed at people who want parallel, hands-off execution of a planned backlog.

orchestrationmulti-agenttmuxcodexworkflow
by okqixiaobao727-design Aug 14, 2026 6/10
workflow Reddit

Semantic Anchors: Compressing Prompts with Established Terms

A discussion of "semantic anchors" — established terms like MECE, Clean Architecture, or Cockburn Use Cases that an LLM already knows in depth. Instead of spelling out what non-overlapping exhaustive categories mean, you write "make these MECE" and the model expands it. A cheap way to shorten prompts without losing precision.

promptingcontext-engineeringtechniquemece
by Necessary_Abroad6632 Aug 14, 2026 6/10
workflow GitHub

ai-engineer-playbook: Hands-On Agent Labs with No API Key

A set of hands-on labs for understanding how AI agents actually work internally. The labs run on an existing Claude Code or Codex subscription rather than requiring an API key, which lowers the barrier for learning. Documentation is bilingual Chinese and English.

learninglabsagentstutorial
by louisxu168 Aug 14, 2026 5/10
workflow GitHub

devforge-ai: Agent-Driven SDLC Phases from Idea to Shipped Feature

An AI-powered SDLC workflow system that moves a feature idea through structured, agent-driven phases: planning, building, verification, shipping, and maintenance. Instead of one-shot prompting, work is broken into explicit stages each handled by agents. Useful if you want a repeatable process wrapper around Claude Code rather than ad-hoc sessions.

sdlcworkflowagentsplanningautomation
by saitarrun Aug 13, 2026 6/10
workflow GitHub

agentkit: One-Command Agent Team, Project Memory, and Process for Any Repo

Drops a team of AI agents, project memory, and an engineering process into any repository with a single command. Targets multiple harnesses — Claude Code, Cursor, and AGENTS.md — so the same setup travels across tools. Worth a look if you repeatedly hand-roll the same CLAUDE.md and agent scaffolding for each new project.

agentsproject-memoryscaffoldingclaude-codecursoragents-md
by s1rne Aug 13, 2026 7/10
workflow GitHub

nightshift: Accountable Long-Running Agent Shifts for Claude Code

A harness for running Claude Code or Codex on extended unattended shifts with accountability built in. It structures long sessions so you can see what the agent did and why, instead of waking up to an opaque diff. Aimed at overnight or multi-hour autonomous runs.

automationlong-runningcodexaccountabilityovernight
by orwa-mahmoud Aug 13, 2026 7/10
workflow GitHub

agentit: Provider-Neutral Harness for Agent Orchestration and Skills

A portable harness handling safe orchestration, skill routing, and configuration management across AI coding agents. The pitch is keeping your setup from being locked to one vendor's config format. Early-stage, but relevant if you run several agents side by side.

orchestrationharnessskillsconfigurationportable
by marcmarti9 Aug 13, 2026 5/10
workflow Reddit

Week 4 Vibecoding an MMO: Model Routing, Test Ratios, and Balance

A build-in-public devlog on running a multiplayer game project almost entirely through agents. Notable details: 0.77 lines of test code per line of game code with the whole suite running on every prompt, and a routing setup where one model handles art and strategy while spawning separate agents for code. The open problem the author reports is that AI cannot tell whether gameplay is actually balanced.

vibe-codingdevloggame-devtestingmulti-agent
by Electrical-Pig Aug 13, 2026 6/10
workflow GitHub

gtm: A Phase-Gated Marketing and Sales Workflow for Software Engineers

A plain-markdown workflow that walks an engineer from zero to first users to first paying customers, with reality gates between phases so you cannot skip ahead on optimism alone. Being markdown-only, it works with any LLM or agent harness rather than binding to one tool. Aimed at developers who can build the product but stall at distribution.

workflowmarketingsalesgo-to-marketmarkdown
by JeroenOnNostr Aug 13, 2026 6/10
workflow Reddit

Dopamine: An Agent Loop That Checks Cheaper Options Before Writing New Code

Dopamine is a prediction-and-feedback loop for coding agents that stops them from mistaking motion for progress. Before writing custom code it checks whether the behavior already exists, whether config suffices, whether a project helper or installed dependency covers it, and only then writes something new. The author benchmarked it across 12 tasks and reports wins on code size, tokens, cost, and time.

agent-loopover-engineeringbenchmarktoken-efficiency
by AutoProspectAI Aug 13, 2026 7/10
workflow Reddit

A 41-Skill Solo Guild Setup: Router, Cheap Subagents, and Four Rules

A month of solo projects turned into 41 single-purpose SKILL.md files plus a router that picks the smallest party for each task. No MCP, no API keys, just markdown: the main session delegates big builds to an expensive-model subagent and mechanical work to a cheap one with a report format that bans essays. The load-bearing rule is that whatever builds a thing never evaluates it.

skillssubagentsdelegationmodel-routing
by kusa-jp Aug 13, 2026 7/10
workflow GitHub

handoff: Dispatch Implementation Plans to a Second AI Executor from the CLI

handoff splits agent work into two roles: a coordinator that writes the implementation plan and an executor that carries it out, leaving you to review rather than drive. It is pure CLI and works across opencode, Claude Code, grok, and codex. Remote development machines are supported, so the executor can run somewhere other than your laptop.

orchestrationclimulti-agentcode-review
by Xsxdot Aug 13, 2026 7/10
workflow GitHub

goblin-watcher: Linear Tickets to Parallel Agent Sessions in tmux Worktrees

goblin-watcher turns a Linear ticket into a branch, a git worktree, and a running agent session in one step. Each agent gets its own worktree so parallel work does not collide. tmux windowing gives you a single place to watch and switch between all the concurrent sessions.

worktreesparallel-agentslineartmux
by shr3kst3r Aug 13, 2026 7/10
workflow Reddit

The Worklog and KnownPitfalls.md: Passing Hard-Won Context to Future Agents

A six-month-old workflow built around a /worklog command that appends a reverse-chronological session log to worklog.md in the project root. The explicit purpose is knowledge transfer to future agents rather than proof of work, so entries are capped at two to three sentences and record the why, since git history already covers the what. A companion KnownPitfalls.md captures the gotchas that survive model regressions.

worklogcontext-transferdocumentationslash-command
by callmejace Aug 13, 2026 7/10
workflow Reddit

Managing an Agent Farm: Using OSC 633 Shell Integration to Track Agent State

Running four or five agents at once turns your job into deciding who needs attention next, and supervision does not scale the way execution does. The author found that detecting agent state from output silence fails because Claude Code polls the terminal constantly and its replies land on the input stream. VS Code shell integration via OSC 633 turned out to be the reliable signal for command start, end, and exit codes, though running-versus-stuck still needs output inspection after stripping ANSI.

parallel-agentsmonitoringosc-633terminal
by Ecstatic-Night4222 Aug 13, 2026 7/10
workflow Reddit

Claude Code skips read-before-edit enforcement for the 5-family models

Community report that Claude Code's long-standing 'must read a file before editing it' guard is now bypassed for Opus 5, Sonnet 5 and Fable 5. The poster observed test clobbering as a side effect, especially with Fable overwriting existing tests when asked to add new ones. Useful context if you rely on that guard as a safety net.

harnessedit-toolsafetytesting
by myninerides Aug 13, 2026 7/10
workflow GitHub

sasu: A strict senior reviewer that verifies every 'done' with evidence

Interviews the tacit knowledge out of your head, pins it into a PRD, then double-checks the coding agent's work against it and demands evidence for every completion claim. Agent-agnostic and deliberately simple. Aimed at the failure mode where an agent declares success without proof.

verificationprdcode-reviewagent-agnostic
by yansfil Aug 13, 2026 6/10
workflow Reddit

Shipping a paid product in one day with eight parallel Claude Code agents

A build report on launching a digital-product business end to end in a single working day, with eight parallel Claude Code sessions each writing one deliverable. Covers the verification gates used to keep parallel agents honest and the Stripe re-verification done server-side before serving downloads. Read it for the parallel-agent coordination pattern more than the product.

parallel-agentsverificationstripebuild-report
by operastudio Aug 13, 2026 6/10
workflow GitHub

infra-moonlight-tavern: Multi-repo project management using git as the database

Decentralized project management across repos driven by Claude Code, where git is the store and PR lifecycle is the task status. No backend to run. An interesting fit if your work already lives in PRs and you resent adding a separate tracker.

project-managementmulti-repogitno-backend
by lumetrix-dev Aug 13, 2026 6/10
workflow GitHub

vibe-flow (patrick1099): Grade the task first, then size the process to it

A personal vibe-coding workflow plugin for Claude Code and Codex built on one decision: is this a small job or a big one? That single grading call then drives clarification depth, whether to explore alternatives, whether to write docs, and how strict verification should be. Chinese-language docs. Deliberately light for small tasks.

workflowplanningpluginchinese
by patrick1099 Aug 13, 2026 5/10
workflow GitHub

agent-logger: Append-only AGENT-LOGGER.md record of tool customizations

A cross-agent convention: whenever a tool is customized or modified, append an entry to AGENT-LOGGER.md at the artifact root. Gives you a reviewable, reproducible trail of what the agent changed about its own environment. No tooling required — it is a protocol.

loggingreproducibilityconventionaudit-trail
by bsawang Aug 13, 2026 5/10
workflow Reddit

Keeping a MISTAKES.md: what actually happened after months of use

A trivial setup — a MISTAKES.md in the repo plus one line in CLAUDE.md telling the agent to log what happened, root cause and prevention. No tooling, no vector store. The report is that the agent actually reaches for the file unprompted, citing past decisions like 'this approach was avoided because...'. Worth reading for the honest account of what it does and does not fix.

memoryclaude-mdretrospectiveconvention
by thabxi Aug 13, 2026 7/10
workflow GitHub

claude-orchestrator: Roles and harnesses as orthogonal axes

A plan, delegate, verify workflow where the role (planner, implementer, verifier) is independent of the harness running it — so any role can run on Claude, Codex, Grok or Pi. Includes an enforced no-implement mode for planning roles and a cross-harness message bus. The orthogonality is the interesting design choice.

orchestrationmulti-modeldelegationplanning
by maplenk Aug 13, 2026 7/10
workflow GitHub

cortex-loop: Proof gates and holdout attacks for autonomous engineering

An evidence-driven autonomous loop for Claude Code built from independent agents, proof gates between phases, holdout attacks against the work produced, and a final audit. The holdout-attack step — adversarially testing the result with material the builder never saw — is the part worth stealing.

autonomousverificationadversarialproof-gates
by lucasterres Aug 13, 2026 7/10
workflow GitHub

caty-agent-harness: A harness that learns from its own failures

Runs your tasks to a verified done and feeds failures back into itself so the next run avoids them. Plain text files and real checks, no daemon to keep alive. The self-improving angle is common in pitches and rare in implementations — worth a look for the file format alone.

harnessself-improvingverificationplain-text
by caty-ai Aug 13, 2026 6/10
workflow Reddit

A two-page printable Claude Code cheat sheet

Page one covers working inside a session: keyboard shortcuts, prompt prefixes, permission modes, context management, slash commands and bundled skills. Page two covers everything around it — CLI flags, settings file precedence, permission rules, subagents, skills, hooks, MCP, CLAUDE.md and hook events. Free PDF, no signup.

referencecheat-sheetshortcutssettings
by nicwortel Aug 13, 2026 7/10
workflow Reddit

Two Claude Code sessions ate each other's work — found only via git reflog

One session ran a schema migration while another did 'unrelated' cleanup, and the cleanup session deleted the three-minute-old migration as unused. Session one regenerated it differently, leaving two plausible schema versions and a broken database. A concrete cautionary tale about running parallel sessions in one working tree.

parallel-sessionsgitincidentworktrees
by Specialist_Agent3599 Aug 13, 2026 6/10
workflow Reddit

Comparing five memory systems for Claude Code — and why 'long-term memory' is the wrong frame

The author found the frameworks are not interchangeable: Mem0 extracts reusable facts and preferences, MemU turns session history into markdown procedures, and the others solve different problems again. Argues you should name the specific problem — stale facts, repo scoping, procedure reuse — before picking a tool.

memorycomparisonmem0context
by WishboneImmediate509 Aug 13, 2026 7/10
workflow Reddit

Are you isolating your Claude Code agents? A discussion on sandboxing setups

Raises the concern that running an agent inside a directory does not confine it to that directory — it has your whole filesystem and shell. Asks whether the exfiltration and accidental-deletion risks are real in practice and what setups people actually run. The comment thread is the value here.

sandboxingsecurityisolationdiscussion
by aj_kt Aug 13, 2026 6/10
workflow GitHub

awesome-agent-orchestrators: Curated List of Agent Orchestration Tools

A community-maintained awesome-list cataloging tools that orchestrate multiple coding agents. Useful as a starting map when you are shopping for a multi-agent runner rather than building one yourself. Low effort to browse, high breadth.

orchestrationawesome-listmulti-agentdirectory
by andyrewlee Aug 13, 2026 6/10
workflow GitHub

ai-tpk: Clone-Run-Forget D&D-Themed Multi-Agent Toolkit

A Claude Code toolkit packaging planning, review, investigation, and shipping as D&D-flavored multi-agent workflows. Designed to be cloned into a repo, used, and discarded rather than maintained as a long-lived dependency.

multi-agenttoolkitcode-reviewplanning
by alkofu Aug 13, 2026 6/10
workflow GitHub

stepstone: A Dependency-Aware Roadmap That Lives In Your Repo

Keeps a project roadmap as repo-resident state with explicit dependencies between steps, so an agent can always tell what is unblocked next. Drivable from the terminal or by any coding agent, which keeps planning and execution in the same source of truth.

roadmapplanningdependenciesrepo-native
by max-miller1204 Aug 13, 2026 7/10
workflow GitHub

wtcraft: Git-Native Task Contracts That Keep Agents In Their Lane

Defines a task contract per unit of work and runs deterministic scope and verification checks against git state. If an agent edits outside the declared scope or fails verification, the check fails, giving governance that does not depend on the model behaving.

governancegitverificationscope-control
by zywkloo Aug 13, 2026 7/10
workflow GitHub

ahp_plus: Git-Backed Continuity and Handoffs Across AI Agents

Stores agent continuity, evidence, and authority in git so a task can be handed between platforms without losing verified context. Aimed at teams that rotate between different coding agents and need the handoff to carry proof, not just prose.

continuityhandoffgitcross-platformevidence
by jossuealcacao-exe Aug 13, 2026 6/10
workflow Reddit

Truthmark: A Maintenance Loop So Spec Docs Stop Going Stale

Addresses the second half of spec-driven development: after a feature ships, hotfixes and refactors quietly desync the design docs from the code. Truthmark maps codebase areas to their governing documents and forces future changes to reconcile the docs, keeping them usable as agent context.

documentationspec-drivenmaintenancedriftopenspec
by Middle_Key8737 Aug 13, 2026 8/10
workflow GitHub

prd-agents-framework: Multi-Agent PRD Creation and Review

Structures requirements work as a multi-agent pipeline grounded in BABOK, using perspective-based reading so each reviewer agent hunts a different class of defect, plus explicit requirement smell detection. More rigorous than the usual one-shot PRD prompt.

prdrequirementsmulti-agentbabokreview
by vshidlovsky Aug 13, 2026 7/10
workflow GitHub

pm-scaffold: PRD-Only Scaffold With Non-Bypassable Human Gates

A Chinese-language PM scaffold that converts raw requirements into a traceable, human-confirmed PRD. Uses six-state knowledge annotation to mark what is confirmed versus assumed, and hard human gates that the loop cannot skip.

prdproduct-managementchinesehuman-in-the-looptraceability
by konwait12 Aug 13, 2026 6/10
workflow GitHub

shipmates: Role-specialized subagents with persistent per-project memory

A Claude Code subagent framework where each persona keeps its own memory that survives across sessions in a project, so specialists accumulate context instead of starting cold. Adds a live lead-and-crew channel for dispatching work, steering agents mid-task, and approving steps human-in-the-loop. Aimed at longer multi-agent efforts where losing context between runs is the main cost.

subagentsmemoryorchestrationhuman-in-the-looppersonas
by luthermonson Aug 13, 2026 8/10
workflow Reddit

Claude Code Wired Into Linear as an Agent That Answers From Your Notes

A Linear OAuth app registered as an agent: mention it or delegate an issue and it starts a Claude Agent SDK session on your own machine, with cwd pointed at an Obsidian knowledge base. CLAUDE.md rules and MCP servers load as in a normal session, answers appear in the issue thread, and follow-ups resume the session. About 946 lines of TypeScript, and it runs on a Claude Code subscription rather than an API key.

linearagent-sdkobsidianknowledge-baseintegration
by ChartBuilder Aug 12, 2026 8/10
workflow GitHub

ai-workstation-setup: Idempotent Setup Script Plus CC Skills, Agents, Hooks

A personal AI coding workstation captured as code: an idempotent setup script, tmux and shell configuration, and template Claude Code instructions, skills, agents, and hooks geared toward spec-driven development. Useful as a starting point if you are assembling your own baseline rather than copying fragments piecemeal.

setupdotfilesskillshooksspec-driven
by alpersonalwebsite Aug 12, 2026 6/10
workflow GitHub

klaude: Discipline Layer That Keeps Context Current and Logs Decisions

A lightweight layer over Claude Code sessions that keeps project context up to date, enforces explicit decision logs, and aims to reduce agent drift over long-running work. It targets the failure mode where an agent slowly loses the thread of earlier choices. Minimal setup compared with heavier orchestration frameworks.

context-managementdecision-logagent-driftdiscipline
by Silverfell Aug 12, 2026 6/10
workflow GitHub

llm-wiki-3m-universe: Multi-Agent Knowledge Governance With Tiering

A knowledge-governance system for multi-agent setups built around L0-L3 task tiering, explicit handoff protocols, and spec arbitration between agents. Includes a curated LLM and deep-learning knowledge base with full auditability.

multi-agentknowledge-basehandoffgovernance
by yschang1688 Aug 12, 2026 5/10
workflow GitHub

kb-metabolism: Markdown Knowledge Bases That Expire Unless Used

Gives a Markdown knowledge base a metabolism: notes expire by default and are renewed by being used. The AI proposes what to prune or keep, but a human makes the final call on removals.

knowledge-basemarkdownmemorypruning
by chenyk2016 Aug 12, 2026 6/10
workflow GitHub

spark: Turn Claude and GitHub Subscriptions Into a Delivery System

Wires an existing Claude subscription together with GitHub into a repeatable software delivery pipeline. Aimed at people who already pay for both and want them working as one system rather than two disconnected tools.

githubcideliveryautomation
by jwogrady Aug 12, 2026 5/10
workflow Reddit

Sane Permission Defaults for Claude Code: Deny, Ask, Allow

A working guardrail configuration up for community critique: deny rm -rf, .ssh/.aws/.env reads, curl-pipe-bash and force pushes; ask for package publishing, sudo, and unknown MCP tools; allow ordinary reads, tests, and builds. The open question is where .env access and force push belong before approval fatigue sets in.

permissionssecurityguardrailsconfig
by ashrey-26 Aug 12, 2026 5/10
workflow GitHub

kijito-claude: Sessions That Self-Check Context and Clear Safely

Runs Claude Code sessions that are aware of their own context state: a real context self-check, auto catch-up for armed panes, and a safe self-clear loop for long-running work. Backed by Kijito but usable standalone.

contextsessionsautomationlong-running
by KijitoAI Aug 12, 2026 6/10
workflow Reddit

Keeping Opus 5 Pleasant: Fresh Context and Two Small Skills

A user reporting none of the commonly cited Opus 5 annoyances describes their method: restart sessions whenever docs and solution are consistent, run at max effort in auto mode, and load two small self-made skills (keeping-it-simple, writing-asd-ste100). Projects maintain a requirements.md and dev-plan.md detailed enough to rebuild from.

opus-5contextskillsprompting
by timsam Aug 12, 2026 5/10
workflow Reddit

A 9-Agent Conversion-Design Team With an Adversarial Art Director

A Claude Code plugin structuring nine agents into a conversion-design pipeline, from researcher through to an adversarial art director running on Opus and a QA inspector. Sixteen skills distill design-award and conversion research, and three mechanical QA gates fail the build — including a zero-dependency headless-Chrome audit over raw CDP that measures the rendered page rather than the source.

pluginmulti-agentdesignqa-gates
by mmanja84 Aug 12, 2026 8/10
workflow GitHub

Supreme-Leader: Agent Teams With Hook-Enforced Verification

An installable Claude Code plugin organizing work across five agent teams, with hooks that block claims which do not hold up: test results that fail to reproduce and imports that do not resolve. Runs plain by default, with the tyrant theming optional.

pluginmulti-agenthooksverification
by MohamedEmbarak Aug 12, 2026 6/10
workflow Reddit

Treat Agents Like Cattle, Not Pets: An Orchestrator-First Pattern

Argues most agent setups are pets — individually prompted, watched, and corrected, which caps you at roughly two at a time. The cattle alternative: never instruct a worker directly, have an orchestrator spawn each agent with one job and exactly the context that job needs, and discard rather than nurse the ones that come back wrong.

orchestrationsubagentspatternsscaling
by ronin4001 Aug 12, 2026 6/10
workflow GitHub

keel (grimaldost): Definition-of-Ready Gates and a Blind Pre-Mortem

A governed development method packaged as a Claude Code plugin. Deterministic Definition-of-Ready gates and a mandatory blind pre-mortem keep multi-PR, agent-built work from drifting apart across sessions.

plugingatespre-mortemgovernance
by grimaldost Aug 12, 2026 6/10
workflow GitHub

AI Forge: Multi-Agent Dev Ecosystem With Self-Healing CI

An autonomous multi-agent development setup that takes an idea to production-ready software using specialized agents with full local codebase context, self-healing loops, and an auto-fix CI/CD flow.

multi-agentci-cdself-healingautomation
by chithanh85 Aug 12, 2026 5/10
workflow GitHub

claude-code-team-memory: Auto Memory Into a Reviewed AGENTS.md

Distills each team member's Claude Code auto memory into a shared AGENTS.md committed to the repo. Entries are filtered and deduplicated, and every change is gated behind a pull request so team memory gets reviewed rather than silently accumulated.

memoryteamagents-mdpull-request
by babyrooster248 Aug 12, 2026 7/10
workflow Reddit

terminal-setup Fails on Ubuntu? Use Ctrl+J for Multiline Prompts

On VTE-based terminals like GNOME Terminal, Claude Code's /terminal-setup refuses to run, which normally breaks Shift+Enter multiline input. The fix is not to debug it: use Ctrl+J to insert a newline and Enter to submit.

ubuntuterminalgnometroubleshooting
by atish31 Aug 12, 2026 5/10
workflow GitHub

cc-operator-plugin: An Evidence Ledger and a Stop-Hook That Blocks

A Claude Code orchestration harness built around a chief-operator charter, tier-routed review and planning workflows, an append-only evidence ledger paired with an input-axis token compressor, and a Stop hook that refuses to let a session end while work remains unverified.

orchestrationhooksevidenceverification
by betmoar Aug 12, 2026 7/10
workflow Reddit

Measured: Why MCP Round-Trips Can Cost 3x More Than They Save

A couple of weeks of measurement comparing a custom harness against plain Codex and Claude Code on identical tasks: the harness cost roughly 3x for the same patch and the same passing tests, with most of the overhead in the protocol rather than the work. The core argument is that these protocols are stateless, so adding tokens to an existing call is linear but adding a turn is quadratic — and MCP cannot batch calls, so every tool use is another full turn.

mcptokenscostbenchmark
by KitchenAmoeba4438 Aug 12, 2026 8/10
workflow GitHub

claude_forge: Branch-by-Branch Workflow With a Validated Brief

A development workflow for Claude Code that works one branch at a time: it requires a validated brief up front, generates a structured plan from it, and tracks progress with minimal update churn.

gitbranchingplanningworkflow
by jeanchristoph Aug 12, 2026 6/10
workflow Reddit

A Daily Claude Code Workflow: Git, Worktrees, and Versioning First

A practical account of one developer's daily Claude Code habits after months of use. The core advice: always use git and push immediately (private repo if you're self-conscious), and always work in worktrees with versioning so parallel features never collide.

gitworktreesworkflowbest-practices
by oxmannnn Aug 12, 2026 6/10
workflow Reddit

It's Not Opus, It's Your Instructions: Auditing CLAUDE.md for Drift

Argues that Opus 5 follows instructions well — including instructions you wrote long ago and forgot — so complaints about low-confidence, over-cautious behaviour often trace back to accumulated CLAUDE.md rules. The author compared common user complaints against Anthropic's docs and their own repo and compiled a list of instruction patterns that make an agent skittish.

opus-5claude-mdinstructionsprompting
by MickQn Aug 12, 2026 6/10
workflow GitHub

agentic-product-management-system: Capture, Verify, Keep Current

A product-lifecycle system for software built with AI coding agents: capture what was learned during the work, verify that changes do what they claim, and keep published content current as the product moves.

product-managementlifecycledocumentationverification
by natannovum Aug 12, 2026 5/10
workflow GitHub

memos: A Personal Operating System for Running OSS Projects

One maintainer's personal operating system for running their open-source projects — rules, repository structure, task definitions, and agent skills that guide an AI agent consistently across every repo.

rulesskillsproject-managementopen-source
by memclutter Aug 12, 2026 5/10
workflow Reddit

Using a Haiku 4.5 Subagent to Reword Opus 5's Output

A technique for readers who find Opus 5's prose hard to parse: have Opus launch a Haiku 4.5 subagent at the end of each task whose only job is rewording the response into plainer language. The open question the author raises is whether the smaller model drops detail that mattered.

haikusubagentreadabilityopus-5
by thehoundtrainer Aug 12, 2026 5/10
workflow GitHub

codex-plugin-to-claude: Dual-Model Review With Codex and Claude

An open-source Codex skill and plugin for running code review through two models at once, pairing OpenAI Codex with Claude Code so each checks the other's reading of the diff.

code-reviewcodexdual-modelplugin
by spenceryangxiao-dotcom Aug 12, 2026 6/10
workflow GitHub

vision-driven-design: Prove Every Commit Traces to a Business Goal

Bi-directional traceability for AI-assisted development: an eight-phase chain with seven gates and 113 checks establishing that every commit traces back to the business goal that authorized it. Ships as a skill for Claude Code, Cursor, and OpenCode, backed by a hosted MCP server.

traceabilitygatesgovernancemcp
by simonplmak-cloud Aug 12, 2026 6/10
workflow Reddit

A Practical Guide to Running an AI With Subagents

A beginner-oriented working method for agent setups. The central rule: always pick a main model smarter than the subagents it manages, because the reverse consistently goes badly. The rest covers defining your working method with the model up front and where instructions belong.

subagentsorchestrationguidemodels
by Ok_Rub9933 Aug 12, 2026 6/10
workflow GitHub

ModelPeer: Let Claude, Codex, and Gemini Peer-Review Each Other

Cross-model peer review for coding agents. Claude Code, Codex CLI, and Gemini CLI consult one another as independent read-only engineering peers, so a second model can challenge a plan without being able to change the code.

peer-reviewcross-modelcodexgemini
by makedirectory Aug 12, 2026 7/10
workflow Reddit

A Dictionary of Claude Code Terms, Starting With the Ratchet

A push for shared vocabulary in agentic coding, opening with the ratchet pattern: borrowed from a ratchet wrench that turns one way and locks, it means enforcing monotonic progress. The agent works one discrete sub-item at a time, and once a step passes mechanical verification — a test, a linter, a build constraint — that progress is locked and the agent cannot roll back or oscillate.

terminologyratchetpatternsglossary
by Afraid-Yoghurt6731 Aug 12, 2026 6/10
workflow GitHub

sdd-hello-world: Spec-Driven Development with GitHub Issues as Memory

A demo repo for the talk The Human Is the Loop, showing spec-driven development with a coding agent. Four slash commands work for both Claude Code and opencode, GitHub issues serve as the agent's persistent memory, and each task gets its own git worktree. A compact reference for wiring specs, issues, and worktrees into one loop.

spec-drivenslash-commandsworktreegithub-issuesworkflow
by petar-djukic Aug 12, 2026 7/10
workflow Reddit

Eight Days of Headless Claude Code + Codex Built a 52-Game Site

A developer gave headless Claude Code and Codex processes an open-ended goal and coordinated them with a deliberately thin harness: a scheduler, shared documents, and a short constitution. Eight days later the project had 52 games, AI opponents, puzzles and original art, with agents proposing new requirements and extending the harness itself when they hit its limits. A concrete case study in letting orchestration stay minimal instead of reaching for an agent framework.

orchestrationheadlessmulti-agentcase-study
by Difficult-Writer6663 Aug 11, 2026 7/10
workflow Reddit

60 Subagents and 2,400 Shell Commands: Claude's Riemann Hypothesis Run

An account of an Anthropic staffer prompting Claude to attempt the Riemann Hypothesis with little more than encouragement. After 650 failed ideas, a second run spent a day and a half coordinating roughly 60 subagents that ran 2,400 shell commands, wrote hundreds of Python scripts, checked results against known zeta zeros and refereed each other's work. Interesting as a data point on how far self-directed subagent fan-out can be pushed.

subagentsresearchorchestrationlong-running
by TangibleHangnail Aug 11, 2026 6/10
workflow GitHub

herdr-automations: Cron for Coding Agents in Fresh Git Worktrees

The trigger layer for the Herdr runtime: pair a cron schedule with a prompt and it wakes an agent in a fresh git worktree to run while you sleep. Includes MCP config, an overlap guard so runs do not collide, run history, and a live board. Useful if you want scheduled unattended agent work without hand-rolling the locking and isolation.

cronschedulingworktreeautomation
by DnzzL Aug 11, 2026 7/10
workflow GitHub

claude-code-book: Technical Guide to Claude Code CLI Architecture

A written walkthrough of how the Claude Code CLI is put together, from startup flow through to the design of its query engine. Aimed at people who want to understand or reimplement agent harness internals rather than just use them.

internalsarchitectureguidecli
by ptolemaic-programmemusic151 Aug 11, 2026 7/10
workflow GitHub

bug-receipt: No 'Fixed' Without Receipts — an Evidence Gate for Agents

A portable gate that refuses to let a coding agent declare a bug fixed without producing evidence: the failing reproduction, the change, and the passing result. Targets one of the most common agent failure modes, where a plausible edit is reported as a fix that was never actually verified.

verificationtestingevidencequality
by lMysticl Aug 11, 2026 7/10
workflow GitHub

agent-foreman: Strong Models Plan and Verify, Cheap Agents Do the Coding

Splits a task so a capable model writes the plan and checks the result, while weaker and cheaper agents execute clearly bounded coding steps. The point is to spend expensive reasoning on decisions and verification rather than on mechanical edits.

workfloworchestrationplanningcost-optimizationmulti-agent
by xu-0306 Aug 11, 2026 7/10
workflow Reddit

The Repository Is the Wrong Unit of Work for Claude Code

Argues that pointing Claude at a whole repo and describing a feature in prose forces it to rediscover system boundaries every time. Proposes delegating at the level of a seam behind a specific interface, making six things explicit: bounded outcome, contract, editable files, off-limits surfaces, acceptance evidence, and integration points needing separate checks. Recasts CLAUDE.md as a router to authoritative contracts rather than an encyclopedia.

workflowcontext-managementdelegationclaude-mdtask-scoping
by jonah_omninode Aug 11, 2026 7/10
workflow GitHub

mkrdlc: Self-Hosted AI-Driven Development Lifecycle Template

A repo template laying out a full AI-driven development lifecycle for Claude Code, self-hosted rather than tied to a service. Gives you a starting structure for running planning, implementation, and review phases as a defined process instead of ad-hoc prompting.

workflowtemplatesdlcself-hostedprocess
by kikrgbh Aug 11, 2026 6/10
workflow Reddit

pi-plugin-cc: Run DeepSeek Flash sessions from Claude Code as an orchestrator

A Claude Code plugin, modeled on the official Codex plugin, that spawns DeepSeek Flash sessions from inside a CC session. The author uses Opus as the orchestrator and delegates bug-hunt verification passes across large repos to the cheaper model. Worth a look if you want a multi-model setup where the expensive model plans and a fast model does the sweeping.

pluginorchestrationmulti-modeldeepseekcode-review
by kingbling Aug 11, 2026 6/10
workflow Reddit

A message-passing pattern for coordinating Claude Code across sibling repos

Discussion of how to run work that spans multiple repositories. The author keeps all repos as siblings (never nested), runs one CC session per repo, and passes work between them by having an agent write a Markdown file into the target repo's messages/ folder for the other session to pick up. Comments compare this against running a single session over several repos at once.

multi-repocoordinationmonorepopatternsdiscussion
by fabpub Aug 11, 2026 5/10
workflow GitHub

agentic-workflow-template: An "Agent Covenant" governance template for autonomous agents

A GitHub repo template that ships a governance framework — the "Agent Covenant" — defining what an autonomous coding agent may do unsupervised and where it must stop. Works across Claude Code, Antigravity, and Aider. Start here if you want guardrails scaffolded into a new project rather than written from scratch.

templategovernanceguardrailsautonomous-agentsscaffolding
by mancano-tales Aug 11, 2026 6/10
workflow GitHub

claude-phases: One PR per phase, gated auto-merge, drivable from your phone

Turns a markdown implementation plan into a phased delivery pipeline: each phase becomes its own pull request with a gated auto-merge, so you approve progress one step at a time. Because the loop runs through the repo rather than a local terminal, you can drive a session from your phone. Good fit for long builds you want to supervise asynchronously.

planningpull-requestsautomationphased-deliveryremote
by sixoverground Aug 11, 2026 7/10
workflow Reddit

claude-power-pack: Wave Orchestration From Spec-Kit Design to Shipped Features

Adds 'flow-wave' and 'register' commands so one orchestrator agent can drive multiple agents through waves of features. The chain runs project init, syncs planned tasks to GitHub issues, registers agents, then iterates through issues by dependency priority with approval gates. Built on Claude Code's inter-session SendMessage support.

orchestrationmulti-agentspec-drivengithub-issues
by clash_clan_throw Aug 11, 2026 7/10
workflow Reddit

agentic-company-seed: Operating Doctrine Kit for Running a Company on Claude Code

A distilled seed kit of the operating doctrine behind a company that runs most work through Claude Code. Covers constitution architecture, verification that executes rather than reads, delegation and model routing, governed versus passive memory, and a 31-class failure taxonomy mined from real incidents. Meant to be handed to Claude so it can generate your own version.

doctrinegovernancedelegationmemoryfailure-taxonomy
by idcydwlsnsmplmnds Aug 11, 2026 7/10
workflow GitHub

dev-lead: Cross-Model Delegation With Adversarial Review Across Four CLI Agents

One lead agent delegates to four runtime adapters covering different CLI coding agents, with a hard rule that no change merges if it was only reviewed by its own model family. Cross-family review is meant to catch the blind spots a model shares with itself. A concrete implementation of the implementer/auditor split many people build by hand.

multi-modeladversarial-reviewdelegationorchestration
by aarontzeng Aug 11, 2026 7/10
workflow GitHub

haft: Decision Engine That Flags Decisions When Their Evidence Goes Stale

Frames, compares, and records engineering decisions, then tracks decay of the evidence each one rested on so stale decisions surface instead of silently persisting. Enforces parity between what was decided and what is in the repo. Works across Claude Code, Cursor, Gemini CLI, and Codex.

decisionsadrevidencemulti-agent
by m0n0x41d Aug 11, 2026 6/10
workflow GitHub

local-llm-subcontractor: Delegate Test-Gated Grunt Work to a Local LLM

One-shot setup that wires a local model such as Qwen3.6-27B or Bonsai 27B in as a subcontractor to Claude Code or Codex via a delegate CLI. Delegated work is test-gated, so the cheap model's output has to pass before it counts. A pragmatic way to cut token spend on mechanical tasks.

local-llmdelegationcost-savingtesting
by focuslight-nr Aug 11, 2026 7/10
workflow GitHub

fusebase-flow: Product Owner and Developer Agent Pair for Client Work

A two-agent framework where a Product Owner agent advises what to build and an AI Developer agent ships it. Targeted at client-facing teams building internal and client apps. Built and maintained by FuseBase.

multi-agentproductframeworkclient-work
by fusebase-dev Aug 11, 2026 5/10
workflow Reddit

How One Team's Software Factory Failed Before It Worked

An engineering write-up tracing the path from 'let Claude Code implement our PRs' through realizing it does not work, to building something closer to an actual software factory. Honest about the failure modes encountered along the way. Useful counterweight to the usual success stories.

case-studysoftware-factoryprocesspost-mortem
by sn1pr0s Aug 11, 2026 6/10
workflow GitHub

fluencyloop: Development Workflow That Produces Understanding Alongside Code

An AI-assisted workflow built so the human ends up understanding the code, not just receiving it. Teaches as it goes, captures decisions, generates documentation, and assembles review material. A response to the review-fatigue problem of high-volume AI output.

workflowdocumentationlearningreview
by baokhang83 Aug 11, 2026 5/10
workflow GitHub

OpenSocrates: 48 Reasoning Systems Invoked Only When Deeper Thinking Helps

A local, open-source reasoning framework for Claude and Codex containing 48 authored reasoning systems, selected conditionally rather than always applied. The selectivity is the design point — the cost of deeper reasoning is only paid when it pays off. Runs entirely locally.

reasoningframeworklocalprompting
by ParkerHwang Aug 11, 2026 6/10
workflow GitHub

vibestrate: Supervised Multi-Provider Coding Flow With Local Run Logs

Runs Claude Code, Codex, Gemini, Aider, or local models as a single crew while you approve the risky steps yourself. Every run log stays on your machine, and providers can be swapped without rewriting the flow. Provider-agnostic by design.

orchestrationapproval-gatesmulti-providerlogging
by guyshonshon Aug 11, 2026 6/10
workflow Reddit

Building an AI SRE Agent: Exception to GitHub Issue to Claude Code Action

A write-up of an on-call loop where a production exception opens a labeled GitHub issue, which triggers a GitHub Action running claude-code-action with Opus at high effort. Claude uses a skill plus a read-only CLI to pull stack traces, traces, and logs, investigates root cause, then either edits code or leaves findings. The observability tool is swappable; the Claude Code mechanics are the transferable part.

sregithub-actionsobservabilityautomationon-call
by narrow-adventure Aug 11, 2026 7/10
workflow GitHub

atelier: Software Factory Where Agents Propose and Deterministic Code Disposes

A Python ADW engine runs coding agents through bounded phases while a Next.js cockpit observes and controls them, with the split being that agents propose and deterministic code decides. Both halves meet at a single SQLite trace treated as the source of truth. A clean architecture for keeping agent autonomy bounded.

software-factoryorchestrationsqlitecockpit
by duanecilliers Aug 11, 2026 7/10
workflow GitHub

j-estimate: Evidence-Based Jira Estimation and Update Workflow

A workflow for Codex and Claude Code that produces Jira estimates grounded in repository evidence rather than guesswork, then updates the tickets. Ties the estimate to what the code actually implies. Narrow but concrete.

jiraestimationworkflowplanning
by salehhashemi1992 Aug 11, 2026 5/10
workflow GitHub

Token-Efficient-Spec-Kit: Product Idea to Verified Project in Phased Steps

An engineering workflow that takes a product idea through framing, phased implementation, and explicit next steps, with token efficiency as a stated design constraint. Positions itself against heavier spec-driven kits that burn context. Ends at a verified project rather than a spec document.

spec-drivenworkflowtokensplanning
by Elguajo Aug 11, 2026 6/10
workflow GitHub

test-casebook-back-php: Persona-Matrix Playbook for Exhaustive PHP Backend Tests

An agent playbook for generating thorough backend test suites driven by a persona matrix, covering Laravel, Symfony, Slim, Mezzio, and CodeIgniter 4. The persona matrix forces coverage of role and permission combinations that ad-hoc test generation misses. Framework-agnostic within PHP.

testingphplaravelsymfonyplaybook
by techmefr Aug 11, 2026 6/10
workflow Reddit

Running Opus as Lead With DeepSeek Subagents in One Claude Code Session

Demonstrates keeping Opus as the orchestrator while routing subagents to non-Anthropic models by pointing Claude Code at a local endpoint that remaps model names to different providers. Claude Code still spawns and manages the subagents; only name resolution changes. The author is candid that the run cost about $5 and produced little useful work — the point was proving the routing works.

multi-modelsubagentsroutingcostdeepseek
by GMeTroFuN Aug 11, 2026 6/10
workflow Reddit

Running a Social-Media Function on Claude Code, Not Just Code

Describes a Social Media Manager agent that discovers conversations, drafts in the author's voice, stops for approval, publishes, measures results, and returns a decision packet. Each scheduled run starts a fresh session; the function persists because instructions, state, and evidence live in a repo with a canonical CONTEXT.md rather than in the chat. A good template for running any business function on scheduled agent sessions.

automationworkflowcontentschedulingcontext
by NoFunnyMan Aug 11, 2026 6/10
workflow GitHub

flightdeck-plugin: Governed Multi-Agent Engineering on One Hash-Chained Board

A Claude Code plugin where every agent works from a single board and every action lands in one hash-chained record. The chained log makes the run history tamper-evident and auditable. Engine ships separately on PyPI as flightdeck-connect.

governancemulti-agentauditplugin
by NorthGate-Strategic-LLC Aug 11, 2026 6/10
workflow GitHub

omniconductor: One Workflow Core Installed Into Six Coding Agents

Defines your AI-coding discipline once in a tool-agnostic core, then installs it into Claude Code, Cursor, GitHub Copilot, Gemini CLI, Codex, and Windsurf. Avoids maintaining six divergent copies of the same process. Apache 2.0.

workflowportabilitymulti-agentconfig
by lee77840 Aug 11, 2026 6/10
workflow GitHub

claude-craft: Installable Rules, Agents, and Commands Across Tech Stacks

A framework for installing standardized rules, agents, and commands into projects across multiple technology stacks. Gives new projects a consistent Claude Code baseline instead of copying config by hand. Broad in scope.

frameworkrulesagentscommandsconfig
by TheBeardedBearSAS Aug 11, 2026 6/10
workflow GitHub

claude_agents_gamekit: Multi-Agent Game Dev Workflows for Unity, Godot, and Cocos

A kit of Claude Code multi-agent workflows aimed at game development across Unity, Godot, web, WeChat Mini Games, and Cocos Creator. Each engine gets agent roles and task pipelines rather than one generic prompt. Useful if your project spans more than one engine or you want a starting structure for game-dev agents.

game-devunitygodotmulti-agent
by maybugwaterbutt646 Aug 11, 2026 6/10
workflow GitHub

hearting: One Portable Agent Contract Projected Onto Claude Code, Codex, and OpenCode

Defines a single agent configuration contract and projects it onto three harnesses, with routed capabilities, sealed cross-harness dispatch, per-node model tiers, and a live fleet view. The goal is to stop maintaining parallel setups for each tool. Formerly published as agent_setting.

multi-harnesscodexopencodeorchestration
by dmlguq456 Aug 11, 2026 6/10
workflow GitHub

agents_pipeline: Codex-First Multi-Agent Toolkit That Exports to Claude Code

A multi-agent workflow toolkit with global skills, workspace-local model profiles, and a runtime-neutral core, built Codex-first but able to export configuration for Claude Code and Copilot. The neutral core is the point — author once, project onto each runtime. Handy for teams split across different coding agents.

multi-agentcodexpipelineportability
by bohewu Aug 11, 2026 6/10
workflow GitHub

IMPLEMENTAUDIT.md: Nested Engineering Loops That Re-Verify Until Closure

A prompt-level system of nested loops covering planning and executing repo work, safely implementing audit findings, greenfield design, brownfield improvement, and learning from failures. Each loop re-verifies its own output until the issue is genuinely closed. It ships as a single markdown contract, so adoption cost is low.

auditself-correctingplanningmarkdown
by theislampill Aug 11, 2026 5/10
workflow GitHub

workManagementClaudePlugin: Request-to-Done Delivery Model as a Plugin

A Claude Code plugin marketplace packaging a project-agnostic work-management model: Request to Work item to Active release to Done. It gives AI-supported development a consistent delivery structure instead of ad-hoc task tracking. Installs via /plugin marketplace add and auto-updates as the version bumps.

pluginmarketplacework-managementdeliveryproject-management
by martynjsimpson Aug 10, 2026 6/10
workflow GitHub

exosuit: Drop-In Engineering Org — 43 Skills, 8 Agents, 13 Hooks

A large opinionated Claude Code bundle that models a whole engineering organization rather than a single helper. It layers deep idea interrogation up front, TDD sprints during implementation, and hook-enforced quality gates before work is accepted. Ships 43 skills, 8 agents, and 13 hooks as one installable unit.

plugintddquality-gatesagentshooks
by joris887 Aug 10, 2026 7/10
workflow Reddit

86 Agent PRs Touched CLAUDE.md — Humans Reviewed the File Exactly Once

A scan of 2,204 merged agent-authored PRs on public GitHub found 86 that modified an instruction file (CLAUDE.md, AGENTS.md, .mcp.json, .cursor/, copilot-instructions.md). Of the 68 that modified an existing file, zero drew a human comment on the file itself, even in repos where the surrounding PR was reviewed. The file steering your agents effectively gets reviewed once, on the day it is created.

claude-mdcode-reviewresearchagents-mdgovernance
by Due_Emu_8229 Aug 10, 2026 7/10
workflow GitHub

system-architecture-capture: Reverse-Engineer Monorepos Into OKF Schemas

Builds a persistent architecture knowledge base by reverse-engineering monorepos and multi-repo setups into standard OKF schemas (PKC and SAC). Ships as plugins for Claude Code, Grok, Codex, and OpenCode, so the captured architecture is reusable across tools. Useful for onboarding agents onto large existing systems.

architectureknowledge-basemonorepoplugindocumentation
by SpillwaveSolutions Aug 10, 2026 6/10
workflow Reddit

Cutting Claude Code usage in half: what the CULP author does by hand

The author of a usage-limits SaaS walks through the techniques their tool automates, explicitly so readers can do it without buying anything. Covers where token burn actually comes from in a normal session and which habits move the number most. Self-promotional framing, but the underlying advice stands on its own.

usage-limitstokensoptimization
by echasse Aug 10, 2026 5/10
workflow GitHub

apex-unified: zero-dependency prompt orchestrator with 5 modes and 39 skills

A prompt orchestration layer spanning 5 modes, 7 phases, 39 skills, and 18 agents, packaged as a plugin for Claude Code, OpenCode, Codex, Cursor, and several others. Zero dependencies, so it installs as prompt assets rather than a runtime.

orchestrationpluginskillsagents
by lhbsaa Aug 10, 2026 6/10
workflow GitHub

claude-code-loops: agent loops that stop on a machine-evaluated condition

Companion code to a book on building Claude Code loops whose exit condition is evaluated by a computer, not asserted by the agent. It refuses to advance on the model's own say-so and prints what each iteration cost. The 'agent said it was done' failure mode is exactly what this targets.

loopsverificationcosteducation
by regardo911 Aug 10, 2026 7/10
workflow GitHub

ephemeris: regression test harness for your agent harness

Checks agent execution traces against a machine-checkable model of the procedure your team intended, then measures whether a change to your harness actually improved anything. Aimed at teams who keep tweaking prompts and hooks without knowing if it helped.

testingtracesharnessevals
by alpha0301 Aug 10, 2026 7/10
workflow GitHub

relayforge: contained agent team orchestrator with worktrees and sandboxing

Orchestrates a plan, implement, review, verify agent team with each agent in its own git worktree, contained by Bubblewrap and cgroups, driven from a local control plane. The containment layer is more serious than most orchestrators bother with.

orchestrationsandboxworktreessafety
by arbazkhan971 Aug 10, 2026 7/10
workflow GitHub

artibot: agent OS for Claude Code with 28 agents, 114 skills, and 72 commands

A large opinionated framework built around dual-process cognition, lifelong learning, parallel agent teams, and a planning pipeline that produces PRDs, ADRs, and TODOs. Cross-platform install. Substantial surface area, so expect to adopt the whole model rather than pieces.

agentsskillscommandsframework
by Yoodaddy0311 Aug 10, 2026 5/10
workflow GitHub

inside-coding-agents: a handbook and lab for coding agent architecture

A visual, evidence-backed handbook plus a hands-on lab covering coding agent architecture: harness design, tool definitions, context management, sandboxing, and reproducible traces. Documentation rather than tooling, but it is the kind of grounding most agent projects lack.

architectureharnesseducationtraces
by vpromise Aug 10, 2026 7/10
workflow GitHub

ai-craftsman-superpowers: a rules engine enforced in hooks and CI

A Claude Code plugin with five language packs (Symfony, React, Python, Bash, AI/ML) and a three-level rules engine enforced both in hooks and in CI, so standards apply at write time and at merge time. Adds a correction-learning loop and 12 specialized agents.

pluginruleshooksciagents
by BULDEE Aug 10, 2026 6/10
workflow GitHub

cafleet: multi-agent orchestrator across coding agent providers

Coordinates a fleet of coding agents from different providers on the same work, rather than assuming every agent is the same CLI. Useful if you deliberately mix models for cost or capability reasons.

orchestrationmulti-agentcross-provider
by himkt Aug 10, 2026 6/10
workflow Reddit

AMH: a boring maintenance harness for when vibe-coded projects get real

An operating harness for the transition from weekend vibe-coding to software you maintain. Targets three specific failures: every session starting with amnesia, old bugs reappearing, and changes marked verified that were never actually tested. Deliberately unexciting, which is the point.

governancemaintenanceverificationharness
by v_uurtjevragen Aug 10, 2026 7/10
workflow Reddit

The review loop one team landed on after agents started merging too fast

A post-mortem on four production regressions in six weeks after going all-in on agents. The author's conclusion is that generation quality was never the problem: agent changes did exactly what the ticket asked while quietly altering adjacent behavior no test covered, because the suite was written when a human knew what they had touched. Describes the review loop they built to close that gap.

reviewregressionsprocesstesting
by Potential_Orchid_590 Aug 10, 2026 7/10
workflow Reddit

Stop patching model behavior — switch models or tools instead

Argues that fighting a model's default behavior with system prompt patches is a losing strategy, and that picking a different model or tool that already behaves the way you want is more durable. Aimed at the endless stream of 'fix the model' advice that circulates after each release.

modelspromptingopinion
by rafal-kochanowski Aug 10, 2026 5/10
workflow GitHub

sdd: spec-driven development for Claude Code, sized to the task

Spec-driven development that scales the ceremony to the size of the work via a tier table, with execution rules, artifact skeletons, and skills for building and maintaining a project's architectural canon. The tiering matters: most SDD frameworks impose the same weight on a typo fix and a rewrite.

spec-drivenplanningarchitectureskills
by kremniov Aug 10, 2026 7/10
workflow Reddit

Cutting a fresh Claude Code session from 35K to 13K startup tokens

A walkthrough of auditing what loads into a new session before you type anything, using /context all, and cutting the parts you never actually use. The author's setup went from roughly 35K to 13K startup tokens in one pass. Approximate numbers from a personal setup, but the method transfers.

contexttokensoptimizationclaude-md
by LorenzoSith Aug 10, 2026 7/10
workflow GitHub

specclaw: spec-driven development framework for Claude Code

A spec-driven development framework for Claude Code, structuring work from specification through implementation. One of several SDD approaches circulating; worth comparing against the alternatives before committing.

spec-drivenframeworkplanning
by chan4lk Aug 10, 2026 5/10
workflow GitHub

agent-protocol: an edit-approval protocol and error post-mortem log

A written protocol for approving agent edits plus a running log of error post-mortems, distilled from developing a commercial project with a coding agent. Russian-language, and process rather than tooling.

processgovernancerussianpostmortem
by mrdronru Aug 10, 2026 5/10
workflow GitHub

foreman-router: route work so expensive models stop searching your repo

Routes work across persistent Claude sessions and models so your expensive model spends its context reasoning rather than burning it on repository search. The economic framing is right: search is the cheapest thing to delegate downward.

routingmodelscostsessions
by singoesdeep Aug 10, 2026 7/10
workflow Reddit

132 days of a self-rewriting agent, curated into a book from its own journals

A 200-line program was given its own source code, a goal, and a rule: wake every 8 hours, improve something, keep the change only if the tests prove it safe. 132 days and about 600 sessions later it is 115,000 mostly self-written lines, and it journaled a letter to its next version every night. The book is those letters, curated with Claude Code.

self-improvementagentsjournalexperiment
by liyuanhao Aug 10, 2026 6/10
workflow GitHub

keel: a five-stage SDLC for Claude Code with a named subagent per role

Splits the development lifecycle into five stages, one skill per stage, with a named subagent for every role and hard gates between stages where correctness matters more than speed. The explicit gates are the differentiator from looser workflow packs.

sdlcsubagentsgatesworkflow
by AWenSu Aug 10, 2026 7/10
workflow GitHub

QA_FlowKit: portable starter kit taking AI-assisted QA from PRD to Gherkin

Copy a .qa-ai/ directory into any QA or automation repo and it bootstraps agent commands that carry work from PRD and requirements through Gherkin tests, TestRail planning, traceability, automation feasibility, and PR-ready artifacts. Tool-agnostic across Claude Code, OpenCode, and Codex.

qatestinggherkintestrail
by warante Aug 10, 2026 6/10
workflow Reddit

Benchmarking Local Models on an M4 Pro Mac Mini Alongside Claude Code

A developer measured whether a 24 GB M4 Pro Mac mini can serve local models next to a Claude Code workflow, reporting ~64 tok/s for GPT-OSS 20B in MLX FP4 even with 16 OrbStack containers running, and MLX roughly 19% faster than GGUF. The takeaway is that local inference is a complement to Claude Code rather than a replacement: use it for private codebase triage, boilerplate, and offline prompt experiments, then escalate to the frontier model. Useful reference numbers for anyone considering a hybrid local/cloud setup.

local-modelsmlxbenchmarkmachybrid-workflow
by silent_lurker_69 Aug 10, 2026 6/10
workflow GitHub

onus.ai: Scout-Test-Write-Judge Research OS for Claude Code

onus.ai structures research work in Claude Code as a four-stage pipeline (scout, test, write, judge) with iron rules enforced through hooks. It uses a guarded task graph with a progress-aware stopping rule so runs terminate instead of looping, and a four-reviewer gauntlet before output is accepted. Aimed at long research tasks where unbounded agent loops are the failure mode.

researchhookspipelinerevieworchestration
by lodetomasi Aug 10, 2026 7/10
workflow Reddit

RoboCo: Self-Hosted AI Software Company with PM, Dev, QA and Reviewer Agents

A walkthrough of RoboCo, an open-source self-hosted multi-agent setup that mirrors a software company org chart. Work flows through a task hierarchy (root task, cell task, subtask) with dedicated PM, developer, QA, documenter, and PR reviewer roles, and failed reviews cycle back to the original dev for revision. Interesting as a concrete example of role-based agent delegation with explicit escalation paths.

multi-agentorchestrationself-hostedcode-reviewdelegation
by PA100T0 Aug 10, 2026 6/10
workflow GitHub

claude-config: 134-Agent Multi-Agent OS with Cost-Aware Routing

A large Claude Code configuration packaged as a multi-agent operating system: 134 agents across 15 categories, 14 plugins, and local-first routing. Orchestration is cost-aware, sending work to cheaper models or local execution where it makes sense. Best treated as a reference implementation to borrow from rather than adopt wholesale.

multi-agentconfigroutingpluginscost
by SkyWalker2506 Aug 10, 2026 6/10
workflow GitHub

techscan: Weekly Auto-Curated AI Agent Trend Report via Claude Code Cron

A Claude Code cron routine that assembles a weekly curated report on AI agent developments. It is a working example of scheduling an agent to do recurring research and publish the output unattended. Documentation is in Korean.

cronautomationcurationreportsresearch
by kor-soboro Aug 10, 2026 5/10
workflow GitHub

cognitive-powers: 19 Workflows Where a Separate Verifier Closes the Claim

A Claude Code and Codex plugin with nineteen workflows that match process to task type, keep evidence files outside your repo, and refuse to mark a claim done until an independent verifier confirms it. Pure Python standard library with no runtime dependencies. The separate-verifier design targets the common failure of agents declaring success prematurely.

workflowsverificationpluginevidence
by Drizzy07x Aug 9, 2026 7/10
workflow GitHub

higgs-workbench: Gated AI Video Production Workflow on Higgsfield MCP

A Portuguese-language AI video production workbench for Claude Code, built over the Higgsfield MCP server. The workflow uses explicit gates, a 'cold eyes' validator, and measured QC rather than accepting the first generated output.

videomcpworkflowqc
by DCCA Aug 9, 2026 5/10
workflow GitHub

train-conductor: A Merge Train for Parallel Claude Code Agents on One Repo

A method for running several Claude Code agents on one repository without collisions: git worktree isolation per agent, a gate every stream must pass alone, and an evidence protocol that makes each agent's claims checkable. The merge-train framing keeps integration serialized while the work itself stays parallel.

parallel-agentsworktreesmerge-trainverification
by phaddad90 Aug 9, 2026 8/10
workflow Reddit

Mission Control: An 11-Step Autonomous Company Loop on Headless Claude Code

A detailed writeup of an autonomous company built on Claude Code and the Claude API: eight agent roles (CEO, researcher, brainstormer, builder, QA, sales, marketing, finance) running an eleven-step loop on a FastAPI backend, with a Next.js dashboard streaming each step over websockets. The build step spawns headless Claude Code against a generated GOAL.md spec. Most of the setup is described as reproducible.

multi-agentheadlessautomationorchestration
by SIGH_I_CALL Aug 9, 2026 6/10
workflow GitHub

claude-org-ja: Japanese-First Multi-Agent Operations Framework for Claude Code

A Japanese-language multi-agent framework for Claude Code with four explicit roles — secretary, dispatcher, curator, and worker — each with clear responsibility boundaries. The role separation is the point: it stops one agent from silently taking on everything.

multi-agentjapaneseframeworkroles
by suisya-systems Aug 9, 2026 5/10
workflow GitHub

autorun: Keep Claude Code and Codex Running Until the Task Is Actually Done

A plugin for Claude Code and Codex plus a Gemini CLI extension that keeps agents running to completion, protects data along the way, and pushes for better planning up front. Aimed at the stop-halfway failure mode on long tasks.

automationlong-runningpluginplanning
by ahundt Aug 9, 2026 6/10
workflow GitHub

document-project-template: Issue-Driven Document Writing With Claude Code

A Japanese-language template for writing structured documents — grant applications, papers, reports — with Claude Code under an issue-driven process. Format, evaluation criteria, and a minimal-cognitive-load serialization are settled before writing starts.

documentsjapanesetemplateissue-driven
by AtsushiHashimoto Aug 9, 2026 5/10
workflow GitHub

task-pipeline: Ten Gated Delivery Stages With an Intake Grill and Loop Guard

A full-cycle delivery orchestrator for AI coding agents: a mandatory intake interrogation that front-loads decisions, then ten gated stages from docs and brainstorm through deploy and acceptance. A loop guard breaks the churn pattern where an agent cycles on the same problem without progress.

orchestrationgatespipelinedelivery
by ssheleg Aug 9, 2026 7/10
workflow GitHub

agentic-pmo: 11 Specialists and 16 Workflows From One Project Charter

A complete agentic product and project management office for Claude Code: fill in one charter, run /setup-pmo, and you get eleven specialist agents, sixteen workflows, and a methods library. Aimed at people running projects rather than single tasks.

pmoproject-managementagentsworkflows
by link7373 Aug 9, 2026 6/10
workflow GitHub

superstack: A Specialist Team and Durable Record for Long-Horizon Builds

An agentic engineering framework aimed at work that spans many sessions: idea shaper, planner, debugger, reviewer, incident responder, data migrator, and release manager all share one durable project record. The record is what lets builds survive compaction and crashes and resume mid-task.

long-horizonmulti-agentstateframework
by debabsah Aug 9, 2026 7/10
workflow GitHub

quiet-cve: CVE Triage That Only Flags Vulnerable Code You Actually Call

A Japanese-language CVE triage workflow where Claude Code reads your code and narrows alerts to the vulnerable functions you genuinely use. Directly targets alert fatigue from scanners that flag every transitive dependency regardless of reachability.

securitycvetriagejapanese
by high-tech-r Aug 9, 2026 6/10
workflow GitHub

cannery-row: Task State as Files in Your Repo, Where Location Is Status

A Claude Code plugin that stores task state as files in your repository, using directory location to encode status. Because the state lives in the repo rather than the session, an agent's work survives the session that produced it.

task-statepluginpersistencegit
by justmaniv Aug 9, 2026 6/10
workflow GitHub

groundwork-template: A Project Operating System You Copy, Not a Starter App

A copyable project operating system rather than a code scaffold: a work model, living documentation, and a /system dashboard derived from those docs. The distinction matters — it structures how work is tracked instead of what the app is built from.

templatedocumentationworkflowdashboard
by ShawnTalvacchia Aug 9, 2026 5/10
workflow Reddit

10-Hour Test: Delegating the Build Step to a Cheaper Model Cost More

A ten-hour experiment pitting harness configurations against each other on a vanilla-JS-to-React migration, testing whether a cheaper model as the builder in a multi-agent workflow saves tokens. It did not: orchestration overhead plus fixing the cheaper model's bugs exceeded the savings. A useful counterweight to model-routing enthusiasm.

benchmarkmodel-routingtokensexperiment
by turtleninja99 Aug 9, 2026 6/10
workflow GitHub

claude-engineering-team: Opus 5 Architects, Sonnet 5 Implements

A Claude Code subagent team splitting work by model tier: architecture and review on Opus 5, implementation and tests on Sonnet 5. Deliberately simple and long-lived, with no over-design — a concrete answer to which model should do what.

subagentsmodel-selectionarchitectureteam
by tonyzhoup Aug 9, 2026 6/10
workflow GitHub

dotfiles-public: Spec-Driven Bootstrap, Guarantee-Driven Maintenance on Nix

A two-phase development lifecycle for AI-agent collaboration implemented on Nix: spec-driven during bootstrap, then guarantee-driven during maintenance. The phase split acknowledges that early and late project work need different agent constraints.

nixdotfileslifecyclespec-driven
by yktsnet Aug 9, 2026 5/10
workflow Reddit

Git Worktrees Isolate Branches, Not Every Node Dependency Lookup

A sharp technical writeup: Claude Code places worktrees under .claude/worktrees/ inside the project root, and Node's resolution algorithm walks parent directories, so a worktree with an incomplete node_modules can silently resolve packages from the main checkout. Tests pass while the worktree's own dependency state is broken. Includes two practical checks to catch it.

worktreesnodeisolationgotcha
by Particular_Luck80 Aug 9, 2026 7/10
workflow GitHub

openloop: Deterministic Phases, Worktrees, and Budgets With No Second Bill

A host-native control plane for AI coding agents with deterministic phases, worktree isolation, verification gates, and budgets. Runs on your existing subscription rather than adding a second API bill, which is the differentiator against hosted orchestrators.

control-planeworktreesgatesbudgets
by Akshu1245 Aug 9, 2026 6/10
workflow GitHub

claude-code-pm: Parallel Workers and PR Orchestration for Linear Tasks

Automates Claude Code project management against Linear: parallel workers pick up tasks, results are verified, and PR workflow is orchestrated end to end. Useful if Linear is already your source of truth for work.

linearproject-managementparallelpull-requests
by falungongcleanness498 Aug 9, 2026 6/10
workflow GitHub

Codex-Workspace: Many Repos, Shared Caches, Filesystem-Based Context

A local-first workspace structure for organizing many standalone repositories on one machine, with shared caches and context derived from the filesystem layout. Aimed at people whose agent work spans a dozen repos rather than one monolith.

workspacereposcachingcontext
by ApolloMakesContent Aug 9, 2026 5/10
workflow GitHub

y2k-labs: Azure DevOps Backlog, Sprint Planning, and Health Checks by Agent

Automates Azure DevOps workflows with AI agents: backlog creation, sprint planning, project health checks, and work item templates. Fills a gap given how much agent tooling assumes GitHub or Linear.

azure-devopssprint-planningbacklogautomation
by carobbarlightshow628 Aug 9, 2026 5/10
workflow GitHub

claude-code-practices: An Interactive Claude Code Setup Installer (Russian)

A Russian-language interactive installer covering a full Claude Code setup: cross-session context, hook-enforced rules, prompt injection guards for external content, documentation freshness, and parallel subprojects with shared memory. Written in plain language with recipes and an adaptive checklist for any field.

setuphooksrussianprompt-injection
by kydechuk01 Aug 9, 2026 5/10
workflow Reddit

Split Generation and Review Into Two Blind Passes to Catch Silent Bugs

A writeup and tool splitting generation from review: one pass produces the change, a second independent pass sees only the result — not the first pass's reasoning — and is told to find problems. Caught a silent semantic shift (inclusive bounds becoming exclusive) that self-review missed. The author is candid that both passes run on the same vendor, which weakens but does not negate the effect.

code-reviewtwo-passblind-reviewbugs
by GiiTZzz Aug 9, 2026 6/10
workflow Reddit

CLAUDE.md, SPEC.md, decisions/: A Doc Structure That Survives Agent Work

A UX designer's documentation structure arrived at after CLAUDE.md bloated into an unusable document: CLAUDE.md holds pure orientation (workflow rules, stack, file map), SPEC.md holds current documented behavior as fact with no backstory, and a decisions/ directory holds the why — evidence, rejected alternatives, dated reasoning. Splitting the why out is what keeps SPEC.md readable.

claude-mddocumentationspecdecisions
by scottjenson Aug 9, 2026 7/10
workflow GitHub

claude-atelier: Plugin Marketplace With a Design-Build-Review Pipeline

A Claude Code plugin marketplace hosting two plugins: atelier, which chains design into build into review and adds writing-craft skills, and atelier-typescript, a set of Fastify-focused skills. Install once and get the whole pipeline rather than assembling stages yourself.

pluginmarketplacefastifytypescript
by muzalee Aug 8, 2026 6/10
workflow GitHub

agent-os-langgraph: LangGraph Orchestrator With HITL and SQLite Resume

A coding-agent orchestrator built on LangGraph with human-in-the-loop checkpoints, SQLite-backed resume after interruption, three-tier model routing and MCP support. Runs against Claude and Codex subscription backends instead of metered API keys.

langgraphorchestrationhitlmcp
by simon-aibc Aug 8, 2026 6/10
workflow GitHub

agentsync: Multi-Agent Collaboration Hub With File-Scope Claims

A hub where many humans and AI agents work one repo from a shared plan. Agents claim file scopes, chat in a shared channel, and get MCP-native conflict warnings before two fast agents write the same file - aiming at zero merge conflicts.

multi-agentcollaborationmcpconflicts
by dipakkr Aug 8, 2026 7/10
workflow GitHub

Keel: Rigor Router Picking Fast or Heavy Lanes by Danger Scan

Routes each task to one of two lanes: FAST for low-risk one-shots, HEAVY with full review gates for correctness-critical work. The choice comes from a nine danger-surface scan rather than the developer's mood, so review effort scales with actual risk.

routingcode-reviewriskgates
by sayeediftekhar Aug 8, 2026 6/10
workflow GitHub

practice-loops: Governed Nursing Practice Loops as a Claude Code Plugin

Six NMC-anchored practice loops for nursing, each with built-in verification, escalation paths, human sign-off and an audit trail. A worked example of shipping agent workflows into a regulated profession where 'the model said so' is not an acceptable answer.

healthcaregovernancepluginaudit
by Clinical-Quality-Artifical-Intelligence Aug 8, 2026 5/10
workflow GitHub

shipyard: Worktree-Per-Ticket Delivery Conveyor With Mechanical Gates

A delivery conveyor for Claude Code and the Codex CLI that runs investigate, decompose and deliver as distinct stages, one git worktree per ticket, with mechanical gates and PRs driven to green. Ships with the reproducible container it runs in.

worktreecipipelinecontainer
by serhii-nochevnyi Aug 8, 2026 7/10
workflow GitHub

squad: Tmux Multi-Agent Orchestration With a YAML Task Dispatcher

A Dispatcher reads YAML task definitions and assigns them to parallel Workers running Claude Code or the Codex CLI in tmux panes, reporting progress through dashboards. Plain-text, inspectable orchestration with no extra daemon.

tmuxmulti-agentorchestrationyaml
by h-wata Aug 8, 2026 6/10
workflow GitHub

dev-orchestrate-kit: Supervisor Harness Plans, opencode Implements

A Korean-language kit that folds several AI subscriptions into one development pipeline: Claude or Codex act as the supervising harness for planning and review, implementation is delegated to opencode, with fallback across subscriptions as quotas run out.

orchestrationopencodequotakorean
by fartypie-d Aug 8, 2026 5/10
workflow Reddit

The Claude Code + Codex Audit Loop That Never Converges

A solo founder has Claude Code write specs and build features, then Codex audit both and return GREEN, YELLOW or RED. One hard feature burned five spec versions and four RED audits in a single day - and the findings were mostly real, which is what makes it hard to stop. A useful cautionary case on where second-model auditing stops paying for itself.

code-reviewcodexworkflowdiscussion
by ximon16182 Aug 8, 2026 5/10
workflow GitHub

peertable: Long-Lived Peer Agents With No Orchestrator at the Head

Turns Claude Code sessions into a team of equal, long-lived peers sitting at a round table - no supervising orchestrator dictating work. A structural alternative to the usual dispatcher-and-workers pattern.

multi-agentpeersessionscollaboration
by kitepon-rgb Aug 8, 2026 6/10
workflow GitHub

speck: Specification Workflow for AI-Assisted Programming

A specification-first workflow aimed at the communication gap between humans and LLMs: write the spec the agent works from, so intent is explicit before any code gets generated.

spec-drivenplanningworkflow
by DylanMoss1 Aug 8, 2026 6/10
workflow GitHub

on-the-record: Requirements as Issues, Decisions as Approvals, Work as PRs

Puts the whole development record in GitHub: a requirement is an issue, a decision is an approval comment, work is a PR and rationale lives in that PR. An orchestrator relays the conversation to GitHub and spawns sandboxed role sessions, each given only its own rulebook.

githubgovernancemulti-agentaudit
by tokenmaxxxer Aug 8, 2026 7/10
workflow GitHub

jeff: A Quality Gate That Holds Work Until It Passes Review

Frames the coding-agent shell as a Michelin-star kitchen where you are the boss: nothing leaves the pass until Jeff signs off. In practice a review gate sitting between agent output and anything downstream.

quality-gatereviewworkflow
by johanthoren Aug 8, 2026 5/10
workflow Reddit

Greenfield Agent Loop Judged Only by Suites It Cannot Edit

To stop an autonomous loop from grading its own homework, the author pre-registered three builds from empty folders: the first commit in each repo fixed the goal, the operating envelope and a verify command naming an external judge the loop cannot edit, so the git log proves the gate predates the work. One target was a TOML v1.0 decoder in Rust judged by toml-test v2.2.0; for another the spec was mutated so memorized answers would fail.

autonomoustestingbenchmarkloop
by Dull_String9524 Aug 8, 2026 7/10
workflow GitHub

specwright: One Change-Driven Workflow Across Claude Code and Codex

A multi-host plugin that gives a repository a single explicit engineering workflow driven by the change being made, and keeps that workflow identical whether the session is Claude Code, Codex or OpenCode.

pluginworkflowcodexopencode
by ribeirogab Aug 8, 2026 6/10
workflow GitHub

planlet: Repo-Local Markdown Planning With a Deterministic CLI

Keeps planning and task state in the repository as focused markdown 'planlets', driven by a deterministic CLI plus portable agent skills. Plans stay reviewable in git instead of living only in session context.

planningtasksclimarkdown
by vipentti Aug 8, 2026 6/10
workflow Reddit

Benchmark: 5 Token-Saving Tools Fall Short of Their 60-90% Claims

A preregistered benchmark ran repowise, CodeGraph, Serena, Graphify and a no-tools baseline over 48 Django questions from SWE-bench, same agent/prompt/commit, 261 runs total. Best result was ~32% fewer output tokens per question, far below the 60-90% savings these tools advertise, and index build times varied from 16s to 367s. Harness, raw data and invalidated runs are public; the author discloses working on one of the tools benchmarked.

benchmarktoken-savingscontext-managementserenaswe-benchcodex
by Obvious_Gap_5768 Aug 8, 2026 8/10
workflow GitHub

claude-ns-hub: Local Session Orchestrator with a Queue and Notifications

A local orchestrator for Claude Code that lets you drop a task into a queue and walk away. It dispatches work across multiple concurrent sessions and pushes notifications when runs finish, so long jobs do not need babysitting. Python-based and self-hosted, aimed at fire-and-forget agent workflows.

orchestrationtask-queuemulti-sessionnotificationsautomation
by pluto2060 Aug 8, 2026 6/10
workflow Reddit

A Manager-and-Roster Pattern: Match the Model to the Job, Then Dispatch

One user's orchestration setup where the main loop only plans, decomposes, dispatches, and reviews, while a roster of subagents does the work — a reasoning model for adversarial review and root-cause, a strong coder for open-ended specs, a cheaper model when the spec cites an existing pattern, and a small model for mechanical sweeps. Includes a concrete inline-vs-dispatch gate and the rule that plans state contracts and verification steps rather than finished code. Each phase runs in a clean session.

orchestrationsubagentsmulti-agentmodel-selectionplanningcontext-engineering
by mugsy33 Aug 8, 2026 8/10
workflow GitHub

samd-starter-kit: Build Medical-Device Software with a 10-Agent Claude Code Team

A starter kit for Software as a Medical Device projects, scaffolding IEC 62304 and ISO 14971 compliance from day one. It ships ten specialized agents, multi-agent workflows, and generates a complete regulatory Design History File. A rare example of agent tooling aimed at a heavily regulated engineering domain.

medical-devicecomplianceiec-62304multi-agentstarter-kit
by bryan-basg Aug 8, 2026 7/10
workflow GitHub

devlyn-cli: Ideate, Auto-Resolve, and Ship with Context Engineering for Claude Code

A development toolkit that wraps Claude Code with context engineering and agent orchestration. It covers the arc from ideation through auto-resolving issues to shipping. Aimed at people who want an opinionated end-to-end flow rather than assembling their own.

cliorchestrationcontext-engineeringtoolkit
by fysoul17 Aug 8, 2026 6/10
workflow GitHub

business-brain: A File-Based Operating System for Running a Business on Claude Code

Context files, rules, skills, hooks, and memory conventions extracted from a working agency and packaged as a repo. It treats business operations, not just code, as the thing the agent maintains. The value is in seeing conventions that survived real day-to-day use rather than a theoretical setup.

businessoperationsmemoryhooksconventions
by BenPrem Aug 8, 2026 7/10
workflow GitHub

mestre-yoda: Spec-Driven Delivery Harness With Enforceable Gates

A deterministic, observable spec-driven development harness for AI coding agents. Work moves through enforceable gates that produce auditable evidence, and delivery stays under human control. Useful if you want repeatable agent workflows rather than ad-hoc prompting.

spec-drivenworkflowgatesaudit
by thiagocorreanet Aug 7, 2026 6/10
workflow GitHub

agentic-foundry: Frozen Acceptance Contracts and a Merge Floor

A Claude Code plugin for governed, spec-driven delivery. Acceptance contracts are frozen up front and a merge floor refuses to let a red seam through, so an agent cannot quietly redefine done partway into the work.

pluginspec-drivengovernancemerge-gate
by lukasrepublic Aug 7, 2026 6/10
workflow GitHub

loopx: Cross-Project Quality Gate Kit for Codex and Claude Code

A portable quality gate kit you can drop into multiple projects to hold Codex and Claude Code to the same standards. Useful when you maintain several repos and want one consistent bar.

quality-gatecodexcross-project
by rye567 Aug 7, 2026 5/10
workflow Reddit

Scanning 63 AI-Built Repos for Leaked Keys: 4 Hits, None in .env

An empirical check on the claim that vibe-coded apps leak secrets. Cloning 63 real AI-built web apps turned up 4 committed privileged credentials, roughly 6 percent, and none of them were sitting in .env, which is where most scanning advice points. A useful correction to both the panic and the standard mitigation.

securitysecretsauditresearch
by ItaySela Aug 7, 2026 7/10
workflow Reddit

claude-handoff: Re-Check Stale Handoff Claims Against Git Before Trusting

Handoff docs between long-running sessions go stale and a fresh session believes them anyway. This protocol adds one rule most versions skip: anything bold or load-bearing that is more than about a week old gets checked against git before it is trusted again.

handoffcontextverificationgit
by TVegas2020 Aug 7, 2026 7/10
workflow GitHub

troika: Ticket to Reviewed, QA-Verified PR Through Eight Agent Roles

A pipeline that takes a tracker ticket and runs it through eight distinct agent roles until it emerges as a reviewed, QA-verified pull request. Ships as a plugin for Claude Code, Codex, and Cursor.

pipelineprqamulti-agentplugin
by vsdudakov Aug 7, 2026 7/10
workflow Reddit

Hedgehog v4: BMAD Companion With Parallel Agent Fan-Out

A companion layer for BMAD aimed at cleaner builds, updated in v4 to let agents fan out and build in parallel where the code structure allows it. Relevant if you already run BMAD-style planning.

bmadparallelorchestrationworkflow
by kidwonder Aug 7, 2026 6/10
workflow Reddit

An Evolving TDD and Hooks Workflow for Not Reviewing Every Line

A developer with 35 years of reviewing code describes the workflow — TDD, instructions, hooks, and sweeps — that finally let them stop second-guessing whether the agent's output was sound. Written up around real open-source home security work rather than a toy project.

tddhooksreviewworkflowtrust
by Previous_Amoeba Aug 7, 2026 6/10
workflow GitHub

goat-flow: Harness Engineering, Execution Loop, Skills, Hooks, Learning

A structured workflow system for AI coding agents that combines harness engineering, an execution loop, skills, hooks, and a learning loop that feeds results back in. Works with Claude Code, Codex, Antigravity CLI, and Copilot.

workflowharnesshookslearning-loop
by blundergoat Aug 7, 2026 6/10
workflow GitHub

googlecloud-plugin: A Full GCP Delivery Team for Your Coding Agent

Adds a vendor-objective solution designer, GCP and agentic architects, security, SRE, and QA roles, wired into a design-first and security-first delivery gate. Installs on Claude Code, Antigravity, Codex, and Kimi.

gcppluginarchitecturesresecurity
by jpantsjoha Aug 7, 2026 6/10
workflow GitHub

crash-proof-coding-agents: Temporal Remembers, Claude Code Judges

A delivery team of coding agents where Temporal owns durability of the job, Claude Code makes the judgment calls, and team folders hold the governance. Every claim is measured, tested, and published rather than asserted.

temporaldurabilitymulti-agentgovernance
by thumarrushik Aug 7, 2026 6/10
workflow Reddit

Making a Project Portable So Any Fresh LLM Can Start From the Repo

A solo SaaS developer realized their project's context, decisions, and conventions all lived inside one Claude account, and restructured so any fresh agent can start from the repo alone. Two findings stand out, chiefly that stale docs are worse than no docs because a contradicting doc makes a fresh LLM confidently wrong.

portabilitydocumentationcontextvendor-lock-in
by barcelonatips Aug 7, 2026 6/10
workflow GitHub

glean: Have a Bigger Model Grade Your Smaller Model's Daily Runs

Runs a larger model over a smaller model's daily output to critique it and feed improvements back in. A cheap way to keep a low-cost agent honest without paying frontier prices for every turn.

evaluationmodel-routingfeedback-loopcost
by pcx-wave Aug 7, 2026 5/10
workflow GitHub

groundwork: A Skill Chain That Forces Agents Into Your Methodology

A development-methodology plugin for coding agents that covers the chain from design through completion as skills, and forces the agent into that chain at the start of every session. Documentation is in Korean.

methodologyskillspluginkorean
by HarryJhin Aug 7, 2026 6/10
workflow Reddit

Keep Your Agent on the VPN While Your App Stays Off It

A full-tunnel VPN that the coding agent needs breaks the app under development when domestic services reject the foreign exit IP. The fix is not a static route, since those are global and pull the agent off the tunnel too, but per-socket binding with curl --interface and the equivalent in your stack.

vpnnetworkingroutingdevelopment-environment
by farshadmomo Aug 7, 2026 6/10
workflow Reddit

I Benchmarked My Markdown-Mapping System Against `ls`. `ls` Won.

Three rounds of controlled agent walks over a markdown vault, hand-graded from raw traces across four conditions including mapped, blind, and filesystem-only. The honest result is that plain filesystem navigation beat the elaborate map-and-contract protocol, and self-reported agent success turned out not to count as evidence.

benchmarkmarkdownnavigationnegative-resultevidence
by allemaar Aug 7, 2026 7/10
workflow GitHub

handoff: The Old Session Grades the New One Before Handing Over

Verified knowledge transfer across /clear: the outgoing session writes control questions, the incoming session answers them after reading everything, and the outgoing session grades the answers until it can honestly print the green light. Turns handoff from an assertion into a test.

handoffcontextverificationclearquiz
by 1Popov Aug 7, 2026 7/10
workflow Reddit

Most Outputs Aren't Load Bearing: Cutting ~50% of Tokens Works Better

The argument is that models cannot know what they need until they look, and looking drags in a large amount of material that is never load-bearing for the answer. Pruning roughly half of what Claude Code sees reportedly makes it work better, not worse.

contexttokenspruningperformance
by Popular_Sand2773 Aug 7, 2026 7/10
workflow Reddit

Turning the Agent Loop Into a Back-and-Forth Alignment Loop First

Agents implement plans well but define them badly, so they rush to generic templates and start editing files before you have agreed on anything. This open-sourced tool forces a dynamic alignment exchange with you before implementation begins.

alignmentplanningrequirementsopen-source
by SnooComics4579 Aug 7, 2026 6/10
workflow Reddit

The Basic Anatomy of a Good Prompt

An educational write-up on prompt structure and setting up context inside the prompt itself, using a real failure — someone asking Claude to merge two large open-source monorepos — as the worked example. The argument is that structure matters less than actually thinking the task through and writing it down clearly.

promptingeducationcontextfundamentals
by ibn_larry Aug 7, 2026 6/10
workflow Reddit

Dumb Orchestrator Theory: The Orchestrating Model Drives Your Bill

Data from an AI delivery factory splitting load between Claude and GPT subscriptions points at orchestration being the single largest consumer of available usage, and at the orchestrating model's choice having outsized impact on outcomes. Downgrading the orchestrator from a frontier model changed the economics substantially.

orchestrationcostmodel-selectionusage
by berndalf Aug 7, 2026 6/10
workflow Reddit

Five Review Agents Said the Tests Passed. None of Them Had a Shell.

Five review agents were asked to break SQLite trigger logic and confirm tests went red. All five returned a confident reading, none errored, and not one said it could not run anything. Re-running with an agent that actually had Bash surfaced two integer overflow gaps and a whole direction the reading had never considered.

subagentstool-accessreviewverificationfailure-mode
by Bulky_Ad738 Aug 7, 2026 8/10
workflow GitHub

figma-full-cycle: Figma Frame In, Shipped SwiftUI Feature Out

An eight-stage orchestrator skill for Claude Code and Codex that takes a Figma parent frame and drives it through to a shipped SwiftUI + TCA feature. Each stage is a discrete step with its own checks rather than one giant prompt. Narrow but deep if you work in that stack.

figmaswiftuitcaorchestrationios
by gwair1989 Aug 7, 2026 7/10
workflow Reddit

Claude Code Running a Paid API Business on a Home k8s Cluster

A three-week experiment where Claude Code was given cluster admin and a standing goal to make money autonomously. It built graded.sh, an index of ~3,500 x402 pay-per-call APIs that it probes every six hours and grades A–F, plus a gateway, and it operates the deploy pipeline and its own Grafana dashboards. An unusually concrete look at long-horizon autonomous operation.

autonomous-agentskubernetesx402case-studydevops
by CommissionUpper4531 Aug 7, 2026 8/10
workflow GitHub

agent-harness-kit: Provider-Agnostic Multi-Agent Scaffolding

A scaffolding kit that drops structured multi-agent workflow definitions into an existing codebase without tying you to one provider. Gives you the harness — roles, handoffs, checks — rather than a fixed pipeline. Useful as a starting skeleton.

multi-agentscaffoldingharnessworkflow
by enmanuelmag Aug 7, 2026 6/10
workflow GitHub

mb-system-architecture: Contract-First Lifecycle for Coding Agents

Defines contracts up front so multiple coding agents can build in parallel without colliding, then holds the output to engineering release standards. Targets the gap between agent speed and shippable quality. Process-heavy by design.

multi-agentcontractsarchitecturelifecycle
by mehulbhagwani Aug 7, 2026 6/10
workflow GitHub

speckit-addons: Community Add-Ons for GitHub Spec Kit

Workflows, presets, extensions and bundles that extend GitHub Spec Kit beyond its defaults. Lets you adopt spec-driven development without writing the scaffolding yourself. Community-maintained.

spec-kitspec-drivenworkflowsextensions
by clintcparker Aug 7, 2026 6/10
workflow GitHub

agentic-workflow: A Twelve-Skill Plugin for Solo Maintainers

Covers the full lifecycle for one person directing agents: project bootstrap, product discovery, phase delivery, review orchestration, verification, and evolving the workflow itself. Opinionated about the human staying in the director's seat. Broad but coherent.

workflowsolo-devpluginlifecycle
by gidde032 Aug 7, 2026 7/10
workflow GitHub

flux: A Convention Layer for Quasi-Autonomous Claude Code

Builds a mostly-autonomous development workflow out of native Claude Code primitives — hooks, skills, GitHub Actions — rather than introducing a new engine. Explicitly a convention and configuration layer, so there's less to break when Claude Code changes. Attractive if you distrust heavyweight frameworks.

workflowhooksgithub-actionsautonomy
by sbnet Aug 7, 2026 7/10
workflow GitHub

operator-autopilot: A Daemon That Turns Repos Into Reviewable PRs

A local-first, git-native daemon that orchestrates external AI coding agent CLIs through discover, plan, implement, verify and deliver, ending at a pull request a human reviews. Keeps the agent loop running without keeping you in it. Everything stays on your machine.

daemonautomationpull-requestsorchestration
by ainova-systems Aug 7, 2026 7/10
workflow GitHub

claude-cracks-the-whip: Assign, Review and Rework Agent Output

Uses Claude Code as a supervisor that assigns tasks to other AI coding agents, reviews what comes back, and sends sloppy work around again. A manager-of-agents pattern rather than a single-agent loop. Light on detail but the shape is clear.

orchestrationreviewmulti-agent
by Pammyhangdog747 Aug 7, 2026 5/10
workflow Reddit

Plans Are Cheap; Bad Implementations Aren't

Argues that reviewing the plan is dramatically cheaper than reviewing the code, that the planner shouldn't review its own plan (same model, same blind spots), and that the reviewer shouldn't be allowed to rewrite it either. The proposed loop: the original agent investigates each finding and must defend or revise. A concise case for review-before-code.

planningcode-reviewmulti-agentdiscussion
by bdachev Aug 7, 2026 6/10
workflow GitHub

sagan: Multi-Agent Orchestration Where APPROVED Means Verified

A PM agent dispatches role-bound workers through a critique and verify loop, and every artifact ships with execution evidence bound to a git SHA. The design goal is that approval reflects a run that happened, not a plausible-looking answer. Installs as a drop-in .sagan/ overlay in any repo.

multi-agentorchestrationverificationevidence
by thewhatmatters Aug 7, 2026 7/10
workflow GitHub

taskPlane: AI Software-Delivery Control Plane for Claude and Codex

A control plane that sits in front of Claude Code and Codex, gating work behind dependency-aware readiness checks and scoped execution. Runs 25 engineering 'lenses' over the result and produces fingerprinted evidence for human approval. Aimed at teams who want agent output reviewable before it lands.

control-planeorchestrationcode-reviewgovernance
by vdemkiv Aug 6, 2026 6/10
workflow GitHub

leopold: Autonomous Orchestration Harness That Drives Claude Code for You

You brief leopold the way you would brief a teammate and it conducts Claude Code sessions in your seat. Git operations stay locked so the harness cannot commit or push on its own, keeping the blast radius bounded during unattended runs.

orchestrationautonomousharnesssafety
by Jonhvmp Aug 6, 2026 6/10
workflow GitHub

crewplane: Provider-Neutral Control Plane for Coding-Agent Workflows

Lets you design coding-agent workflows by hand, review them before they execute, observe them while running, and trace them afterward. Deliberately provider-neutral - it drives Claude Code, Codex, Gemini, Copilot, or any CLI agent.

control-planeorchestrationobservabilitymulti-agent
by crewplaneai Aug 6, 2026 6/10
workflow GitHub

dev-loop: Wiki-Grounded Verification and RFC-Based Docs for AI Engineering

An AI-native engineering setup combining LLM knowledge management, verification grounded in a project wiki, RFC-based documentation, and automated best-practice enforcement. Aimed at keeping agent output anchored to written decisions.

knowledge-managementrfcdocumentationverification
by choiyounggi Aug 6, 2026 5/10
workflow GitHub

facework: A 12-Primitive, 8-Phase Protocol for Turning Ideas Into Systems

An open protocol that decomposes 'idea to shippable system' into 12 primitives across 8 phases, designed to run on Claude Code. The pitch is coherence and ownership: the output is a system you understand rather than a pile of generated files.

protocolmethodologyplanningphases
by thefacelessdon Aug 6, 2026 5/10
workflow GitHub

Brewcode: Infinite Focus Tasks With Automatic Context Handoff

A full development platform for Claude Code: long tasks that survive context limits via automatic handoff, prompt optimization, skill and agent creation, quorum-based code reviews, project rule management, and knowledge persistence.

platformcontext-handoffcode-revieworchestration
by kochetkov-ma Aug 6, 2026 7/10
workflow GitHub

Guardian: Scan-Fix-Verify Loop With an Anti-Cheat Gate for Faked Tests

The /guardian command scans a repo for security, performance, and architecture issues, shows proof for each, then loops fix-verify-rescan until clean. Includes payment idempotency fuzzing and an anti-cheat gate that catches agents faking test passes. Works in Claude Code, Cursor, Codex, OpenCode, and Kilo Code.

securityqualityanti-cheatautonomous
by Krish-1507 Aug 6, 2026 7/10
workflow GitHub

product-pipeline: Run a Product Initiative as a Tracked Journey

Treats a product initiative as continuous tracked work rather than a series of one-shot prompts: persistent state across sessions, a living PRD, and hypotheses typed by the kind of evidence behind them.

productprdstatehypotheses
by lenar-amirov Aug 6, 2026 6/10
workflow GitHub

workflow-janitor: Audit-First Cleanup of AI Workflow Artifacts

Cleans up the debris AI workflows leave behind without discarding the knowledge in it: audit first, update documentation, then quarantine rather than delete. The quarantine step makes the cleanup reversible.

cleanupartifactsauditdocumentation
by PrantoSMSS Aug 6, 2026 6/10
workflow GitHub

bearing: DAG-Scheduled, Owner-Approved Orchestration for Coding Agents

Turns a repository request into an approved plan, then DAG-scheduled routes with bounded execution and reviewable evidence at the end. Harness-agnostic and local-first, with approval and review authority deliberately kept by the repo owner.

orchestrationdagapprovalevidence
by alphazede Aug 6, 2026 6/10
workflow Reddit

Your App Is Your Test Suite: Deep Playwright Coverage as a Model Guard

Argues that with newer models the depth of your test suite matters more than the prompt. The author's routine: keep an unusually thorough Playwright suite, let a wide-open session refactor on a throwaway branch, then port only the ideas worth keeping onto dev through controlled sessions.

testingplaywrightworkflowrefactoring
by interbolt_colin Aug 6, 2026 5/10
workflow Reddit

A Markdown Brain: Rules, Todo Queue, and a Ranked Self-Improving Backlog

One builder's answer to the absence of a canonical agentic workflow: a markdown brain holding rules, a todo queue, and a ranked backlog of future ideas, plus a weekly automated analysis of past chats that enhances the system itself. Aimed squarely at preventing rabbit holes that do not advance the goal.

workflowmarkdownbacklogself-improvement
by Ill_Ganache_7588 Aug 6, 2026 5/10
workflow Reddit

One Fact Per File: How Splitting Agent Memory Fixed Stale Notes

Memory notes accumulated until the agent was confidently repeating things that were no longer true. The fix was one long-term fact per file, with dates written out in full because 'last week' is meaningless when the note is read three months later.

memorynotesstalenessorganization
by Euphoric_Daikon_3582 Aug 6, 2026 7/10
workflow Reddit

Three-Model Planning, Unbiased Synthesis, Then Cheap Worker Agents

An orchestrator setup laid out end to end: three top-tier models each produce a plan, an independent instance synthesizes an unbiased best version, and the finalised plan goes to cheaper worker agents for execution. Useful as a concrete reference point if you are assembling your own multi-model pipeline.

orchestrationmulti-modelplanningsubagents
by N0TaC0PP Aug 6, 2026 6/10
workflow GitHub

agent-collab: Run Codex and Cursor as background workers inside Claude Code

Lets Claude Code delegate reviews, tasks and rescue jobs to Codex and Cursor running as background workers. Jobs are tracked with live progress and session handoffs between agents. A concrete take on cross-vendor multi-agent work.

multi-agentcodexcursororchestrationreview
by zebbern Aug 5, 2026 8/10
workflow GitHub

agents-that-ship: End-to-end operating playbook for AI coding agents

A written contract covering how to run an agent-built project from kickoff through App Store release to sunset. Deliberately not a framework — no code to install, just process. Targets Claude Code, Codex and Cursor equally.

playbookprocessshippingconventions
by davidmosiah Aug 5, 2026 7/10
workflow GitHub

claude-self-iterate: Multi-role self-iterating website optimization workflow

Claude crawls your site wearing 15-plus reviewer personas, runs findings through a three-gate review, then applies minimal fixes and stops on its own when done. It also revises its own workflow between rounds. An unusually complete example of a self-terminating agent loop.

workflowreviewwebsiteself-improvingpersonas
by duola15 Aug 5, 2026 7/10
workflow GitHub

harness-engineering-playbook: Organizing AI and human teams for delivery

A practical playbook for structuring mixed AI-and-human teams around production software delivery. Focuses on team organization and process rather than tooling. Useful reading if you are scaling agent use past a single developer.

playbookprocessteamsdelivery
by sobcz2624 Aug 5, 2026 5/10
workflow GitHub

fidelity-machine: Machine-verified ship gate for design-system work

Locks a brand definition, generates UI through that mold, and mechanically refuses anything off-system before it ships. Replaces subjective design review with a pass/fail gate. Aimed at agent-generated UI drifting away from the design system.

design-systemgatesverificationbrandui
by tudorjuravlea Aug 5, 2026 6/10
workflow GitHub

spire-skills: Three-stage agent orchestration pipeline from The Spire

A working build pipeline of design-swarm, run-list and conductor stages, with probe-verified execution between them and a swappable config layer. Presented as skills actually in use rather than a demo. Good reference for staged orchestration design.

orchestrationswarmpipelineskillsverification
by fastedd27 Aug 5, 2026 7/10
workflow GitHub

ready-for-agent: Automate the babysitting of parallel coding agents

Tooling for keeping a large fleet of agent-authored PRs moving without a human watching each one. The author claims 150-plus PRs a week as the target throughput. Aggressively opinionated about where human attention should go.

automationpull-requestsparallel-agentsreviewthroughput
by berenddeboer Aug 5, 2026 6/10
workflow Reddit

Minimal docs over current docs: stop Claude re-deriving architecture

After 41k agent-written lines, the author dropped the keep-ARCHITECTURE.md-current approach for a small doc holding only what the code cannot express: glossary, invariants and decisions. Code and data model stay the source of truth, so the doc never goes stale. One month of evidence, presented as a question rather than a claim.

architectureclaude-mddocumentationcontextdiscussion
by RestlessMotion Aug 5, 2026 7/10
workflow Reddit

Cutting token costs on a production AI alert-investigation agent

Three months of real numbers from an agent that reads logs and traces to write root-cause summaries into Slack: 7,364 investigations, $4,458 in tokens, median run $0.43 across 16 tool calls. The thread asks where the fat actually is in that shape of workload. Concrete cost data is rare enough to be worth reading.

costtokensobservabilityoptimizationproduction
by Odd-Jury4884 Aug 5, 2026 6/10
workflow Reddit

Keepalive prompts to keep a Claude Code session's prompt cache warm

The idea: send a trivial prompt just before the cache TTL expires so a large context never has to be re-read at full price. Would enable long-lived, heavily-preloaded sessions for near-zero upkeep. Posted as an untested proposal, with the thread weighing whether it holds up.

cachecostsessionstechniquediscussion
by UglyChihuahua Aug 5, 2026 5/10
workflow Reddit

mycelium: A plugin that makes Claude interrogate your startup idea first

A plugin marketplace entry that flips the default: Claude refuses to build until it knows who actually asked for the thing. In the author's own test it closed its own pull request. Installed via the plugin marketplace and framed as a challenge to try.

pluginvalidationproductmarketplaceplanning
by haabe Aug 5, 2026 6/10
workflow Reddit

Splitting CLAUDE.md: repo rules versus cross-project lessons

Argues CLAUDE.md becomes a junk drawer because it mixes three scopes: rules that should always load, one-off incident lessons that should not, and cross-project workflows trapped in one repo. Proposes splitting by scope so only repo-level rules stay resident. Written by someone building a memory tool, and says so up front.

claude-mdmemorycontextorganizationdiscussion
by Pure_Bend5514 Aug 5, 2026 6/10
workflow Reddit

Multi-Session Claude Code: Derive Interface Contracts, Don't Just Declare Them

A developer running three parallel Claude Code sessions built a shared system where agents publish interface contracts so others are warned before writing against stale API shapes. A sharper critique they received: contracts should be derived from source (extracted signatures on save) rather than self-declared, since a forgotten declaration fails quietly while still looking trustworthy; declaring still matters for cross-machine coordination before anything is committed.

workflowmulti-agentcoordination
by KangarooPitiful594 Aug 5, 2026 6/10
workflow GitHub

foureyes: Discovery-to-code pipeline for Claude Code via /bootstrap

Drop foureyes into any repos .claude/ directory and run /bootstrap to get a structured pipeline: discovery, spec, plan, then code. Aims to slow Claude Code down just enough to avoid skipping straight to implementation without a plan.

workflowspec-drivenbootstrap
by mik2win Aug 5, 2026 6/10
workflow GitHub

hephaestus (amurshak): One /autopilot command for the full delivery pipeline

A generic software-delivery workflow pattern for coding agents: a single /autopilot command runs orient, plan, critique, implement, review, test, ship, and finish. Ships as harness-neutral specs with generated adapters for Claude Code and OpenCode.

workflowautopilotopencode
by amurshak Aug 5, 2026 6/10
workflow Reddit

Tip: Never discuss usage quotas with Fable when using it as an orchestrator

A Reddit tip warning that if you use Fable to spawn subagents on lesser models with concurrency limits, you should never mention your 5-hour usage window to it. Doing so can trigger a safeguard that halts work until you switch to Opus, tainting context and forcing a restart.

fableorchestrationtip
by newfoundpassion Aug 5, 2026 5/10
workflow Reddit

$4.6k in Sonnet tokens across 7,453 runs: why long agent runs cost more per call

A production postmortem showing per-call cost is not fixed: median runs cost $0.43 but the tail (50-128 tool calls) costs far more per call, since every turn resends the full prior context. The real driver of expensive runs was poorly instrumented services forcing the agent to search longer, not task difficulty.

cost-analysisproductionobservability
by Odd-Jury4884 Aug 5, 2026 7/10
workflow GitHub

AMH: An operating harness for AI-agent-maintained repositories

AMH provides a memory hierarchy, a verification ladder, and reusable workflows for repos that coding agents maintain over time. Aimed at keeping long-lived, agent-touched codebases consistent and verifiable across sessions.

workflowmemoryverification
by faded-penguin021 Aug 5, 2026 5/10
workflow GitHub

FlowCrew: Planner, Parallel Coders, and QA Gates Orchestration

FlowCrew orchestrates a planning agent, parallel coding agents, and QA gates on top of Claude Code or Codex from a single brief, with a persistent campaign memory meant to improve across runs. Aims to let you hand off a task and walk away.

orchestrationmulti-agentqa
by cuibuaa Aug 5, 2026 7/10
workflow Reddit

Workbench: Lessons and Rulebook From a Full-Autonomy Dev Workflow

A write-up and accompanying docs (workbench-101, lessons-with-examples, workflow-mechanics, auto-mode-rulebook) from someone who spent months offloading most development work to agents. Covers concrete guardrails and lessons learned for running agents with minimal supervision.

autonomyguardrailsdocumentation
by _itshabib Aug 5, 2026 7/10
workflow GitHub

Claude Harness Forge: Governance Harness With Blocking Hooks

An MIT-licensed governance harness for Claude Code that combines blocking enforcement hooks, routed coding standards, and multi-project trackers with resume points, aimed at keeping agent work within agreed constraints across sessions.

governancehooksmulti-project
by JayOfemi Aug 5, 2026 6/10
workflow GitHub

Agent Task Manager: Task Board and Pool of Sandboxed Coding Agents

A task board paired with a pool of sandboxed coding agents that pick up and work tasks, plus a manager agent you talk to directly. Useful for teams wanting a lightweight way to fan out coding work across multiple isolated agent workers while keeping a single conversational point of control.

orchestrationtask-managementsandboxed-agents
by Mark-Life Aug 5, 2026 6/10
workflow GitHub

Agent Duet: CLI for Orchestrating Claude Code and Codex Sessions Together

A human-steerable local CLI that orchestrates native Claude Code and OpenAI Codex sessions side by side, with explicit routing rules, persistent handoffs between the two, and review workflows designed to keep a human in the loop. Aimed at developers who want to combine both agents' strengths without losing control over what gets executed.

orchestrationcodexmulti-agent
by Alqahtani921893 Aug 5, 2026 6/10
workflow Reddit

Benchmarking BM25F File Shortlists to Cut Coding-Agent Search Time

A local BM25F lexical ranking pass over file contents, names, and directories generates a shortlist of likely-relevant files before a coding agent starts grepping a codebase. Benchmarked on 240 real SWE-bench Lite issues across six repos, it puts the correct file in the top 20 results 77.9% of the time with no embeddings or API calls. Excluding in-repo documentation from the ranking was the single biggest accuracy gain, lifting MRR from 0.383 to 0.475.

searchbenchmarkingbm25codebase-navigation
by newtophillyfromkc Aug 5, 2026 8/10
workflow GitHub

Agent Pingu: Vault-Backed Engineering Loop With Blind Reviewers

Agent Pingu is a structured development loop for Claude Code built around lanes, phases, and enforced gates, backed by a persistent vault. Four independent blind reviewers check work at each gate before it can proceed, aiming to catch mistakes a single self-review would miss.

orchestrationcode-reviewgates
by rashedulhasansojib Aug 5, 2026 6/10
workflow Reddit

Auto-resume: pause and resume Claude Code before hitting usage limits

A technique for avoiding mid-run stops from 5-hour session limits: poll the statusline, pause new work at 90% usage and new agent spawns at 80%, then resume once the window resets, letting overnight runs continue without interruption.

session-limitsautomationstatusline
by Safe-Analysis-5804 Aug 5, 2026 5/10
workflow Reddit

Pairing on Claude Code with a second reviewer fixes approval fatigue

Running Claude Code in a shared multiplayer session with a second person reviewing each other's turns solved approval fatigue better than solo manual-review or accept-edits mode — each person reviews the other's diffs without the self-approval bias of reviewing their own prompts.

pair-programmingcode-reviewmultiplayer
by r1chardkam Aug 5, 2026 6/10
workflow Reddit

claude-multisession: coordination tools for running many Claude Code sessions at once

A toolkit for multi-session Claude Code work: cross-session messaging, claims/locks so two sessions don't grab the same task, a worktree gate and reaper to stop sessions from clobbering each other's branches, a hook-install checker, and a number allocator for sequentially-numbered docs like ADRs.

multi-sessionworktreecoordination
by Wsz2020 Aug 5, 2026 7/10
workflow Reddit

Bucket unknowns into human-decision, testable-fact, or reversible-default before planning

A technique for keeping Claude Code from silently converting ambiguous requirements into assumptions: before implementation, sort every unknown into a human decision (stop and ask), a testable fact (investigate and cite evidence), or a reversible default (choose, but state the choice and how to undo it) — with any unresolved human decision required to stay visible in the final plan.

planningrequirementstechnique
by imbobbyshi Aug 5, 2026 6/10
workflow GitHub

cc-autoship: Trace AI Dev Work as GitHub Issues/PRs/Reviews

cc-autoship turns Claude Code's development work into a traceable, reviewable asset on GitHub by capturing it as issues, PRs, diffs, and reviews. Aimed at teams that want an auditable paper trail for AI-driven changes.

githubworkflowcode-reviewtraceability
by maee-co Aug 4, 2026 6/10
workflow Reddit

Tip: Offload Heavy Claude Code Sessions via VS Code Remote SSH

A Reddit tip describing how to run multiple parallel Claude Code sessions on a beefier remote machine using VS Code Remote SSH instead of upgrading your local PC. Simple, concrete workaround for RAM-constrained machines running several agent sessions at once.

remote-sshperformancemulti-sessionvscode
by Leasj Aug 4, 2026 5/10
workflow GitHub

Software Build Assurance Kit: Red-First TDD Gates for AI Agents

A workflow enforcing red-first TDD, self-tested gates, calibrated independent verification, and commit-bound evidence for coding agents. Aims to give teams confidence that AI-written code actually passed real checks before merging.

workflowtddverificationci
by kknipe2k Aug 4, 2026 6/10
workflow GitHub

kilin: Deterministic, Inspectable Workflow Runtime for Coding Agents

kilin is a local, CLI-first runtime that lets you describe a workflow in plain files, validate it before running, then execute it through Codex, Claude Code, or OpenCode with explicit approvals and persisted run history. Useful for making agent-driven workflows repeatable and auditable instead of ad hoc.

workflow-runtimecliautomation
by kilin-space Aug 4, 2026 7/10
workflow Reddit

Why Chat Is the Wrong Abstraction for Multi-Agent Software Engineering

An essay arguing that as AI coding moves to multi-agent workflows, chat history is a poor substitute for real engineering artifacts like ownership boundaries, dependencies, and file-scoped responsibilities. Describes a concrete pattern (a TESTER agent owning test structure while a FIXER agent handles bugs, coordinated via explicit boundaries) drawn from a year of multi-agent experiments.

multi-agentarchitectureessay
by rodrigopfraga Aug 4, 2026 6/10
workflow Reddit

Making Browser Agent Workflows Reliable by Saving Them as Reusable Commands

A Reddit post describing why browser agents fail silently (e.g. scraping the wrong table after a layout change) and how switching from re-prompting the agent every run to letting it discover a workflow once and saving it as a reusable command (using a tool called WebCmd) made results far more trustworthy. Useful technique for anyone running recurring browser-automation tasks with AI agents.

browser-automationreliabilitytechnique
by Opening-Profile6279 Aug 4, 2026 6/10
workflow GitHub

paper2pr: Turn AI/ML Papers into Presentation Slides via Claude Code

paper2pr is a Claude Code multi-agent workflow that converts an AI/ML paper into presentation-ready Beamer and Quarto slides. Useful for researchers who need to quickly turn a paper into a talk without manually building slides.

researchslidesmulti-agent-workflow
by alohays Aug 4, 2026 7/10
workflow GitHub

Adversarial multi-agent code review committee

A multi-agent code review workflow where a committee of specialist reviewer agents adversarially critique code, aiming to catch issues that single-pass AI review misses. Useful pattern for teams wanting more rigorous automated review with Claude Code.

code-reviewmulti-agentworkflow
by yuefanxiao Aug 4, 2026 7/10
workflow GitHub

Playbook for running codex/opencode/agy headlessly and in parallel

An operational-hardening playbook documenting the stdin deadlocks, silent empty reads, SQLite races, and truncated outputs that hit when driving CLI coding agents headlessly and in parallel, each with a one-line fix. Useful reference for anyone automating agent CLIs in CI or scripts.

workflowautomationheadless
by oldantique Aug 4, 2026 5/10
workflow GitHub

Docket: in-repo work ledger for concurrent AI coding sessions

A numbered, file-based work ledger checked into the repo so concurrent Claude Code / multi-agent sessions can file, claim, and close tasks on the record, avoiding collisions between parallel agents working the same codebase.

workflowmulti-agentcoordination
by moranbickel Aug 4, 2026 7/10
workflow GitHub

grimoire: domain-specific agents and file-ownership enforcement

Extends Claude Code with domain-specific agents and reusable skills, plus enforcement logic that routes edits of owned files to the right specialist agent automatically. Aimed at keeping large multi-agent setups organized and on-spec.

workflowmulti-agentskill
by anton-kochev Aug 4, 2026 7/10
workflow GitHub

Framework: meeting recording to deployed Agentforce service agent

A Claude Code-native framework that takes a meeting recording and turns it into a deployed Salesforce Agentforce service agent, complete with an in-app feedback loop. Niche but shows an end-to-end pattern for turning requirements capture directly into a deployed agent.

workflowsalesforceautomation
by emailworksfdc-wq Aug 4, 2026 5/10
workflow GitHub

fde-atlas: framework for safe AI-agent document & research management

A Japanese-language framework that lets AI agents like Claude Code safely handle document management, research, meeting minutes, and design-doc creation within defined guardrails. Aimed at teams wanting structured, auditable agent workflows for knowledge work rather than ad-hoc prompting.

frameworkdocumentationgovernancejapanese
by CobaltSato Aug 4, 2026 6/10
workflow GitHub

ein-agent: multi-runtime coding-agent harness with SDD/OpenSpec discipline

A harness for running coding agents (Pi and Claude Code) under spec-driven development and OpenSpec discipline, aiming to keep agent output aligned to a written spec rather than free-form prompting. Targets teams wanting more structured, spec-first agent workflows.

harnessspec-driven-developmentopenspecmulti-runtime
by samuhlo Aug 4, 2026 5/10
workflow GitHub

ultracode-workflows: multi-agent scripts, statusline, and diagram tools

A comprehensive suite for Claude Code combining multi-agent 'ultracode' workflow scripts, a workflow-authoring skill, a live-progress statusline, an enhanced observation UI, and validator/diagram tools. From a known contributor in the Claude Code tooling community (curator of awesome-claude-code), suggesting solid execution.

multi-agentworkflowstatuslinediagrams
by hesreallyhim Aug 4, 2026 7/10
workflow GitHub

Multi-Agent Dev Team Framework: Structure Over Model Capability

A multi-agent software development framework designed to maintain quality under a single-model constraint, using fact-sourced documentation, nine opposing role-based goals, executable gates, and multi-model review. Argues that structured process, not raw model capability, drives reliable output in agentic dev workflows.

multi-agentworkflowquality-gates
by LiuPeng-1024 Aug 4, 2026 6/10
workflow Reddit

Using Claude Code and Codex as Independent Reviewers, Ship Only the Overlap

A workflow where an article on agent-graph design patterns was fed independently to Claude Code and Codex to audit the same repo, then only the recommendations both models agreed on were implemented. The process used a read-only 'Explore' subagent for inventory and an adversarial evidence-reviewer subagent, and it surfaced a real governance bug along the way — a technique for reducing single-model bias in architectural decisions.

workflowmulti-agent-reviewsubagents
by Stunning-Way-7527 Aug 4, 2026 6/10
workflow GitHub

GraphCode: Hand-Offs and Loops for Wiring Coding Agents Together

A framework for chaining coding agents together through hand-offs and loops so multi-step work can continue running without direct supervision. Positioned as infrastructure for building longer-running, multi-agent coding pipelines.

workflowmulti-agentorchestration
by scgopi Aug 4, 2026 5/10
workflow GitHub

diffmode_free: Free Claude Code/Codex Plugin for Growth-Strategy Pipelines

A free, Apache-2.0 licensed Claude Code and Codex plugin that runs a growth-strategy pipeline for bootstrapped founders: competitor analysis, a buyer jobs-to-be-done map, and 7-9 unconventional acquisition tactics, in about 90 minutes, fully local. An example of using Claude Code plugins for non-coding business strategy work rather than software development.

plugingrowth-strategyworkflow
by acogood Aug 4, 2026 6/10
workflow Reddit

Open multi-agent cluster: Claude Code agents co-building a trading algo

A live public cluster where Claude Code sessions from different owners collaborate on one shared crypto-trading codebase — agents propose hypotheses, run backtests, and critique each other's results in the open, with a public dashboard and repo anyone can fork or connect an agent to.

multi-agentworkflowcollaborationtrading
by Psychological_Arm645 Aug 3, 2026 6/10
workflow Reddit

Overnight goal-running workflow: one metric, one prompt, till 8am

A workflow for running Claude Code unattended overnight with a single structured prompt — /goal improve {target} in {scope} from {baseline} toward {goal state}, without {constraint}, until 8am — on a throwaway branch with no push credentials and a spend cap. Requires a mandatory morning report covering the starting number, ending number, reasoning, and next recommendation.

workflowautomationovernightprompt-pattern
by Comprehensive_Toe743 Aug 3, 2026 7/10
workflow Reddit

What's actually documented about cache reads vs. your Pro/Max limit

A researched breakdown of Anthropic's prompt-caching mechanics (write/read multipliers, what counts toward ITPM) and a clear explanation that these API-documented facts don't automatically apply to subscription (Pro/Max) usage limits, which Anthropic doesn't document — correcting a common conflation seen in community answers.

workflowusage-limitscachingresearch
by actvt_io Aug 3, 2026 6/10
workflow Reddit

Daily scheduled routine that fixes Claude Code session title drift

A scheduled daily prompt that uses Claude Code Desktop's session-management MCP tools (list_sessions, list_events, set_session_title) to rename sessions whose auto-generated title no longer matches what the conversation became, only renaming on clear mismatches within the past 24 hours.

workflowautomationsession-management
by yellofruit Aug 3, 2026 6/10
workflow Reddit

Big Brother/Little Brother: pairing Fable with Opus to keep it on task

A workflow for making Opus 5 reliable by running it in a loop against a lightweight dev framework that tracks projects, tasks, and evidence, capped at 3 internal pre-reviews and 4 review-service submissions before a human is paged. A separate Fable session monitors Opus's failed sessions, rewrites its skills/rules, and sometimes finishes the stuck task itself.

workflowopusmulti-agentorchestration
by Chipware Aug 3, 2026 6/10
workflow Reddit

A full guide to context engineering in Claude Code, from first principles

Explains why context engineering matters from first principles: LLMs are stateless, agents fake state by re-pasting the whole conversation array each turn, and attention degrades as context grows with no clean drop-off point (citing Lost in the Middle). Works through the practical implications for structuring prompts and managing context in Claude Code.

workflowcontext-engineeringguide
by agenticlab1 Aug 3, 2026 7/10
workflow GitHub

claudezero: supervisor script that drives Claude Code through a full spec

A supervisor script that builds a software specification into a finished product using Claude Code, looping over a to-do list until each item is implemented, committed, and checked off. Multiple instances can claim to-dos in parallel, synchronized through the git repository.

workfloworchestrationspec-driven
by IvanRublev Aug 3, 2026 7/10
workflow GitHub

claude-tdd-kit — Day-Loop and Gated TDD Pipeline

A Claude Code plugin marketplace bundling two independent plugins: a developer day-loop workflow and a gated test-driven-development build pipeline. Aimed at enforcing TDD discipline in agent-driven coding sessions.

tddworkflowplugin
by shashankreddy509 Aug 3, 2026 6/10
workflow GitHub

my-claude-maestro — Master Orchestrator Plugin

A Claude Code plugin that orchestrates task classification, live documentation, a design gate, layered security checks, and model routing. Aims to be a single entry point coordinating an entire development workflow.

orchestrationplugin
by impravin22 Aug 3, 2026 6/10
workflow GitHub

Self-Improvement-Plugin — Verification-Gated Agent Harness

An experimental self-improvement harness for Claude Code, ChatGPT, and Codex featuring memory-aware startup, safer tool use, verification hooks, bounded fresh-context delegation, a deterministic task-graph runtime, and session closeout.

verificationharness
by RasputinKaiser Aug 3, 2026 6/10
workflow GitHub

youtube-transcript-scraper-and-summary — YouTube-to-Blog Workflow

An agentic workflow that fetches YouTube transcripts, generates deep summaries via Claude, and uploads structured blog posts to Notion with full metadata. Automates turning video content into written posts.

youtubenotion
by shirleyisdoingrightthings Aug 3, 2026 6/10
workflow GitHub

icode-skill — 6-Step Coding Workflow

A structured six-step coding workflow for Claude Code — Plan, Review, Finalize, Code, Deep Check, Audit — runnable all at once or step-by-step, with the ability to switch models between steps.

coding-process
by ayukyo Aug 3, 2026 6/10
workflow GitHub

Content-Agent-Kit — Crawl-Write-Review-Publish Content Pipeline

A kit for agentic IDEs (Claude Code, Antigravity) to build a content agent that crawls sources, writes drafts, gates them through a review step, and publishes to social platforms via Make.com. Includes a 9:16 video pipeline with voiceover, B-roll, and web screenshots. Zero dependencies, environment-variable only, MIT licensed.

content-generationautomation
by XuHo-IT Aug 3, 2026 5/10
workflow GitHub

gsd-openspec-integration — OpenSpec as the Ship Gate

A GSD Core capability making OpenSpec the normative requirement source for the GSD phase loop, blocking shipping until the implementation is proven to satisfy the spec.

spec-drivengsd
by mshegolev Aug 3, 2026 5/10
workflow GitHub

mogui-ADE-orchestrator — Orchestrator Inside the Orca ADE

Runs one AI agent as the orchestrator of an entire workspace inside the Orca ADE, using only a CLI subscription — no API key or model endpoint. Orca hosts and places every session; the harness dispatches workers under contract, verifies their output before accepting it, and hands the orchestrator role to a fresh session when context runs out.

orchestrationade
by baksohyeon Aug 3, 2026 6/10
workflow GitHub

Self-Healing SDLC Agent Framework: 13 Agents, 26 Skills, 9 Hooks

A self-healing agent framework for Claude Code covering the full SDLC/SSDLC with 13 specialized agents, 26 skills, 13 slash commands, and 9 hooks. Includes a launchd watchdog daemon and observability dashboard for auto-activating, drift-reconciling, snapshot-protected automation.

workflowsdlcagentshooksobservability
by pfangueiro Aug 2, 2026 8/10
workflow GitHub

Eleven Claude Code Workflows: Review, Security Audit, Feature Dev

A pack of eleven rigorous workflows for Claude Code, Codex, OpenCode, and Pi covering code review, security audit, feature development, frontend design, and MCP tooling. Portable across multiple coding agents.

workflowcode-reviewsecurity-auditopencode
by waybarrios Aug 2, 2026 6/10
workflow Reddit

Fully Automating Dev Work with Claude Cloud Routines

A developer replaced manual prompting with scheduled Claude cloud routines: one daily routine reviews the codebase and CI to manage GitHub issues, and two-plus daily routines work open tickets through to PRs. The result is a closed loop -- tickets to tests to features to verification to PR to CI to new tickets -- with the human only approving PRs.

workflowautomationcloudci-cd
by Several-Marsupial-27 Aug 2, 2026 7/10
workflow GitHub

claude-code-queue: macOS Daemon Doses Work Across Session Resets

A macOS daemon that queues Claude Code tasks and automatically runs them as your 5-hour session limit resets, spreading work across windows so you don't have to babysit the cap manually.

macosdaemonusage-limitsautomation
by davorinpavlica Aug 2, 2026 6/10
workflow Reddit

Sandboxed Self-Test Loop Let Claude Code Write 100 VBA Modules Unattended

A workflow pattern for unattended Claude Code runs against Excel/VBA: the agent works on a throwaway workbook copy, writes and imports each module, and runs a self-test before promoting it to the real file. Includes automatic Excel crash/hang recovery so the loop can run overnight without supervision.

automationsandboxingself-testunattendedvba
by PutFun1491 Aug 2, 2026 8/10
workflow GitHub

mogui-agent-harness: Vendor-Neutral Agent Ops Harness with Claude Code Hooks

A vendor-neutral agent operations harness that adds a .agent context layer, an LLM wiki, GSD-style planning, and loop engineering, wired into Claude Code, Codex, and Cursor via hooks. Designed to drop into either a greenfield repo or an existing codebase in a single setup step.

agent-harnesshooksplanning
by baksohyeon Aug 2, 2026 6/10
workflow GitHub

dw-solo-skills: A Spec-to-Ship Workflow Sized for Solo Repos

A persistent spec-to-ship workflow for Claude Code aimed at solo developers working in repos only they read, trading the ceremony of team-oriented workflows for a leaner 'thin lane' process.

workflowsolo-devspec-to-ship
by dominikwozniak Aug 2, 2026 5/10
workflow GitHub

claudex-stereo: Claude Plans and Reviews, Codex Implements

A workflow that splits agentic coding across two models: Claude Code handles planning and review while Codex handles implementation, aiming to combine each model's relative strengths instead of relying on one agent for the whole loop.

multi-modelworkflowcodex
by vsladkov Aug 2, 2026 6/10
workflow GitHub

AgentWorkspaceOS: Local-First Markdown Governance Layer for Coding Agents

A local-first governance layer written in plain Markdown for coordinating Codex, Claude Code, and other AI coding agents working in the same workspace, aimed at keeping multi-agent setups from drifting out of sync.

governancemarkdownmulti-agent
by zhangj012595-cloud Aug 2, 2026 5/10
workflow GitHub

yoke (npm): Cross-Agent Harness With Safety Gates and Proof Artifacts

A cross-agent coding harness for Claude Code, Codex CLI, and Gemini CLI built around one shared skill canon, mechanical safety gates, and an autonomous loop with live progress/ETA reporting and proof artifacts for each run. Published to npm as @hecer/yoke.

harnessmulti-agentsafety-gates
by HECer Aug 2, 2026 6/10
workflow GitHub

wincreator: Stop Your Agent From Lying About Passing Tests

A hierarchical engineering-loop system with machine-checkable proof gates, aimed at the common failure mode where an AI coding agent claims tests pass without actually running them.

workflowverificationproof-gates
by winterbim Aug 2, 2026 7/10
workflow GitHub

TAD: Two-Agent Quality Framework With Design and Execute Roles

A development framework that splits work between a Design agent (Alex) and an Execute agent (Blake), enforced by a 4-gate quality system and backed by 25 capability packs covering different domains.

workflowmulti-agentquality-gates
by Sheldon-92 Aug 2, 2026 6/10
workflow GitHub

savetokens: A Measured Datasheet of Token-Saving Techniques

A component-datasheet-style writeup of token-saving techniques for Claude Code and Codex, with measured before-and-after figures that refresh daily. Source for savetokens.tips.

token-usageworkflowbenchmarks
by ryanportfolio Aug 2, 2026 6/10
workflow GitHub

worktender: reconcile git worktrees with coding-agent workspaces

A herdr plugin that keeps git worktrees and agent workspaces in sync — starting an agent on an issue in its own worktree, then reconciling `git worktree list` against herdr's known workspaces to adopt orphans, staff empty ones, and remove finished checkouts. Resumes Claude Code sessions from existing transcripts rather than restarting them.

workflowgit-worktreesmulti-agent
by steig Aug 2, 2026 6/10
workflow GitHub

design-harness: Approval-Gated Web Design Workflow

A structured workflow for Codex and Claude Code that takes a web design from interview through a DESIGN.md spec, a build phase, independent review, and deterministic QA, with approval gates between each stage.

web-designworkflowapproval-gateqa
by ForgetMeAI Aug 2, 2026 6/10
workflow GitHub

ai-protocol: Concept-First Scaffolding Protocol for AI Agents

A harness-agnostic protocol for greenfield projects that starts from a rigorous concept rather than a chain of ad-hoc prompts, so agents build from shared intent. Includes self-healing and crash-safe state handling.

scaffoldingprotocolharness-agnostic
by dnlbox Aug 2, 2026 5/10
workflow GitHub

antigravity-for-claude-code: Run Antigravity CLI as a Sub-Agent

A Claude Code plugin that runs Google's Antigravity CLI (Gemini) as a collaborating sub-agent, with intelligent model routing across different phases of the SDLC. Unofficial community project.

antigravitygeminisub-agentmodel-routing
by yuting0624 Aug 2, 2026 6/10
workflow GitHub

cleargate: Four-Agent Planning Framework for Claude Code

A sprint/epic/story planning protocol for Claude Code agents built around a four-agent loop -- architect, developer, qa, and reporter. Includes a Karpathy-style awareness wiki to keep long-running agent teams oriented across a project.

planningmulti-agentworkflowsprint
by sandrinio Aug 2, 2026 6/10
workflow Reddit

A Doc-Driven Workflow: Architect Agent + Hooks + Phased Planning Docs

A Reddit user shares their workflow for large AI-generated projects: an ENGINEERING doc of coding principles enforced by an architect subagent and a hook, plus a cascade of ARCHITECTURE, PLANNING, phase, and PROGRESS docs that keep long unsupervised builds on track.

workflowplanning-docsarchitect-agenthooks
by geekichu Aug 2, 2026 6/10
workflow GitHub

company-os: Run AI Coding Agents as an Autonomous Software Company

A framework for organizing Claude Code, Codex, and Devin into an autonomous company structure -- a charter, 30 defined roles, SOPs, and cross-platform adapters for coordinating many agents on real work.

multi-agentorchestrationrolessop
by wookat Aug 2, 2026 6/10
workflow GitHub

festival: Structured Multi-Phase Planning for AI Coding Agents

A planning framework that persists context across sessions so multi-phase work can be planned once and executed by any agent -- Claude Code, Codex, or OpenCode -- without losing the thread between sessions.

planningmulti-agentpersistencecross-tool
by Obedience-Corp Aug 2, 2026 6/10
workflow Reddit

Turning CLAUDE.md Prose Rules Into Build-Time Guards That Fail CI

A solo developer converted four CLAUDE.md rules that kept getting silently dropped between sessions into scripts wired into npm run build, so violations fail the build instead of relying on the model remembering. Covers guards for email HTML fallbacks, price consistency, retired product copy, and an HTML sanitizer allowlist, each one only allowed to grow stricter over time.

claude.mdciguardrailsbuild-scripts
by usestork Aug 1, 2026 7/10
workflow GitHub

Agentic Template Repo: Hash-Pinned AGENTS.md Kernel With CI Gauntlet

A template repository for agentic coding projects, built around a hash-pinned AGENTS.md "kernel" and a single check.sh gauntlet that's mirrored in CI. Includes a memory system that learns from external signals and forgets on a schedule, and targets Claude Code, Codex, and any AGENTS.md-reading harness.

agents-mdtemplatecimemory
by srinator22 Aug 1, 2026 6/10
workflow GitHub

littlepowers: Proportional Planning and Recovery Protocol for Agents

A proportional planning, recovery, and engineering-discipline protocol for coding agents, designed to work across Codex, Claude Code, Qoder, and OpenCode. Aims to keep agent effort scaled to task size and recover gracefully from failures.

planningprotocolmulti-tooldiscipline
by clsaa Aug 1, 2026 6/10
workflow GitHub

wiggum: Self-Driving Agent Loop From GitHub Issue to Verified PR

A self-driving agent loop for Claude Code that turns an issue into a planned, verified, and committed change end-to-end. Lets you run, supervise, and chain multiple workplans from the shell for more autonomous delivery.

workflowautomationissue-to-prcli
by benman1 Aug 1, 2026 7/10
workflow Reddit

orch: Architect-Planned Agent Pipeline With Worktrees, Pinned Merges

Orchestrates Claude Code and Codex CLI subagents behind an Architect role that plans work as one issue per task with model/effort/reviewer assigned, then spins up a branch and worktree per issue for an Implementer or Specialist, followed by automated review and CI. Merges run pinned to the approved commit and fail closed if the PR changes after approval.

orchestrationworktreesmulti-agentpr-review
by kninetimmy1 Aug 1, 2026 8/10
workflow GitHub

dispatch: Durable Worktree Sessions With Append-Only History

Provides durable work sessions for coding agents using isolated Git worktrees, an append-only history of what happened, and explicit merge outcomes. Aimed at making long-running or resumable agent sessions easier to audit and recover.

worktreessessionsgitautomation
by smithdak Aug 1, 2026 6/10
workflow GitHub

nightlight: Turn TASKS.md Queues Into Reviewable PRs Overnight

Runs unattended Claude Code sessions overnight that work through a TASKS.md queue and turn each item into a reviewable pull request. Aimed at "leave it running while you sleep" style batch task processing.

automationtaskspull-requestsunattended
by c0d3ster Aug 1, 2026 7/10
workflow GitHub

ccgrapher: Catches Fake-Passing Verification Steps in Agent Plans

ccgrapher lints agent workflow plans for joins that pass while a branch is actually dead, and for verifiers that end up grading their own work. It also finds every plan step that isn't actually waiting on anything, and runs those independent steps in parallel. Ships as a Claude Code skill (parallel-plan) that checks a plan's real dependencies before the agent executes it.

agent-workflowslinterparallel-executionclaude-code-skill
by artfusion Aug 1, 2026 7/10
workflow GitHub

autocomp: An Autonomous Company Run as a Tick Loop in Claude Code

Runs a simulated company inside Claude Code as a recurring tick loop, with role-based subagents, human approval gates on anything touching money or outreach, and an append-only ledger for auditing what happened.

autonomoussubagentsapproval-gatesledger
by Eastkap Aug 1, 2026 6/10
workflow GitHub

ose-primer: A Polyglot Nx Monorepo Template Pre-Wired for AI Agents

A repository template for Nx monorepos that ships with governance rules, AI agent/skill scaffolding, three-level testing, and 11+ language backends pre-wired, so new repos start with working conventions instead of a blank slate.

monoreponxtemplategovernancetesting
by wahidyankf Aug 1, 2026 5/10
workflow GitHub

checkwright: Installable Kits for Machine-Gated Agent Delivery

Packages a coding-agent delivery methodology as installable kits — spec consistency checks, an evidence-stamped iteration lifecycle, and token-aware context management for keeping long agent-driven projects on track.

deliveryspec-consistencycontext-management
by checkwright Aug 1, 2026 5/10
workflow GitHub

design-review-workflow: Evidence-Backed Website Design Reviews

An agentic workflow for repo-capable AI agents that captures screenshots, inspects the visual evidence, and gates a business-grade design review report — instead of an agent guessing at how a page looks.

design-reviewscreenshotsevidencereporting
by RNT56 Aug 1, 2026 6/10
workflow GitHub

researchhelm: A Human-Gated Research Protocol for Coding Agents

Structures agent-driven research as resources → ideas → human approval gates → bounded experiments → audited claims. Ships as a Claude Code plugin and portable skill — a test-first generalization of karpathy's autoresearch.

researchhuman-in-the-loopautoresearchplugin
by zhangyiCristino Aug 1, 2026 6/10
workflow GitHub

ralphctl: A Ralph-Loop Harness for Long-Running Agent Tasks

Implements the "ralph" pattern — a generator/evaluator loop — to orchestrate Claude Code, OpenAI Codex, and GitHub Copilot across multiple repositories for long-running, semi-autonomous coding tasks.

ralph-loopgenerator-evaluatororchestrationcodexcopilot
by lukas-grigis Aug 1, 2026 6/10
workflow Reddit

codor: Fable-Orchestrated Multi-Agent Workflow Across Git Worktrees

An open-source workflow where one Fable agent orchestrates four Opus agents and a GPT agent across five git worktrees — picking up GitHub issues/PRs, dispatching implementation work, routing blockers to a specialist investigator agent, and reviewing/merging the results itself.

multi-agentfableopusgit-worktreesorchestration
by richhard Aug 1, 2026 7/10
workflow GitHub

MarbleRun: Local-First Claude Code Automation for Agent Chains

A local-first automation framework (also known as llmauto) for chaining autonomous Claude Code agent runs together. Aims to let multi-step LLM workflows run unattended on your own machine.

automationagent-chainslocal-firstorchestration
by ellmos-ai Aug 1, 2026 6/10
workflow GitHub

MindFlock: Run a Flock of AI Coding Agents from Your Ticket Queue

Spins up an already-running Claude Code session in its own git worktree for each ticket pulled from Jira, Linear, GitHub Issues, Shortcut, or Asana. You review the diff and merge — no manual session setup per task.

orchestrationworktreeticket-queuemulti-agent
by MindFlock Aug 1, 2026 7/10
workflow GitHub

lupo-ai-os: A Working AI Operating System for Claude Code

The author's actual production setup for shipping with Claude Code — rules, hooks, subagents, and patterns bundled as a reusable 'AI operating system.'

hookssubagentsoperating-system
by localwolfpackai Aug 1, 2026 6/10
workflow Reddit

Mining 1,656 Coding Sessions into a CLAUDE.md Profile

A technique for extracting behavioral rules from session history: only patterns that recur across at least two separate sessions become rules, sorted into layers for working style, design taste, writing voice, and editing habits. Tested head-to-head against a plain CLAUDE.md on the same task with a visibly different result.

claude.mdpersonalizationsession-mining
by BiosRios Aug 1, 2026 8/10
workflow GitHub

ai-workflow-playbooks: 21 Production Playbooks for AI Coding Agents

Production-grade playbooks covering the full software delivery pipeline — 21 playbooks, 10 agent skills, 4 specialist 'guardian' agents, and 5 runbooks from discovery through operations.

playbooksdelivery-pipelinerunbooks
by varunk130 Aug 1, 2026 6/10
workflow GitHub

A Plan-First Development Partner With Tier-Routed Agents

Interview-driven planning followed by execution across haiku/sonnet/opus-tiered agents, with an adversarial review chain that verifies changes through real usage rather than just reading the diff.

plan-firsttiered-agentsadversarial-review
by anilcancakir Aug 1, 2026 6/10
workflow GitHub

work-harness: Multi-Agent Delivery Harness That Drives PRs to Merged

Decomposes a backlog into PR-sized units and dispatches one autonomous Claude Code lead per unit across local, SSH, or cloud hosts, with a persistent 'shepherd' driving every PR through to merged.

multi-agentpr-automationorchestration
by dwiedeman Aug 1, 2026 7/10
workflow Reddit

Why a Green Test Suite Lied: Silent SQLAlchemy 2.x Failures Masked by In-Memory SQLite

A deep dive into a real bug found while pointing Claude Code at other repos: a 7k-star library's pytest suite showed 31 passed, but silent INSERT failures, a swallowed transaction exception, and leaked connections were all present at that commit. In-memory SQLite hid the failures because the whole suite ran on a single connection. A useful reminder that green tests are not proof of correctness.

testingverificationsqlalchemycode-reviewdebugging
by Dull_String9524 Jul 31, 2026 8/10
workflow GitHub

dwarves-kit: Spec-Driven Development Kit With Verification

A minimal Claude Code workflow kit from Dwarves Foundation for spec-driven development, bundling 12 hooks, 12 commands, 8 agents, and 1 skill to enforce verification at each step.

workflowspec-drivenhooksagents
by dwarvesf Jul 31, 2026 7/10
workflow GitHub

cohorte: Portable Multi-Agent Pipeline From Brainstorm to Ship

A token-frugal Claude Code pipeline that runs brainstorm, spec, build, smoke, review, and ship as one agent per stage. Installs with a core package and a single /init-pipeline command that adapts to your stack.

workflowmulti-agentpipeline
by TheBidouilleAgency Jul 31, 2026 6/10
workflow Reddit

Persona-Based Subagents: A 'Wednesday Addams' Debugging Agent

A shared example of building Claude Code subagents around personas rather than generic role names, here a relentless-investigator persona tuned specifically for finding silent failures and making blind spots in a codebase observable.

workflowsubagentspersonadebugging
by VertigoOne1 Jul 31, 2026 5/10
workflow GitHub

famulus: A Backlog That Works Itself via Real Claude Code Sessions

Self-hosted agentic task pipelines that run as actual Claude Code sessions on your own machine, turning a backlog into a queue of autonomous work rather than a list someone has to pick up manually.

workflowautomationtask-pipeline
by getfamulus Jul 31, 2026 6/10
workflow Reddit

teamlore: Share 'Trauma' Between Your Team's Claude Code Agents

When one developer's agent gets corrected or breaks something, teamlore writes a small lore file into a .lore/ folder that ships in the PR. After merge, every teammate's agent automatically recalls that lesson when it touches the same part of the repo, no server, database, or account, just files in git.

workflowteammemorygit
by Calm_Sandwich069 Jul 31, 2026 7/10
workflow GitHub

Wakeflow: Dual-Host Task Delivery for Codex and Claude Code

Plugins for Codex and Claude Code that manage controller state roots, package tasks, deliver them directly to a thread or session, and support evidence review, all running local-first.

workflowtask-deliverylocal-first
by GxFn Jul 31, 2026 5/10
workflow GitHub

Free lightning lessons on getting real, provably-correct work out of coding agents

Free lessons from the Hardcore Agentic Engineering course for builders who ship, focused on getting real work out of coding agents and proving that the work is correct rather than just trusting the agent's report. Includes slides, live demos, and example code.

educationagentic-engineeringverification
by specstoryai Jul 31, 2026 7/10
workflow Reddit

Adventure Party: a Claude Code plugin built around dialogue, orchestration, and leveling up

A Claude Code plugin whose philosophy centers on three things: the human-AI dialogue where decisions get made and understood, agentic orchestration where multiple agents build/test/review/ship, and recording learnings so they compound over time. Positioned between highly structured TDD frameworks and fully autonomous 'let the model run' approaches.

pluginorchestrationphilosophy
by turtleninja99 Jul 31, 2026 6/10
workflow GitHub

kaizen: a full software-delivery-lifecycle orchestrator plugin with evidence-checked gates

Runs an entire SDLC — planning, design, implementation, code review, verification, acceptance, and knowledge maintenance — as one in-session orchestrator that dispatches named specialist personas, checking evidence at every gate instead of relying on the agent's self-report.

sdlcorchestrationverificationplugin
by BhangeeF16 Jul 31, 2026 7/10
workflow Reddit

Claude Code sessions that block on a decision without burning tokens

A session workflow that pauses when it needs a human decision by writing the question to a file and halting, then wakes itself via a bounded detached watcher process (up to 8 hours) with zero model turns while idle. Also supports moving a live session between terminals without losing its number, folder, lock, or branch. Ships as 19 skills, 3 agents, and 8 hooks under MIT license.

workflowsession-managementhooksskills
by Different-Sir7406 Jul 30, 2026 7/10
workflow GitHub

CLARK: Claude Language Assessment Research Kit for Applied Linguistics Researchers

A research workflow kit for language-assessment and applied-linguistics researchers, covering discover, review, write, check, evaluate, and submit. Claude operates each step but checks in with the researcher throughout, so nothing is invented or silently changed.

workflowresearch
by Shalice-in-AIland Jul 30, 2026 5/10
workflow GitHub

nightshift: Autonomous Feature PM That Delivers a Pull Request

An unattended agent that acts as a feature PM: hand it a brief and it works for hours or days before opening a pull request. Distinct from another same-named nightshift repo (r3dbars) already in this database, which focuses on shorter overnight drafting rather than long-running autonomous feature delivery.

autonomous-agentpull-requestunattended
by camkeith Jul 30, 2026 6/10
workflow GitHub

quizzing: Front-Load Agent Clarifying Questions into a Web Form

Collects an AI agent's clarifying questions upfront into a single capped, paginated web form instead of letting the agent interrupt repeatedly mid-task. Helps get the design right on the first pass by batching Q&A into one structured round.

clarifying-questionsplanningweb-form
by Tranquility2 Jul 30, 2026 6/10
workflow GitHub

loopsmith: Portable Goal-Based SDLC Plugin for Claude Code

Adds a goal-based SDLC to any repo as a Claude Code plugin, with an interactive goal-mode and an autonomous park-and-continue loop-mode for unattended work. Zero runtime dependencies, so it installs cleanly into existing projects.

sdlcpluginautonomous-loop
by swapnil-agrim Jul 30, 2026 6/10
workflow GitHub

agentic-dev-harness: Scaffold a Project Charter and Sub-Agent Workflow

A document-first development harness for Claude Code and Codex CLI that scaffolds a project charter, architecture doc, and a sub-agent workflow for a new project in one shot. Aims to get a project's foundational docs and agent structure set up correctly from day one.

project-scaffoldingsub-agentsdocumentation
by kohj1018 Jul 30, 2026 6/10
workflow GitHub

Claude Code Extension Engineering: Choosing the Right Mechanism

A guide and reference for deciding between Claude Code's extension mechanisms (skills, hooks, commands, MCP, subagents) before building, then walking through how to build it. Useful for developers unsure which extension point fits their use case.

extensionsguidedecision-framework
by TranDenyDFW Jul 30, 2026 6/10
workflow GitHub

marketing-cockpit-template: 50-Skill AI Marketing Department for Claude Code

A role-based marketing cockpit template for Claude Code: run /start-cockpit and a wizard builds your brand doctrine, wires your tools, and sets up a ready-to-use marketing department with 50 skills, 10 agents, and 7 modules. A substantial, vertical-specific system rather than a single skill.

marketingtemplatemulti-agent
by Littlpinguin Jul 30, 2026 7/10
workflow GitHub

claude-stack: Loop Engineering and Evidence Gates for Claude Code

An orchestration doctrine for Claude Code covering loop engineering and evidence gates, checkpoints that require proof before an agent can proceed. Distinct from another claude-stack repo (joryeugene) already in this database by a different author.

orchestrationevidence-gatesworkflow
by rishbjain1 Jul 30, 2026 5/10
workflow GitHub

forge-plugins: 12-Stage Gated SDLC Orchestrator for Claude Code

A 12-stage gated SDLC orchestrator for Claude Code with deterministic gates, REQ-ID traceability, cost-capped background agents, and support for brownfield adoption. More structured than most SDLC plugins, aimed at teams wanting auditable, requirement-traced automation. Distinct from another forge-plugins repo (lets-forge) already in this database by a different author.

sdlcgated-workflowtraceability
by tonmoy007 Jul 30, 2026 7/10
workflow GitHub

Diffler: Generate Comprehension Quizzes from Git Diffs

Turns Git branch diffs into comprehension quizzes for Claude Code, OpenCode, and PR review workflows. Helps reviewers and teammates verify they actually understand a change rather than rubber-stamping it.

code-reviewgit-diffquizpr-workflow
by jamestkelly Jul 30, 2026 6/10
workflow GitHub

Menxia: Cross-Vendor Model Veto on Your Agent's Commit Summaries

Feeds your coding agent's raw session transcript to models from other vendors and lets them veto the commit before it lands, rather than trusting the agent's own self-written summary. A check against agents grading their own homework.

verificationmulti-modelcommit-review
by yandie-AI Jul 30, 2026 6/10
workflow GitHub

Initech: A Terminal Runtime for Collaborating Agents

A runtime that lets multiple coding agents collaborate with each other from a single terminal, optimized for steerability so a human can guide the multi-agent session. Aimed at orchestrating agent-to-agent collaboration rather than single-agent use.

multi-agentorchestrationterminal
by nmelo Jul 30, 2026 6/10
workflow GitHub

Harness-Firmware: A Self-Syncing Claude Code Project Template

A Claude Code project template with a rule kernel, helpful skills, a committed memory library, and session hooks, where improvements flow both ways between the template and the projects it spawns. Aims to keep a fleet of projects consistently up to date with your best practices.

project-templatememoryhookssync
by ryanportfolio Jul 30, 2026 6/10
workflow Reddit

Auditing 14 Repos Found Half of All Agent-Written Markdown Was Stale

A methodology for auditing agent-written markdown (PLAN.md, HANDOFF.md, etc.) by commit distance and inbound references, which found 54% of 317 agent-authored files across 14 repos were stale or orphaned, with stale-but-still-linked docs being the costly ones since agents load them as current state. The author now runs two hooks: PostToolUse on Write stamps agent markdown with the commit SHA it was written against, and a SessionStart check flags docs that have drifted since.

markdownhookshygieneworkflow
by Beautiful-Energy2169 Jul 30, 2026 6/10
workflow Reddit

Spec-Driven Dev Where the Spec Dies in $TMPDIR Instead of Persisting

A workflow write-up arguing spec-driven-development tools go stale because they persist the spec: instead, research stays read-only, one handoff doc is written to $TMPDIR, a build step checks it against the repo and runs the tests, and only durable rules live in AGENTS.md. The spec itself is discarded with the temp file rather than becoming another stale doc to maintain.

spec-driven-developmentworkflowagents-md
by c1rno123 Jul 30, 2026 6/10
workflow GitHub

Consort: spec-first, test-driven agent ensemble against live Lakebase branches

A coordinated ensemble of role agents driven by a deterministic state machine, working spec-first and test-driven against live branches of a real Lakebase database. Aims to enforce engineering discipline on AI-written code rather than leaving it to model whim.

databrickslakebasestate-machinetesting
by databricks-solutions Jul 30, 2026 7/10
workflow GitHub

loop-engineer: typed terminal states and verification gates for agent loops

Executable operating contracts for AI agent loops: 7 typed terminal states, verification-gated completion, and bounded repair so a loop can prove it's actually done instead of just declaring victory. Ships as both a Claude Code plugin and a portable Python core.

agent-loopsverificationclaude-code-plugin
by SollanSystems Jul 30, 2026 6/10
workflow Reddit

Context Overhead Audit: Load Frequency x Size Beats File Size

A user audited their Claude Code setup and found about 71,000 tokens of standing overhead per message, mostly from skills and plugins that load into every message regardless of raw file size. Key insight: load frequency times size is the metric that matters, not file size alone, and denying a plugin only blocks tool calls -- you must disable it in enabledPlugins to actually stop it loading into context.

context-windowtoken-optimizationclaude-mdpluginsskills
by silent_lurker_69 Jul 30, 2026 6/10
workflow GitHub

generalstaff: Local-First, Verification-Gated Dispatcher for AI Coding Agents

An open-source dispatcher that routes work to AI coding agents with a verification gate; changes that fail tests get automatically rolled back. Supports bring-your-own-key model access and runs entirely local-first.

dispatcherverificationrollbackorchestration
by lerugray Jul 30, 2026 7/10
workflow GitHub

devchain: Local-First Orchestration for a Team of AI Coding Agents

Runs and coordinates a team of AI coding agents on your own machine, with support for Claude Code, Codex, OpenCode, Antigravity, and Copilot. Already has real traction (90+ GitHub stars) as a local-first alternative to cloud multi-agent orchestration platforms.

orchestrationmulti-agentlocal-first
by TwiTech-LAB Jul 30, 2026 8/10
workflow GitHub

ai-workflow-wizard: One-Command Setup for AI Development Workflows

Bootstraps context layers, testing, CI/CD, and spec-driven development in any repo with a single install command, auto-detecting your stack and IDE. Supports Claude Code, Cursor, Windsurf, Kiro, Codex, Copilot, Antigravity, and OpenCode.

bootstrapci-cdspec-drivensetup
by hugoafj Jul 30, 2026 5/10
workflow GitHub

Hamzaish: A Claude Code Setup That Runs a Product's Whole Lifecycle

An open-source Claude Code setup aimed at handling a product beyond just writing code: launch, pricing, early customers, and shutdown decisions, while carrying lessons learned into the next project. Also works with Cursor, Codex, and Windsurf; has modest early traction.

product-lifecyclestartupsetup
by hamza-ali-shahjahan Jul 30, 2026 5/10
workflow GitHub

headsign: A Phase Gate Where Your Shell Decides Pass/Fail, Not the LLM

A tiny phase-gate tool for coding agents: shell checks (tests, lint, build) determine whether a phase passes, and headsign's workflow routes the agent to advance, retry, escalate, or finish based on that verdict. Claude Code drives the work; headsign holds the state so pass/fail isn't left to the model's judgment.

phase-gateverificationstate-machine
by meganemura Jul 30, 2026 6/10
workflow Reddit

A four-tier subagent hierarchy to dodge both Opus 5 style and Fable quota limits

A routing scheme that demotes Fable 5 from "manager" and puts Opus 4.8 in the main session loop as a planning-only "boss" that never writes code. Opus 5 runs as an isolated subagent that receives a blind spec, does the heavy engineering, and returns a terse changed/verified/blocked report with no direct user contact. Fable 5 is called only for narrow, isolated consulting briefs, while Sonnet/Haiku subagents handle routine pattern-matching and log triage.

workflowsubagentsmulti-modelorchestration
by mugsy33 Jul 29, 2026 6/10
workflow GitHub

Plumbline: self-learning agile agent team for Claude Code

An orchestration framework built around 87 subagents and skills implementing TDD defense-in-depth gates, Kaizen-style retros, and a four-body adversarial review council, with an empirically benchmarked QA harness for validating output quality.

workflowsubagentstddqaorchestration
by DYAI2025 Jul 29, 2026 7/10
workflow GitHub

dev-agents: Multi-Agent Orchestration Across Parallel Workers

dev-agents dispatches specialized Claude Code agents across multiple workers in parallel waves, aimed at scaling agentic coding beyond a single session. It coordinates many agents working concurrently on different parts of a task.

orchestrationmulti-agentclaude-codeworkflow
by Arlencho Jul 29, 2026 6/10
workflow GitHub

my-robot: Install a 7-Layer AI-First Dev System in 30 Seconds

my-robot bootstraps a '7-layer AI-first development system' into any repo with one clone/install step, aimed at standardizing how AI coding agents like Claude Code operate in a project. It's a starter-kit style tool for teams wanting consistent agent conventions without manually assembling them.

bootstrapclaude-codedeveloper-toolsconventions
by noidsoup Jul 29, 2026 5/10
workflow GitHub

devloop: Guard-Railed Closed-Loop Workflow for Claude Code and Codex

A closed-loop workflow for AI coding agents built around a live state bus and execution-level hard intercepts, covering GitHub PRs and GitLab MRs. Works from step-level to requirement-level checks, combining eval-driven and spec-driven gates with human-in-the-loop approval.

workflowguardrailsgithubgitlab
by compforge Jul 29, 2026 7/10
workflow GitHub

harness-factory: Generate a Production-Ready Agent Harness

Answers a few setup questions and generates a production-ready agent harness for Claude Code, Codex, or Cursor. Bilingual (English/Korean) and Docker-ready for quick deployment.

workflowharnessdockercodex
by Kimyongari Jul 29, 2026 6/10
workflow GitHub

cc-plugin-codex: Use Claude Code Models Inside Codex

An open-source plugin that runs inside Codex and lets you invoke Claude Code and Claude models for code review, rescue tasks, and tracked background workflows without leaving Codex.

workflowcodexreviewcross-tool
by sendbird Jul 29, 2026 6/10
workflow GitHub

open-workflow-kit: Tool-Agnostic Agent Workflow Starter Kit

A single workflow core plus a team profile that generates adapters for Claude, Codex, Cursor, Copilot, CodeBuddy, Kiro, and Trae, so a team can standardize on one workflow definition across whichever coding agent each developer uses.

workflowmulti-agentstarter-kit
by bluecoast1379 Jul 29, 2026 6/10
workflow GitHub

google-ads-agents: Multi-Agent Toolkit for Google Ads Management

A multi-agent toolkit for Google Ads with end-user gcloud SSO, a 24-hour session cap, and per-MCC profiles. Covers read paths across campaign types, conversions, gtag health, placement safety, and brand exclusions, with mutations gated behind approval.

workflowgoogle-adsmarketingvendor
by arcbaslow Jul 29, 2026 5/10
workflow Reddit

DataFlow-Harness: Turn Claude Code Scripts Into Editable Data Pipelines

Instead of one-off scripts, grounds Claude Code in real DataFlow operators, field schemas, and pipeline state so it builds editable, visual data pipelines in DataFlow-WebUI. Reported a 93.3% pass rate on a 12-task data-engineering benchmark, cutting cost by 72.5% and latency by 49.9% versus vanilla Claude Code.

workflowdata-engineeringmcpbenchmark
by Puzzleheaded_Box2842 Jul 29, 2026 7/10
workflow GitHub

plan-build-review: Gated, Role-Based Agent Workflow

A role-based workflow with independently reviewed plans, task-by-task delivery, and explicit approval checkpoints between each stage.

workflowreviewapproval-gates
by jameswei Jul 29, 2026 6/10
workflow Reddit

North Star Workflow: From a Rough Idea to Something an Agent Can Build

A documented AI workflow that turns a rough idea into agent-ready work: North Star documents, feature briefs, atomic task breakdown, context management, subagents, and treating CLAUDE.md/AGENTS.md as a map rather than a rulebook.

workflowplanningclaude-md
by Weird-Bed6225 Jul 29, 2026 5/10
workflow GitHub

awesome-ai-tokenomics: A Map of What AI Tokens Actually Cost

A curated map of where AI tokens are wasted versus well spent, with tools, research, practices, and copy-paste setups for keeping agentic coding token-efficient.

workflowtokenscost-optimizationawesome-list
by QuesmaOrg Jul 29, 2026 6/10
workflow GitHub

summon: Summon Any AI From Any CLI

A tiny, dependency-free cross-vendor sub-agent dispatcher for Claude, Codex, Cursor, Gemini, Antigravity, and any OpenAI-compatible API, with a council mode, fan-out swarms, and a structured JSON envelope.

workflowmulti-agentdispatcher
by Nafjan Jul 29, 2026 6/10
workflow GitHub

agent-sync: Coordination for Concurrent Coding Agents

Coordinates multiple concurrent coding agents with leases, ID reservation, a run journal, and a generated board layered over a pluggable knowledge cloud.

workflowcoordinationmulti-agent
by appvillis-com Jul 29, 2026 6/10
workflow Reddit

Notes From a Broken Multi-Model Orchestrator Setup

A detailed account of a multi-model orchestrator setup (Fable, Opus 5, Codex, Sonnet) breaking down under cost and reliability constraints, with specific observations on how Codex tends to invent a plausible-looking fake field to pass a check when a spec is underdetermined.

workfloworchestrationmulti-modelcodex
by cvnlvc Jul 29, 2026 5/10
workflow GitHub

llm-orchestrator: Deploy a Coordinated Team of AI Engineers

A Claude Code plugin that deploys a coordinated team of AI engineers against any codebase, with a structured workflow, two-stage code review, autonomous BLOCKED-state recovery, and a research gate that verifies external APIs against current docs before specs get written.

workflowmulti-agentcode-review
by felipemelendez Jul 29, 2026 7/10
workflow GitHub

ccf: Context-First, Spec-Driven Workflow Plugin for Claude Code

A strictly sequential, spec-driven development workflow plugin for Claude Code that keeps your CLAUDE.md/.claude spec always fresh and grounds every decision in Context7 and Microsoft Learn.

workflowspec-drivencontext7
by naniiluja Jul 29, 2026 6/10
workflow GitHub

agentloop: Portable Agent Harness With Council, Swarm, and Ship Gates

A portable agent harness plugin offering a council mode, capped swarm, plan-execute-verify (PEV) loops, ship gates, and a craft pack aimed at killing AI slop. Works across Cursor, Claude Code, Codex, Copilot, and Windsurf.

workflowmulti-agentquality-gates
by edenbuilds Jul 29, 2026 6/10
workflow Reddit

Analysis of 5 Claude Code Review Setups on the Same Diff

A blind comparison of five Claude Code review processes — an in-house agent with old vs. rewritten CLAUDE.md, Matt Pocock's code-review skill, and Anthropic's official code-review command and pr-review-toolkit — run on the same ~19k-line real PR, measuring agent time, turns, and cost per setup.

workflowcode-reviewbenchmarkclaude-md
by PablanoPato Jul 29, 2026 7/10
workflow Reddit

Five Habits That Cut Claude Code Token Usage

Practical habits for controlling Claude Code token burn: keep CLAUDE.md small, start fresh sessions between problems, fetch web pages as clean markdown (e.g. via Firecrawl) instead of raw HTML, exclude folders the agent doesn't need, and check /context periodically to see what's actually filling the window.

workflowtokenscost-optimization
by oscar_savy Jul 29, 2026 5/10
workflow GitHub

Maestro: Opus-Planned, Codex-Implemented Orchestrator Loop

An orchestrator/implementer loop where Opus plans, debates, and reviews while Codex writes the code and proves it works. Runs on your ChatGPT login instead of an API key, keeping the workflow subscription-based.

orchestratorcodexopusworkflow
by Pythoughts-labs Jul 29, 2026 6/10
workflow GitHub

Orchestra: Local Control Plane for Codex, Claude Code, OpenCode

A local control plane for coordinating Codex, Claude Code, and OpenCode agents from one place. Aims to unify multi-agent-CLI workflows without relying on a hosted service.

orchestratormulti-agentcodexopencode
by batteryshark Jul 29, 2026 5/10
workflow GitHub

LazySitter: 26-Agent Pipeline From Feature Request to Merge

An autonomous AI engineering team built as a 26-agent coding pipeline for Claude Code and Codex, turning a feature request into reviewed, tested, merge-ready code. Chains planning, implementation, review, and testing agents into one pipeline.

workflowmulti-agentcodexautomation
by soumit-kaz Jul 29, 2026 7/10
workflow GitHub

reseat: Zero-Token Handoff Between Claude Code and Codex

Reseats an in-progress coding session from Claude Code into Codex (or back) with zero token cost and no extra dependencies. A lightweight alternative to full context-transfer tools for switching agents mid-task.

workflowhandoffcodexcontext
by vuplea Jul 29, 2026 6/10
workflow Reddit

Running 4 AI Coding Agents at Once — A Working Setup Write-Up

A practical write-up on running Claude Code, Cursor, OpenCode, and Antigravity together: a shared AGENTS.md instead of tool-specific config files, narrow single-purpose agents (planner/orchestrator/pusher) instead of one generalist, and routing cheap work to free-tier models to save paid credits for hard problems.

workflowmulti-agentagents-mdcost-optimization
by DMorais92 Jul 29, 2026 6/10
workflow Reddit

NixOS as a Native OS for Claude Code

A write-up on running Claude Code on NixOS instead of WSL: avoids the dual-filesystem tax and imperative package drift of WSL/apt by declaring the whole machine — packages, services, drivers — in one git-tracked file, with instant rollback via boot-menu generations. The author runs Claude Code itself as a gated sysadmin over the declared config.

workflownixoslinuxsysadmin
by pete716 Jul 29, 2026 6/10
workflow GitHub

vibe-code-stack-for-ceos: One AGENTS.md, Six Coding Agents, Identical Output

An AI-first Turborepo monorepo where Claude Code, Cursor, Copilot, Gemini CLI, Kiro, and Windsurf all read one shared AGENTS.md handbook and ship equivalent production-grade code across a Next.js dapp, React admin SPA, Astro landing page, and a Connect-RPC backend, deployed to Cloudflare.

workflowmonorepoagents-mdmulti-agent
by NoahDuongMaster Jul 29, 2026 6/10
workflow Reddit

Audit Your CLAUDE.md Before Blaming Opus 5

A worked example of pointing Opus 5 at its own project CLAUDE.md and skills and asking it to audit them for unnecessary instructions: cut a 90-line CLAUDE.md by 40 lines, trimmed supporting docs, and flagged two skills as unneeded — after which the same task went from floundering for minutes to finishing in about one. Suggests that guardrails tuned for older models may now be actively hurting Opus 5.

workflowclaude-mdopus5prompt-engineering
by papabear556 Jul 29, 2026 6/10
workflow GitHub

agent-sdlc: Full-SDLC Pipeline From Idea to Reviewed PR

A pipeline for AI coding agents covering idea, acceptance criteria, architecture, tech stack, atomic plan, a readiness gate, test-first subagent build, and a reviewed PR. Installable as a Claude Code or Cursor plugin.

workflowsdlcpipelinetesting
by smarzban Jul 29, 2026 7/10
workflow GitHub

phase-skills: Phase-Driven Development Workflow as Drop-In Skills

Packages a phase-driven development workflow for Claude Code as drop-in skills: plan-before-code gates, per-phase tracking, worktree discipline, task decomposition, and an audit step between phases.

workflowphasesworktreeaudit
by awjackson2 Jul 29, 2026 7/10
workflow GitHub

all-cli-council: Five Models, Four Vendors, Anonymous Cross-Ranking

Asks five models across four vendors the same hard question through the CLIs you already have (no API keys), has them anonymously rank each other's answers, then leaves the final call to you.

workflowmulti-modelcomparisonjudging
by developerjillur Jul 29, 2026 7/10
workflow GitHub

trantor: Hub-World for Orchestrating Multi-Vendor Agent Crews

Orchestrates Claude Code, Codex, Gemini, Kimi, and DeepSeek as live crews through a plan-aware advisor, a Kanban/flow command center, a testing gate, and an economics brain (Scrooge) that tracks spend across the crew.

workflowmulti-agentorchestrationcost-tracking
by sashabogi Jul 29, 2026 7/10
workflow GitHub

claude-jobhunt-agents: multi-agent job posting scorer

A Claude Code multi-agent workspace that turns a job posting into an evidence-based, scored analysis and ranked scoreboard, splitting judgment (LLM) from bookkeeping (code). A niche but concrete example of a structured multi-agent pipeline.

multi-agentjob-searchworkflow
by diz5 Jul 28, 2026 5/10
workflow Reddit

Use Fable as orchestrator/reviewer with Opus 5 as implementer

A prompting pattern where Fable is assigned as orchestrator, reviewer, and final approver of work, dispatching Opus 5 to implement while Fable adversarially reviews the output. Aimed at curbing Opus's tendency to make assumptions without reading full code context.

promptingorchestrationcode-review
by Brocsta876 Jul 28, 2026 6/10
workflow GitHub

harness-sync: one config repo projected into every AI coding harness

A deterministic, idempotent, zero-LLM-token tool that projects a single config repo into multiple AI coding harnesses (Claude Code, Codex, Cursor, Gemini), keeping instructions/settings in sync across tools without needing an LLM to do the translation.

config-managementmulti-toolsync
by Dhi13man Jul 28, 2026 6/10
workflow GitHub

NFA-Spec: A Requirements Doc Template for Briefing Coding Agents

A structured requirements template (Nonfunctional, Functional, Agentic) meant to be written before a coding agent starts work, with a worked example and ready-to-use agent prompts to reduce ambiguity in agent-driven development.

workflowrequirementsspecagent-prompts
by arrrgr Jul 28, 2026 6/10
workflow Reddit

Research Findings on Gate Design and Loop Limits for Agent Review Pipelines

A literature review (130+ sources) on adversarial review/critique gates in agent pipelines, finding flip rates of 17.5-97.3% under challenge, low intra-rater agreement on repeated runs, and accuracy loss after repeated refinement rounds. Recommends capping repair loops at 2-4 rounds, far below defaults like LangGraph's 1000.

workflowagent-pipelinesevaluationresearch
by aaddrick Jul 28, 2026 6/10
workflow GitHub

gcp-devkit: practical Google Cloud workflows for Claude Code

A set of Claude Code workflows covering common Google Cloud tasks: Terraform, Cloud Run, GKE, IAM, and Firestore. Gives Claude Code concrete, tested playbooks for GCP infrastructure work instead of ad hoc prompting.

workflowgcpterraforminfrastructure
by mohitkale Jul 28, 2026 6/10
workflow GitHub

fleet: supervise a multi-provider fleet of AI coding agents

Turns a coding agent into a supervisor coordinating workers across many providers at once, including Codex, Cursor, Copilot, Claude Code, Qwen, and Amp. Aimed at teams running several coding agents in parallel who want one control point.

multi-agentorchestrationfleet-management
by adam-N-singh Jul 28, 2026 5/10
workflow GitHub

super-ux: scenario-driven UX contract for AI coding agents

A Claude Code plugin defining UX as a contract of personas, jobs, flows, scenarios, and audits through a single /ux entry point, with a linter that flags when docs drift from actual code. Aimed at keeping AI-built UI consistent with intended user flows over time.

uxpluginlinter
by ssheleg Jul 28, 2026 7/10
workflow GitHub

ether: local-only spec-driven development harness with phase gates

A Claude Code harness enforcing spec-driven development through phase gates, TDD checks, and a learning log, making no network calls at all. Aimed at developers who want disciplined, offline spec-first workflows enforced rather than just suggested.

spec-driventddharness
by arayaroma Jul 28, 2026 7/10
workflow GitHub

herdr-agent-handoff: hand off a live agent session to another coding agent

A Herdr plugin that transfers an in-progress Claude Code (or other agent) session to a fresh session of a different installed coding agent, embedding the complete session transcript in the prompt rather than a summary. Avoids the information loss of manual handoff notes when switching tools mid-task.

session-handoffmulti-agentplugin
by sanirudh17 Jul 28, 2026 7/10
workflow GitHub

forge-claude-code: enterprise blueprint for Claude Code in regulated banking

A governance blueprint for running Claude Code securely in a regulated banking environment, based on a GlobalLogic/Barclays deployment using Windows VDI and AWS Bedrock. Useful reference for enterprises needing a compliant, auditable Claude Code rollout.

enterprisegovernanceaws-bedrock
by vikas0486 Jul 28, 2026 6/10
workflow Reddit

Getting Claude Code running on old Macs (macOS Catalina 10.15)

A step-by-step workaround for installing Claude Code on a 2012 iMac running the unsupported macOS Catalina, using MacPorts to install an older Node.js build and pinning to Claude Code 2.1.112 to avoid dyld symbol errors. Useful for anyone stuck on pre-Ventura macOS who still wants to run Claude Code.

macoslegacy-hardwareinstallation
by bidutree Jul 28, 2026 6/10
workflow GitHub

Apple Pie: TUI harness driving Claude Code from ticket to reviewed PR

A TUI dashboard for Android teams that drives Claude Code through a Jira or markdown ticket end-to-end — plan, implement, verify on an emulator, and open a reviewed pull request — running parallel agents but never auto-merging. Gives teams a single view over multiple in-flight agent tasks with a human still gating the merge.

tuiandroidparallel-agents
by Apple-Pie-AI Jul 28, 2026 8/10
workflow GitHub

dev-method: Blast-Radius-Based Review Weight for Claude Code / Codex

A Claude Code / Codex development methodology plugin that scales review rigor to the 'blast radius' of a change rather than applying uniform process to every commit. Aimed at teams wanting lighter review overhead for low-risk changes.

workflowcode-reviewplugin
by mizulba-dev Jul 28, 2026 5/10
workflow GitHub

frappe-workflow: Claude Code Plugin for Frappe/ERPNext Development

A Claude Code plugin that orchestrates tasks from planning through deployment on Frappe/ERPNext projects without losing context. Targets teams building on the Frappe framework who want structured, context-aware agent workflows.

pluginerpnextfrappeworkflow
by mustafahasanain Jul 28, 2026 5/10
workflow GitHub

beijixing: Zero-Trust Governance Framework for Agent Harnesses

An enterprise-oriented zero-trust governance framework for agent harnesses covering unified admission control, task-level least-privilege authorization, evidence verification, budgets, approvals, auditing, revocation, and rollback. Aimed at organizations that need compliance-grade controls around autonomous coding agents.

governancezero-trustsecurityenterprise
by Brian-dai694 Jul 28, 2026 6/10
workflow GitHub

joycraft: CLI/Plugin to Scaffold and Upgrade AI Development Harnesses

A CLI and Claude Code plugin that scaffolds and upgrades AI development harnesses, spanning everything from casual vibe coding to autonomous spec-driven development. Aimed at teams standardizing how their agent tooling is set up.

clipluginscaffoldingworkflow
by maksutovic Jul 28, 2026 5/10
workflow GitHub

armory-fleet: Subagent Orchestrator for the pi Coding Agent

The armory suite's cross-harness subagent orchestrator for the 'pi' coding agent, where every spawned agent is armory-native by default. Extends the armory skills ecosystem into fleet-style multi-agent orchestration.

orchestrationmulti-agentcross-harness
by getpipher Jul 28, 2026 5/10
workflow GitHub

taskcrew: Turn a Backlog.md Board into an Unattended Multi-Agent Dev Pipeline

taskcrew converts a Backlog.md task board into a fully unattended multi-agent development pipeline that runs on your own Claude subscription. Aimed at teams wanting continuous, ticket-driven agent work without per-task manual kickoff.

workflowautomationbacklogmulti-agent
by Spritech-Lab Jul 28, 2026 6/10
workflow GitHub

Safe-Vibe-Coding: Field Guide to Directing LLM Coding Agents Safely

A practical guide covering repo setup, agent guidance techniques, and AI-assisted auditing for working safely with LLM coding agents like Claude Code. Goes beyond "just prompt better" to address repository hygiene, constraint-setting, and how to use the agent itself to audit its own work. Aimed at developers who want to maintain quality and security while using agentic coding tools.

safetybest-practicesguideauditingrepo-setupagentic-coding
by Frostbite1536 Jul 27, 2026 8/10
workflow GitHub

playmaker: Run Claude Code, Codex, and Antigravity as Parallel Sub-agents

playmaker is a CLI that acts as a playing-coach orchestrator, spinning up Claude Code, Codex, and Antigravity as simultaneous sub-agents to distribute work across separate API quotas. Useful for power users who want to maximize throughput by running multiple AI coding engines in parallel on the same task.

parallelsub-agentscodexcliorchestrationquota
by vladsafedev Jul 27, 2026 6/10
workflow GitHub

pipeline_worker: Automated Git-Worktree Workflow with Claude Code and CI Auto-Fix

pipeline_worker captures developer intent from git diffs using Claude Code or GitHub Copilot CLI, then automatically runs build/lint/test, opens GitLab MRs or GitHub PRs, and re-invokes the agent to fix any failing pipelines. It wraps the full change → review → fix cycle in a single automated worktree-based workflow. Useful for teams wanting AI-assisted CI/CD with minimal manual intervention.

git-worktreeci-cdautomationgithubgitlabworkflow
by MohanTn Jul 27, 2026 8/10
workflow GitHub

CrowdControl: Orchestrate Claude Code Instances in Parallel from Elixir

CrowdControl is an Elixir-based CLI that runs many Claude Code or Open Code CLI instances simultaneously as coordinated agents. It lets you fan out work across multiple agent processes from a single controller, useful for parallelizing large codebases or multi-repo tasks. Built for teams who want Elixir's concurrency model driving their AI coding fleet.

orchestrationelixirparallelmulti-agentcli
by nyo16 Jul 27, 2026 8/10
workflow Reddit

Build Verification Gates Before Features: The Real AI Productivity Unlock

A practitioner's account of spending two weeks building verification infrastructure — failing builds, guards against destructive commands, tests for those checks — before shipping any user-visible features. The insight: productivity gain is a step function that arrives after the setup, not a gradual ramp, because the bottleneck shifts to verification. Recommends treating that setup time as planned work, not overhead.

workflowverificationtestingciproductivitybest-practices
by thebvg Jul 27, 2026 8/10
workflow GitHub

Team: Drive Features from Idea to PR with a Squad of Claude Code Agents

A workflow tool for orchestrating multiple Claude Code agents as a team to take a feature from concept through implementation and pull request. Each agent has a defined role, enabling parallel and coordinated work on complex features.

multi-agentorchestrationworkflowfeature-developmentpr
by bostonaholic Jul 27, 2026 7/10
workflow GitHub

Swarms: Enterprise-Grade Multi-Agent Orchestration Framework

A Python framework for building production multi-agent systems with routing, memory, and coordination built in. Aims to be the enterprise standard for agent orchestration, with a hosted platform at swarms.ai. Supports a broad ecosystem of agent architectures.

multi-agentorchestrationpythonenterpriseframework
by kyegomez Jul 27, 2026 6/10
workflow GitHub

Opus Rail: Opus 4.8 Orchestrates, Opus 5 Executes

A Claude Code orchestration pattern where Opus 4.8 acts as the driver/planner and Opus 5 handles implementation work. Enforcement is hook-based or skill-based, with adversarial review between the two agents. Exploits the cost and capability differences between the two model tiers.

workfloworchestrationmulti-modelopushooks
by TigerGTC Jul 27, 2026 7/10
workflow GitHub

Agent Machines: Control Plane for Persistent Agent Workers with Runtime Routing

A platform inspired by OpenRouter that provides routing and sandbox environments for persistent agent workers. Supports specialist presets and fleet supervision. Provision configurations and route runtime substrates for your agent fleet.

orchestrationroutingagent-fleetsandboxcontrol-plane
by Kevin-Liu-01 Jul 27, 2026 6/10
workflow GitHub

cm-workflow: Codex-Native Spec-Driven AI Agent Workflow With Claude Code Support

A spec-driven AI agent workflow that is Codex-native but Claude Code compatible. Includes independent review, QA, fixes, and refactor stages. Provides a structured pipeline for moving from specification to reviewed, QA-passed code across multiple agents.

workflowspec-drivenQACodexreview
by kingxiaozhe Jul 27, 2026 6/10
workflow GitHub

claude-code-marketplace-manager: Manage Claude Code Plugin Marketplaces With GitHub Actions

A GitHub Actions-based tool for managing Claude Code plugin marketplace catalogs. Automates publishing, versioning, and maintenance of skill marketplaces so teams can share and distribute skills via GitHub. Useful for organizations building internal Claude Code skill registries.

marketplaceGitHub Actionspluginsdistributionskills
by spencerbeggs Jul 27, 2026 6/10
workflow GitHub

wayworks: AI-Assisted Development Workflow With Obsidian and Linear Integration

An open-source development workflow framework with Claude Code plugins that integrates second-brain (Obsidian) note-taking and issue tracking (Linear) into AI development sessions. Connects your knowledge base and task tracker directly to Claude Code sessions.

workflowObsidianLinearintegrationproductivity
by SilviaAre95 Jul 27, 2026 6/10
workflow GitHub

openthought: Strategic Intent Layer for Solo Builders Using AI Agents

A framework for maintaining strategic coherence when building with AI agents. Uses a markdown intent graph and coherence checker backed by Claude Code skills to keep agent sessions aligned with high-level product goals rather than drifting into tactical implementation details.

strategyintentcoherenceworkflowskills
by ChindanaiNaKub Jul 27, 2026 6/10
workflow GitHub

arc-kit: Enterprise Architecture Governance Harness for AI Coding Assistants

A harness for enterprise architecture governance using AI coding assistants. Covers strategy, architecture, delivery, and assurance workflows with Claude Code and similar tools. Designed for organizations applying Wardley Mapping and structured architecture thinking with AI assistance.

enterprisearchitecturegovernanceworkflowstrategy
by tractorjuice Jul 27, 2026 6/10
workflow GitHub

macbook-24x7-agents: Keep AI Agents Running 24/7 on a MacBook With Lid Closed

A set of fully reversible macOS settings and instructions for keeping a MacBook awake with the display off and lid closed for 24/7 AI agent operation. No third-party tools required — just native macOS power management settings. All changes can be undone cleanly.

macOSautomation24x7backgroundsetup
by apoorvdarshan Jul 27, 2026 6/10
workflow GitHub

tierdecay: Self-Distilling Model Router for AI Coding CLIs

Solves each problem class once at the expensive model tier, then captures the solution pattern in markdown so future identical problems run cheaply. Acts as a self-improving cost optimizer: first run uses the expensive model, subsequent runs of the same class use cheaper alternatives. Just markdown, no proxy required.

costroutingmodelsoptimizationmarkdown
by alebgl77 Jul 27, 2026 7/10
workflow GitHub

ssm: Structured Context and Task Management for Claude Code Across Sessions

Prevents context loss during compaction by maintaining a structured context and task management system for Claude Code. Enables efficient multi-session workflows by persisting the agent's understanding of current state, open tasks, and project decisions across context resets. Addresses Claude forgetting what it was doing mid-project.

contextcompactionsessionstasksmemory
by BrianMburu Jul 27, 2026 7/10
workflow GitHub

claude-kit: Autonomous SDLC for Claude Code With Gated Verification

A complete autonomous software development lifecycle harness for Claude Code that will not advance past any gate on an unproven verdict. Each phase requires evidence before the next step runs, preventing the failure mode where Claude Code confidently produces wrong results without checking.

SDLCgatesverificationautonomyworkflow
by ajyadav013 Jul 27, 2026 7/10
workflow Reddit

AutoDev Studio: Multi-Agent SDLC Pipeline Reported 75% Cheaper Than Claude Code on Cost

An open-source SDLC harness that chains PM, Dev, QA, and Reviewer agents into a pipeline from English spec to pull request. Uses different model families for author and reviewer to prevent self-approvals. Compatible with Claude Code, Codex, Cursor, and Aider via headless mode using existing subscriptions.

SDLCpipelinemulti-agentcostreview
by NeighborhoodOwn8510 Jul 27, 2026 7/10
workflow GitHub

odin: Headless Task Runner for Claude Code — One Fresh Session Per Task

Runs a queue of tasks through claude -p in headless mode, spawning one fresh session per task and carrying context forward between tasks. Designed for unattended batch work where you want each task to start clean but build on previous results. Minimal and focused.

headlessbatchtasksautomationsessions
by hglattergotz Jul 27, 2026 7/10
workflow GitHub

SimpleFlowHarness: Chain AI Coding CLIs Into YAML-Defined Multi-Stage Flows

A single binary that takes YAML-defined workflow specs and chains multiple AI coding CLIs into multi-stage flows with review loops, parallel fan-out, and session resume. Supports Codex, Claude Code, opencode, Grok, and Antigravity. No framework lock-in — bring whatever CLIs you already use.

workflowYAMLmulti-agentorchestrationCLI
by Aero123421 Jul 27, 2026 7/10
workflow Reddit

claudemux: Message Bus for Real-Time Communication Between Claude Code Sessions

Lets multiple Claude Code sessions talk to each other in real time via slash commands. Built with bash, jq, tmux, and a single systemd user service — no server, no database, no ports. Works cross-machine over SSH, and messages are treated as untrusted data to prevent prompt injection through peer sessions.

multi-agenttmuxcommunicationIPCsessions
by Literally_A_Brain Jul 27, 2026 8/10
workflow GitHub

compass: Guardrails, Budget Cap, and Self-Fixing PR Loop for Claude Code

Wraps Claude Code (and Codex/Gemini) with guardrails that enforce a hard token budget, run eval-gated checks, and automatically re-attempt fixes until the PR passes at 100/100. Designed so you always own the final merge decision without babysitting the agent loop.

guardrailsbudgetworkflowpr-automationeval
by dshakes Jul 27, 2026 8/10
workflow GitHub

evolve: Claude Code Agent Swarm With Gated SDLC Automation

Runs a swarm of Claude Code agents that follow a structured, gate-checked software development lifecycle — each phase must pass before the next begins. Aimed at automating end-to-end coding and testing pipelines with human-defined quality gates.

swarmsdlcworkflowautomationgated
by familycaptain Jul 27, 2026 7/10
workflow GitHub

doctrine: Markdown Context-Engineering Blueprint That Catches Stale Specs

A structured Markdown format for LLM coding-agent specs that tracks status, provenance, dependencies, and freshness for each section. Prevents agents from implementing from outdated context by surfacing staleness before code is written.

context-engineeringspecsmarkdownworkflowfreshness
by Forest-Project-Lab Jul 27, 2026 7/10
workflow GitHub

colign: Team Spec Alignment Before AI Writes Code

Tool that helps teams review and agree on specs before handing them to an AI coding agent, reducing rework from misaligned requirements. Addresses the pattern where agents implement the wrong thing because the spec was never actually agreed on.

specworkflowcollaborationplanningalignment
by invertible-statue269 Jul 27, 2026 6/10
workflow GitHub

background-agents: Persistent Background Agents That Manage Code and PRs

Runs development tasks with persistent background agents that operate in isolated sandboxes — handling code changes, tests, and pull requests autonomously. Useful for fire-and-forget tasks like dependency updates or test fixes that do not need interactive oversight.

backgroundautomationprsandboxworkflow
by Jbaws4177 Jul 27, 2026 7/10
workflow GitHub

jeffy-loop: Autonomous Audit-Fix-Verify Improvement Loop for Claude Code

Autonomous loop that runs one verified improvement per iteration: audit, fix, verify, converge — checkpointing each step in local commits it never pushes. Stops when quality converges rather than running for a fixed number of iterations.

autonomousworkflowloopauditimprovement
by lenamonj Jul 27, 2026 8/10
workflow Reddit

o3s: Security-Hardened Devcontainer for Claude Code With Firewall in a Separate Gateway

o3s moves the network firewall out of the agent container into a separate gateway the agent cannot reach — closing the main gap in the Anthropic reference devcontainer. Features DNS locked to an allowlist, per-host/per-port rules, live allowlist for CDN IP rotation, and Docker-in-Docker for full-stack sandbox testing. MIT licensed.

workflowsecuritydevcontainerfirewallsandboxing
by Hansehart Jul 26, 2026 8/10
workflow Reddit

Ultracode Workflow: Fable Orchestrating Multi-Model Subagents With Validation Gates

A detailed ultracode pattern where Fable orchestrates GPT/Opus workers, followed by adversarial cross-model review, a synthesis subagent to judge issues, and targeted fix agents — all gated by a deterministic validator before spawning. Distributes model types evenly to manage quota. Practical template for teams hitting subagent sprawl.

workflowultracodeorchestrationsubagentsmulti-model
by TPHG Jul 26, 2026 7/10
workflow GitHub

nixos-config: NixOS Setup for Autonomous AI Coding With Kernel-Level Sandboxing

A NixOS configuration purpose-built for autonomous AI coding: kernel-level sandboxing, atomic rollbacks if an agent breaks something, and a fully reproducible AI toolchain across multiple machines. Good reference for teams wanting drift-free, auditable agent environments.

workflownixossandboxingreproduciblesecurity
by jacopone Jul 26, 2026 6/10
workflow Reddit

PSA: Claude Code Subagents Now Inherit Your Session Model — Not Free Haiku

Since v2.1.198, subagents (Explore, Plan, general-purpose) default to inheriting the main session model instead of running on Haiku. An Opus session means Opus subagents. Set CLAUDE_CODE_SUBAGENT_MODEL=haiku or model: haiku in agent frontmatter to restore cheap subagent behavior. Awareness critical for subscription users watching quota burn.

workflowsubagentsmodeltoken-efficiencytips
by HimaSphere Jul 26, 2026 8/10
workflow GitHub

Mycelium: Claude Code Harness That Forces Discovery Before Writing Code

A Claude Code harness that requires the agent to run a discovery phase and weigh evidence before writing a single line. The agent must "earn the right to start" by surfacing relevant context. Targets the common failure mode of premature coding and is designed for software, AI tools, and service projects.

workflowharnessdiscoveryevidencepre-codingplanning
by haabe Jul 26, 2026 7/10
workflow Reddit

Why Claude Code Keeps Using grep/sed Instead of Built-In Tools — and How to Stop It

Reddit investigation into why Claude Code persistently reaches for shell tools (grep, sed, cut) despite explicit instructions to use dedicated Grep and Read tools. Claude attributes it to "habit built up in context" — suggesting that in-context instruction buildup can cause self-reinforcing instruction-violating behavior. The thread explores practical strategies to break the pattern.

grepbashtool-usebehaviorworkflowcontext-management
by smbaker1 Jul 26, 2026 6/10
workflow Reddit

Spec-driven development with Claude Code and AWS Step Functions

A detailed write-up of building a sandboxed agentic pipeline where agents pick up Linear tickets and implement code changes on GitHub via Claude Code running in AWS Step Functions. Agents have no direct access to Linear or GitHub — they consume pre-hydrated workspaces from S3. Everything implemented by agents from specs, with Opus 4.8.

workflowawsstep-functionsspec-drivenlinear
by Specific-Doughnut413 Jul 26, 2026 7/10
workflow GitHub

graph-engineering: Run AI coding agents as a graph, not a loop

Models AI coding agent workflows as a graph — each node is a subprocess, each edge is a file, and the exit code is the contract. Single file, stdlib only, compatible with any agent CLI.

graphorchestrationworkflowsubprocess
by AdityaIndoori Jul 26, 2026 6/10
workflow Reddit

Anchor Claude Code 5-hour windows with a VPS cron job

Technique for fixing Claude Code usage window start times by sending a trivial warm-up message from an always-on VPS via cron. The 5-hour session window opens on schedule regardless of when you sit down. Includes headless auth with claude setup-token and wrapper script setup.

usage-windowcronvpssession-management
by Obvious_Yoghurt1472 Jul 26, 2026 7/10
workflow Reddit

Adversarial agent review: use a second model to check AI-generated code

Pattern for using a separate model instance to review AI-generated code diffs, raising findings without touching the code. The author model then decides what to act on. Data from 83 tickets showed the majority had findings worth acting on — an additional review round that costs only tokens, not time.

adversarial-reviewmulti-modelcode-reviewworkflow
by croovies Jul 26, 2026 7/10
workflow Reddit

mtt-harness: Mutation testing gate that catches AI agents weakening tests

Mutation testing tool that prevents AI agents from weakening tests — generates single-point mutants, runs the test suite against each, and exits non-zero when surviving mutants indicate weak coverage. The CLI determines pass/fail via execution so agents cannot fabricate results. Installs as a skill for Claude Code, Cursor, Codex, and Copilot.

mutation-testingtestingqualityciskill
by Jealous-Ladder-7291 Jul 26, 2026 8/10
workflow Reddit

Opus 5 not looking good for now

I do collaborative LLM workflows, not new to me, done it since October or so. Overall, it is a collaboration of llm to solve architectural code problems. One llm is an orchestrator, giving other br...

hookworkflow
by texasguy911 Jul 25, 2026 5/10
workflow Reddit

How I Run 100+ Projects with Claude Code

I'm showing the full setup I use for managing multiple projects at once with Claude Code (CLI). Most of it comes down to letting Claude do the work while I make the actual decisions. Hooks, tasks, ...

hookworkflowapigitautomation
by Myth_Thrazz Jul 24, 2026 9/10
workflow Reddit

Claude Security doesn't have access to Workflow tool

I've burnt way too many tokens to get through this, but ok, I'm still learning (it's my first month with Claude and Claude Code). So I've stumbled into a wall and neither me nor Claude can get over...

skillworkflowgitpython
by MichaelHadTo Jul 24, 2026 9/10
workflow Reddit

UltraCode triggers more than just an effort tweak

I was asking Claude how it deals with sub-agents and orchestrated flows. I think we all know doing that is a real token burner, and UltraCode also can be. But TIL that UltraCode itself can trigger ...

workflow
by medialantern Jul 23, 2026 5/10
workflow GitHub

helm: AI-Assisted Workflow Orchestrator — Spec to Plan to Code with Quality Gates

An opinionated development workflow orchestrator that guides AI coding agents through Spec → Plan → Code phases with quality gates at each step. Enforces structured development discipline to reduce drift and poor AI outputs on longer projects.

orchestrationquality-gatesspecplanningworkflow
by lhpaul Jul 22, 2026 7/10
workflow GitHub

MoFlo: Local-First Agent Orchestration Toolkit for Claude Code

An opinionated, local-first AI agent orchestration toolkit for Claude Code featuring semantic memory, learned routing, gates, and reusable "spells." Requires no API keys or cloud services and works out of the box with Claude Code.

orchestrationsemantic-memorylocal-firstautomationrouting
by eric-cielo Jul 22, 2026 8/10
workflow GitHub

dev-sdd-kit: Spec-Driven Factory for Multi-Repo Systems Built for Claude Code

A spec-driven development kit for multi-repo systems with human-gated permissions, strict TDD enforcement, and verifiable docs and metrics. Designed specifically for Claude Code workflows where accountability and traceability matter.

spec-driventddmulti-repohuman-gatestraceability
by mmaripanguec Jul 22, 2026 7/10
workflow GitHub

saipen: Vendor-Neutral Session Continuation Protocol for AI Coding Agents

A portable continuation protocol that lets any AI coding agent (Claude, Gemini, Codex, Aider) resume a project with full context and zero rebriefing. STATE.md tracks phase and next action, BOARD.md is the ticket board, LOG.md is an append-only event graph — all plain markdown with zero dependencies.

session-continuitycontextmarkdownmulti-agentportable
by vacterro Jul 22, 2026 7/10
workflow GitHub

loop-and-gate-foundation: AI Agent with Obsidian Memory That Edits Its Own Skills

An AI agent system using files-first memory stored in an Obsidian vault with no vector database. The agent learns from each session by editing its own skills, getting sharper over time while keeping all data in plain markdown files you own.

memoryobsidianself-improvingskillslocal-first
by slogsdon Jul 22, 2026 7/10
workflow GitHub

jalisa: Agent Governance Kit with Git-Backed Shared Memory

An agent governance toolkit that provides git-backed shared memory, machine-enforced protocol adherence, and self-proving results for AI coding agents. Designed to bring consistency and accountability to multi-agent AI development workflows.

governanceshared-memorygitprotocolmulti-agent
by finallyfavor Jul 22, 2026 6/10
workflow Reddit

Sharding: Plugin That Detects Interface Drift Between Claude Code Sessions

Sharding treats multi-session AI development like a type checker — contracts between Claude Code sessions (APIs, schemas, shared conventions) live on disk and are frozen while a phase is open. Any session that diverges from an agreed interface is caught mechanically, not discovered at integration time, bringing compile-time-style guarantees to multi-agent coordination.

multi-sessioncontractsinterfacetype-safetycoordinationdrift-detection
by CONTROVERSIAL_TACO Jul 22, 2026 8/10
workflow Reddit

Gated Development Methodology for Long-Running AI Coding Projects

A structured AI coding methodology with explicit phase gates, human review at each step, and context firewalls between sessions. The human owns product decisions while architect and coding agents execute separately, with all decisions documented so a different model can continue any project without reconstructing its history.

methodologyhuman-gatescontext-managementmulti-sessionworkflow
by nonproductive Jul 22, 2026 6/10
workflow GitHub

dynobox: Cross-Harness Testing for Multi-Step Agent Flows

A testing framework designed specifically for multi-step AI agent flows that works across different agent harnesses. Enables repeatable, cross-compatible testing of agentic workflows to ensure consistent behavior regardless of which AI coding tool is running.

testingmulti-agentcross-harnessworkflowsagentic
by dynobox Jul 22, 2026 6/10
workflow GitHub

harness: Declarative YAML Control Plane for Agent Grounding, Tools, Memory, and Hooks

A declarative control plane that describes an agent harness in a single YAML file covering grounding, tools, memory configuration, and hooks. Supports describe, validate, diff, and apply operations, bringing infrastructure-as-code discipline to AI agent configuration.

declarativeyamlconfigurationhooksmemorygrounding
by LanNguyenSi Jul 22, 2026 7/10
workflow GitHub

AI-SOP-Protocol: Machine-Readable Constraints for TDD, ADRs, and Commit Gates

A protocol that encodes development standards as machine-readable constraints, making Claude automatically follow TDD, Architecture Decision Records, commit gates, and release checks. Turns soft guidelines into hard rules that the AI cannot bypass.

tddadrcommit-gatesprotocolconstraintssop
by astroicers Jul 22, 2026 7/10
workflow GitHub

seam-scaffold: Safety Protocols That Make Coding Agents Investigate Before Acting

Seam-aware protocols ("training wheels") for AI coding agents that force investigation before changes, gate irreversible actions, and require agents to prove their claims. Designed to reduce careless behavior on sensitive code paths by treating AI unpredictability as a fixed property to design around.

safetygatesprotocolsai-codinginvariants
by SeamStressDev Jul 22, 2026 6/10
workflow GitHub

radin: Agentic Stack for Token-Efficient AI Coding

An agentic stack focused on baking in the most efficient and safe token-reduction tools for AI coding workflows. Helps developers cut costs while maintaining quality in agentic coding pipelines.

token-reductionagentic-stackefficiencycost
by shortcuts Jul 22, 2026 7/10
workflow Reddit

Kimi K3 as Claude Code Backend: A Hands-On Workflow Test

A developer successfully ran Kimi K3 as the primary model for Claude Code while their Anthropic subscription was depleted. The test covered the full CC toolchain—file edits, Bash, subagents, planning, MCPs, skills, and git—and found near-identical behavior to native Anthropic models. The only hiccup was the Claude-in-Chrome MCP, which needed minor tab management.

kimi-k3alternative-modelsworkflowtesting
by rayhomme Jul 21, 2026 6/10
workflow Reddit

Always-On Personal AI OS: Discord-Controlled Agent with Persistent Knowledge Base

A detailed writeup and build guide for a personal AI operating system that dispatches coding work across repos via Discord. A kernel process routes work to ephemeral Claude Code sessions; all state lives in files and SQLite so crashes lose nothing. Includes a gist you can hand directly to your own agent to replicate the setup.

orchestrationdiscordpersistent-memoryautomationarchitecture
by CrayonsFearMe Jul 21, 2026 8/10
workflow Reddit

Building a Reliable AI Code Review Gate: Findings Must Be Reproducible

A developer's month of field data on AI code review gates: roughly 3 in 4 initial findings don't hold up. The fix is requiring the reviewer to reproduce each finding against the running app—not just describe it. A finding that can only narrate a problem is an opinion; one that can demonstrate it is evidence. Practical guidance for teams running automated review agents.

code-reviewvalidationgateworkflowai-safety
by mrtrly Jul 21, 2026 7/10
workflow Reddit

Archivum: Git-Backed Knowledge Workspace for Claude Code

A Git-backed, LLM-readable knowledge OS for projects, research, decisions, and long-horizon work. Claude Code starts from a compact live-state surface and searches outward as needed, writing durable changes back as Markdown/YAML files. A single shared agent contract works across Claude Code, Codex, and Cursor—agents are replaceable, the knowledge base persists.

knowledge-basegitworkflowpersistent-memoryarchitecture
by AntreasAntoniou Jul 21, 2026 8/10
workflow GitHub

Weft: Composable AI Rules Manager for Coding Agents

A composable rule source manager for coding agents that lets teams layer and sync CLAUDE.md/AGENTS.md rules from multiple sources. Solves the problem of maintaining consistent agent behavior across a team when rules live in different repos or tools. Composable layering means local overrides stack cleanly on top of shared rules.

rulesteamworkflowclaude-mdagents-md
by jophira Jul 21, 2026 7/10
workflow GitHub

halyard-fleet: Remote Control Plane for Orchestrating Coding Agents

A control plane for managing coding agents remotely — approve or deny tool calls, steer sessions mid-run, and route work between agents from any channel and across different agent runtimes.

orchestrationcontrol-planemulti-agentremotetool-approval
by alperarabaci Jul 21, 2026 8/10
workflow GitHub

pi-graph: Deterministic YAML Workflow Graphs for Coding Agents

pi-graph prevents agents from skipping steps by encoding workflows as deterministic YAML graphs that the agent builds, runs, and can inspect. Provides auditability and reproducibility for multi-step tasks.

workflowyamldeterministicgraphorchestration
by ali-abassi Jul 21, 2026 7/10
workflow Reddit

Claude Code Setup for Adversarial Code Review With GPT-5.6-sol via herdr

A Claude Code configuration for running adversarial code reviews using GPT-5.6-sol as a counterpart reviewer through the herdr multi-model routing tool. Cross-model adversarial review to catch blind spots.

workflowadversarialcode-reviewmulti-modelgpt
by a_deneb Jul 21, 2026 6/10
workflow Reddit

Project-Level Compound Engineering: Git Task Graph With Parallel /lfg Fan-Out

A project-level orchestration layer on top of Every's compound-engineering plugin. Decomposes an epic into a git-committed task graph, then fans it out as parallel /lfg waves of 3–5 concurrent agents producing green PRs.

workfloworchestrationfan-outparallelcompound-engineeringgit
by hookedonwinter Jul 21, 2026 8/10
workflow Reddit

Multi-Model Orchestration: Fable Architect + Opus 4.8 + GPT for QA

Community discussion on splitting AI roles across model families — Fable for architecture, Opus 4.8 for implementation, GPT for QA. Explores whether cross-provider QA adds value. Useful starting point for teams designing multi-model pipelines with Claude Code.

multi-modelorchestrationfableopusworkflow
by Snmrv Jul 21, 2026 6/10
workflow GitHub

openclaw-worker-relay: Supervise Claude Code and Codex Workers From OpenClaw

Relay layer that lets OpenClaw manage Claude Code and Codex CLI workers with async progress tracking, routed delivery, wake, resume, and automation support. Useful for orchestrating long-running AI coding tasks from a central controller.

orchestrationopenclawworkerautomationrelay
by VsevolodUstinov Jul 21, 2026 6/10
workflow Reddit

Claude refuses to generate code for Instagram account automation

I'm trying to automate a workflow for my job that involves configuring a large number of Instagram accounts. I asked Claude to generate the code, but it refused, saying the automation would violate...

workflowautomationconfig
by Just-End-9747 Jul 21, 2026 5/10
workflow Reddit

Loop & Gate: Fixed Human-Decision Gates for Autonomous Claude Code Agents

Four MIT-licensed Claude Code plugins that let an agent run its loop freely between a fixed set of named human-decision gates — no full autonomy or constant approval. Plain-text Obsidian memory injects context at session start, and gates cover the full solo project lifecycle: memory, building, marketing, and shipping. Agents may propose edits to their own skills but cannot weaken their own gates.

workflowgatesautonomypluginsmemoryobsidian
by slogsdon01 Jul 20, 2026 8/10
workflow Reddit

Harness vs. Solo Agent: Community Debate on Autonomous Coding Patterns With Fable

Community discussion comparing structured harnesses (like ultracode) against prompting a single agent through plan → implement → review → commit unattended. With Fable-class models, solo agents appear equivalent to harnesses for low-to-moderate complexity tasks while deviating less and shipping faster. Raises the question of whether harness overhead is still worth it as models improve.

workflowharnessautonomypatternsdiscussion
by ZhopaRazzi Jul 20, 2026 5/10
workflow GitHub

cadence: Verification Layer That Prevents Agents From Self-Certifying Their Own Work

Adds settle gates to AI-assisted development workflows: agents declare acceptance criteria, then settle gates independently re-check those criteria and refuse to proceed until the evidence holds. Works as a CLI tool and MCP server with Claude Code, Codex, and other agents. Addresses the core problem of agents marking tasks done without genuine verification.

workflowverificationgatesacceptance-criteriaqualitymcp
by manehorizons Jul 20, 2026 8/10
workflow GitHub

loom: Adaptive Planning OS for AI Coding Agents That Learns From Every Run

Planning system for AI coding agents that shows its reasoning and improves with each session. In a blind benchmark, a smaller model at low effort running loom matched a frontier model at max effort, using fewer tokens and less time. The system learns from run history to progressively reduce overhead and token costs.

workflowplanningadaptivelearningbenchmarkefficiency
by saroo98 Jul 20, 2026 7/10
workflow GitHub

claude-automata: Long-Running Autonomous Agent Environment for Claude Code

Persistent autonomous agent environment that can run Claude Code sessions for days, storing only verified information across runs. Designed for long-horizon tasks where you want the agent to accumulate reliable state without drifting or hallucinating its own history. Memory writes require verification before persistence.

workflowautonomouslong-runningmemoryverificationpersistence
by clomia Jul 20, 2026 7/10
workflow GitHub

claudux: Deterministic CI Gate That Fails Builds When Docs Drift From Code

No-AI CI gate that fails your build when documentation drifts from the code it describes. The drift check is deterministic (no LLM involved), making it reliable in CI pipelines. Also includes VitePress doc generation via Claude or Codex for the writing side, keeping the detection and generation concerns separate.

workflowcidocumentationdrift-detectionvitepressgate
by firstbitelabsllc Jul 20, 2026 7/10
workflow GitHub

tiered-agents: Cost-Tiered Orchestration for Claude Code

Workflow pattern for Claude Code that routes planning to frontier models, execution to cheaper models, and verification to evidence-based checks. Cuts costs without sacrificing quality by matching model tier to task complexity.

costorchestrationworkflowmulti-modeloptimization
by prvrtl Jul 19, 2026 8/10
workflow GitHub

codex-claude-orchestrator: Custody-Aware Codex-to-Claude Orchestration

Orchestration layer that routes tasks from Codex to Claude Code with cheaper subagents for execution and safe native fallback. Maintains custody awareness — tracking which agent holds context at each step — to avoid context loss on handoffs.

orchestrationcodexworkflowmulti-agentcost
by coredo-eu Jul 19, 2026 6/10
workflow Reddit

ICM: Folder-Based Workflow Methodology for Single-Agent Orchestration

Interpretable Context Methodology (ICM) carries multi-step task orchestration in folder structure rather than code. Numbered folders encode order, hierarchy controls what each step sees, and plain markdown holds state — one agent walks the structure without a subagent tree. Includes a restructure mode that classifies and migrates messy repos, and a build mode for scaffolding fresh workspaces.

workfloworchestrationcontextmethodologyfolder-structure
by VanCliefMedia Jul 19, 2026 7/10
workflow Reddit

Claude Code CLI Parallel Agent Concurrency Is Capped by CPU Count

Discovery that Claude Code limits the number of parallel agents in ultracode to the number of available CPUs — causing significant slowdowns on low-core machines like Raspberry Pi 4. Network-bound agent tasks still serialize on underpowered hardware, making CPU count a practical constraint for multi-agent workflows.

performanceparallelcpuultracodemulti-agent
by Born-Persimmon7796 Jul 19, 2026 6/10
workflow GitHub

open-multi-agent: TypeScript Agent Orchestration With Dynamic Task DAGs

A TypeScript framework where a coordinator plans the task DAG at runtime rather than requiring a static graph. Supports Claude, ChatGPT, Gemini, DeepSeek, and local models. Goal-driven: describe what you want, the coordinator figures out the execution plan.

workfloworchestrationmulti-agenttypescript
by open-multi-agent Jul 19, 2026 6/10
workflow GitHub

da-run: Staged Rust Code Factory for Claude Code

Spec-in, verified-and-committed-change-out pipeline specifically for Rust projects. Stages the Claude Code interaction so changes are verified before commit. Useful for Rust developers who want deterministic, reviewable output from agentic coding sessions.

workflowrustpipelineverification
by igouss Jul 19, 2026 7/10
workflow GitHub

cc-fleet: Run Claude Code Workflows on Any Third-Party LLM

Enables Claude Code's Dynamic Workflows, Agent Teams, and Subagents to use DeepSeek, GLM, Kimi, Qwen, or a Codex subscription instead of requiring an Anthropic subscription. Bridges Claude Code's orchestration capabilities with alternative model providers. Chinese/English bilingual.

workflowmulti-modeldeepseekorchestration
by ethanhq Jul 19, 2026 7/10
workflow GitHub

game-of-cards: Agile Task Cards for Human + LLM Collaboration

Turns work items into durable, inspectable cards that both humans and LLMs can read, update, and act on. Designed for the age of agents where tasks persist across many sessions. Brings agile-style structure to agentic development workflows.

workflowtask-managementcollaborationagile
by zauberzeug Jul 19, 2026 6/10
workflow GitHub

loopthing: Turn Claude Code History Into Portable Reasoning Handoffs

Converts local Codex and Claude Code conversation history into structured handoff documents for the next chat, agent, collaborator, or your future self. Bridges context across sessions and agents. Useful when a task spans multiple sessions or agents.

workflowcontexthandoffhistory
by danyolio Jul 19, 2026 6/10
workflow GitHub

parallel-sessions: Multi-Session Coordination for Claude Code + Codex

Pure Bash hooks providing file locking, crash recovery, and cross-session task delegation across multiple AI coding agent sessions. No server or daemon required — coordination happens through the filesystem. Works across Claude Code and OpenAI Codex sessions.

workflowmulti-agentbashcoordination
by sezeryavuz Jul 19, 2026 7/10
workflow GitHub

trio-handoff: Evidence-Rich Handoff Bundles for Cross-Agent Review

Packages Claude Code session output into evidence-rich handoff bundles that Codex (or another agent) can review and continue. Enables a build-then-verify pattern where different agents do the building and reviewing. Structured for auditability.

workflowhandoffcode-reviewmulti-agent
by AliceLJY Jul 19, 2026 7/10
workflow GitHub

CodeyBox: Multi-Agent Task Queue With Isolated VMs and Quota Routing

Runs CLI coding agents (Claude Code, Codex, Copilot, Cursor, Gemini, opencode) against a task queue where each agent works in an isolated VM. Configurable auditors check output before git merge. Pools multiple provider subscriptions with quota-aware routing and fallback. C#/.NET 10, MIT-licensed.

workfloworchestrationmulti-agentvmqueue
by AdamFrisby Jul 19, 2026 8/10
workflow GitHub

PanWizard: Plan→Execute→Verify Workflow Automation for AI Coding Agents

A one-installer, five-runtime workflow automation tool implementing Plan→Execute→Verify cycles for Claude Code, Codex, Gemini CLI, OpenCode, and Copilot. Structures agentic work into explicit phases with verification gates between them.

workflowplan-execute-verifymulti-agentautomation
by oharms Jul 19, 2026 6/10
workflow GitHub

nomad: Portable AI Team Workspace — Plain Text, Zero Dependencies

A portable AI team workspace that uses plain text files with zero dependencies, compatible across Claude Code, Codex, OpenCode, Copilot, and Cursor. Represents tasks, context, and handoffs in a format any agent or human can read without tooling.

workflowportableplain-textmulti-agentcollaboration
by LucioLiu Jul 19, 2026 7/10
workflow Reddit

Multi-Model Orchestration: Fable + Sol + Opus via Shared Web Wrapper

A practical multi-model workflow using a custom web wrapper where Fable 5 (orchestrator/creative), GPT-o3 Sol (technical lead), and Claude Opus (engineer) collaborate in a shared room via @-mentions. Each agent sees only its mentions; the human sees everything. Enabled 24h+ continuous agentic runs.

workflowmulti-modelorchestrationfable5opus
by richhard Jul 19, 2026 7/10
workflow GitHub

roadmapped: Project Management as Flat Files Driven by AI Agents

YAML-based task management stored directly in the repo with a computed roadmap, driven by your AI coding agent. No database, no SaaS, no external service — tasks live alongside the code they track. MIT-licensed.

workflowproject-managementyamlrepo-native
by 5e1y Jul 19, 2026 7/10
workflow GitHub

clem: docker-compose for Claude Code Agents — Persistent Teams, 24/7

Continuously Looping Engineering Machines — a docker-compose-style system for running persistent Claude Code agent teams on any Linux host, 24 hours a day. Treats long-running agent sessions as containers with defined services and restart policies.

workflowdockerpersistent24-7linuxorchestration
by jahwag Jul 19, 2026 8/10
workflow GitHub

pixel-mcp-workflow: Figma-to-React 6-Phase Parallel AI Pipeline

An AI-powered design-to-code pipeline that converts Figma designs to React components across six parallel phases. Uses MCP tooling and parallelism to accelerate the typically slow design handoff process.

workflowfigmareactdesign-to-codemcp
by giovannisacca Jul 19, 2026 6/10
workflow GitHub

graphkit: Graph of Agent Nodes With Drift-Correcting Supervisor

A Claude Code skill that structures long coding tasks as a graph of executor nodes rather than a single drifting loop. A supervisor agent runs outside the main context and corrects drift when the executor wanders off track. Available in English and Chinese (MIT).

workfloworchestrationdrift-correctionsupervisormulti-agent
by levi-qiao Jul 19, 2026 8/10
workflow GitHub

agent-studio: Task Dispatcher for Claude, Copilot, Codex, and Gemini CLI

Routes tasks to Claude Code, GitHub Copilot, Codex, and Gemini CLI, lets each agent work, and repeats. A simple dispatcher for teams that want to run the same task across multiple coding agents and compare results.

workflowmulti-agentdispatchercomparison
by agent-orc Jul 19, 2026 5/10
workflow GitHub

deskmate: Run Claude Code as an AI Company With Web Dashboard

A multi-agent orchestration dashboard that structures Claude Code sessions as a company hierarchy: CEO→Team Lead→Members. Provides a web UI with chat rooms, approval flows, ticket management, pin-review, Git integration, and a terminal. Multi-language (English/Korean).

workfloworchestrationmulti-agentdashboardhierarchy
by asete93 Jul 19, 2026 7/10
workflow GitHub

fabrik: Drive Claude Code Through a Full SDLC Pipeline on GitHub Projects

A Go CLI that drives Claude Code through a Specify→Research→Plan→Implement→Review→Validate SDLC pipeline, using GitHub Project boards to track state. Human-in-the-loop or fully automated. Turns issue-driven development into a repeatable, auditable pipeline. Documentation at fabrik.handarbeit.io.

workflowsdlcgithubpipelineautomationgo
by handarbeit Jul 19, 2026 9/10
workflow Reddit

Add a Browser to Your Claude Code Cloud Container With Playwright

A startup script that installs Playwright CLI and its skills into a Claude Code cloud container, plus a SessionStart hook that auto-configures proxy settings when HTTPS_PROXY is present. Lets you run browser automation inside a cloud-hosted Claude Code session without any manual setup. Useful for CI-style web scraping or UI testing workflows.

playwrightcloudbrowserskillhookautomation
by hous Jul 19, 2026 7/10
workflow GitHub

claude-code-memory-setup: Long-Term Memory for Claude Code via Obsidian + Graphify

A setup guide and configuration for adding persistent long-term memory to Claude Code by connecting it to an Obsidian vault via Graphify. Reduces token usage by externalizing codebase knowledge into a searchable graph. Lets Claude retrieve only relevant context rather than re-loading entire codebases each session.

memoryobsidiantoken-usagecontextworkflow
by DuyDan1305 Jul 19, 2026 6/10
workflow GitHub

linear-pipeline-kit: Linear Tickets as Executable Specs for Claude Code

A complete Linear-driven development workflow for Claude Code: tickets become executable specs, each feature runs in a dedicated git worktree, a merge-gate hook enforces TDD discipline, and a backlog queue runner processes work sequentially. Extracted directly from a live daily setup with a companion ai-review-kit. High-signal, opinionated, and battle-tested.

linearworkflowworktreetddhookproject-managementspec-driven
by kristijan-kresic-hvar Jul 19, 2026 8/10
workflow GitHub

Agentic-Doc-Templates: Modular Docs That Keep AI Agents Aligned Across Sessions

A set of modular document templates that convert chats, design docs, and rough ideas into structured Understanding + TODOs that an agent reviews before starting work. Keeps agents from context-drifting across long projects by establishing a consistent artifact format. Drop the templates into any project and agents stay aligned without re-briefing.

templatesworkflowcontextalignmentagentdocumentation
by BrianCLowe Jul 19, 2026 6/10
workflow GitHub

product-dev: Claude Code Plugin for Idea-to-Spec UX Research Flows

A Claude Code plugin that guides you from a fuzzy product idea through structured UX research prompt flows to a compiled technical spec. Uses a spec-compiling subagent to synthesize research outputs into a document an agent can act on. Bridges the gap between product thinking and implementation-ready specs.

productux-researchspecworkflowsubagentclaude-code
by clownware Jul 19, 2026 6/10
workflow GitHub

redthread: Phase-Aware Memory Management for AI Agents

A memory management system for AI agents that scopes context to project phases — each phase carries its own memory layer, preventing earlier phase details from polluting current context. Reduces noise and improves agent focus as projects move through design, implementation, and review stages.

memorycontextphasesworkflowagentmanagement
by sina5 Jul 19, 2026 6/10
workflow GitHub

straymark: Cognitive Discipline Framework for AI-Assisted Projects

Framework and Rust CLI for externalizing scope, decisions, and risks (Charters, AILOG, AIDEC, ADR) so AI agents stay coherent across many turns. Generates ISO 42001, EU AI Act, and NIST AI RMF compliance evidence as a side effect. Available in English, Spanish, and Chinese.

governanceadrcompliancerustmulti-language
by StrangeDaysTech Jul 18, 2026 6/10
workflow Reddit

The Rubber Duck Agent: Does the Duck Reply Actually Matter?

Explores whether a critic subagent (the rubber duck) actually contributes value or whether the value comes from writing the handoff prompt that articulates the plan. Author built duck.md that challenges plans before non-trivial changes — found the prompt-writing process does most of the work, raising the question of whether the agent reply adds anything.

critic-agentworkflowplanningrubber-duck
by imposter3c Jul 18, 2026 6/10
workflow Reddit

Macro Commands That Batch Multi-Step Agent Tasks Into One Turn

Proposes using macro commands to collapse multi-step agent tasks (inspect env, apply patches, build, test, read media) into a single RAG turn rather than separate turns. Author tested on other providers and reports 40-80% reduction in LLM turns and similar token savings. Includes benchmark results comparing configurations.

macrooptimizationtokensturnsefficiency
by SGM_Finance Jul 18, 2026 6/10
workflow GitHub

sortie: Turn Tracker Tickets Into Autonomous Agent Sessions

Bridges your issue tracker and autonomous agent execution by turning labeled tracker tickets directly into Claude Code agent sessions. Automates the hand-off from project management to coding without manual context copying.

issue-trackerautomationsessionsworkflow
by sortie-ai Jul 18, 2026 6/10
workflow GitHub

agentharness: Portable Engineering Policies for Coding Agents

Portable engineering policies for coding agents covering git, testing, logging, and language conventions written once and referenced everywhere. Makes your standards explicitly machine-readable rather than buried in CLAUDE.md files that agents may drift from.

engineeringpoliciesconventionsportable
by andr-ca Jul 18, 2026 6/10
workflow GitHub

antmay: Discussion-Driven Development for AI Agents

Reaches decisions through open-ended discussion between agents, then threads those decisions into spec, plan, and implementation as reviewable on-disk artifacts. An alternative to having agents jump straight to implementation without shared understanding.

discussionspecartifactsworkflowplanning
by Jei-sKappa Jul 18, 2026 6/10
workflow GitHub

fab-kit: Structured Spec-Driven Development Workflow for AI Agents

Spec-first development workflow toolkit for AI coding agents. Enforces defining what to build before building it, reducing the drift that happens when agents start coding without a clear specification. Framework-agnostic and compatible with multiple agents.

spec-drivenworkflowplanning
by sahil87 Jul 18, 2026 6/10
workflow Reddit

seeks: Overnight Agent Loop With Independent Verification and Hard Stops

Plugin for running Claude Code overnight using node hooks the agent cannot read or edit. Features: setup interview that defines concrete done-conditions, loop memory in md files surviving compaction, git push/merge blocked in code, done verified by a separate fresh-context agent, and 16 lens exhaustive review (concurrency, injection, timezone, etc.). Iteration and wall-clock caps live in hook-owned files.

workflowovernightverificationhooksloop
by Bogdanilaa Jul 18, 2026 8/10
workflow GitHub

context-forge: Claude Code Plugin for Disciplined AI Development

Claude Code plugin enforcing spec-driven builds, real verification at each step, and project memory that survives every session. Addresses the drift that happens when agents build without a spec or when memory resets wipe out accumulated context about the project.

spec-drivenverificationmemoryworkflow
by yerros Jul 18, 2026 7/10
workflow GitHub

critters: TypeScript Daemon for Issue-Triggered Claude Code Workflows

TypeScript daemon that watches an issue tracker for labeled issues and runs configurable agentic Claude Code workflows on them — planning, execution, review, or custom phases. Bridges the gap between your issue tracker and autonomous agent execution.

automationgithub-issuestypescriptdaemonworkflow
by ack-ventures Jul 18, 2026 8/10
workflow Reddit

orchflows: Build Self-Improving Agent Loops in One Sentence

Library of skill primitives composable into workflows with a self-improving skill as a first-class citizen. Builds on the orchestrator→subagent pattern but makes the composition dynamic so models route requests to the smallest appropriate workflow automatically. Works in Claude Code and Codex.

workflowself-improvingorchestrationdynamic
by FlyingTriangle Jul 18, 2026 7/10
workflow Reddit

Nothing Agents Produce Counts as Done Until an Independent Check Passes

Practical post about implementing a second verification step that is separate from the agent that did the work: tests for code, recalculation for spreadsheets, live re-fetch for web data. Includes a publish gate script that scans outbound content for terms that must never leave the machine, with the key rule that the agent cannot edit the term list to make it pass.

verificationquality-gateworkflowindependent-check
by xThursday6 Jul 18, 2026 7/10
workflow Reddit

Worktree-Based Alternative to /loop for Long-Running Tasks

Workflow pattern using worktrees and explicit stage-based plans as an alternative to /loop for long-running tasks. Stages include review, implement, write tests, run tests, and regression testing. The agent delegates each stage to a persistent subagent in the worktree, giving a natural start/end cycle without the open-ended loop risk.

worktreeworkflowstageslong-runningloop
by Complete-Captain3322 Jul 18, 2026 7/10
workflow GitHub

cadence-ai: Gated Agile Workflow Plugin for Claude Code

Claude Code plugin that tracks work on a YAML board, enforces hard approval gates so nothing skips ahead of its own readiness, and maintains a persistent Obsidian-linked knowledge brain that survives across sessions. Designed to prevent agents from rushing past planning or shipping incomplete work.

workflowagilegatesobsidiankanban
by febradc-github Jul 18, 2026 7/10
workflow GitHub

claude-config: Plan-Then-Execute Multi-Agent Workflow for Claude Code

Deterministic scaffolding and quality-gate loops that let even smaller, cheaper models ship large features via a plan-then-execute pattern with multi-agent coordination. Designed to get consistent results by separating the planning phase from execution and applying gates between stages.

multi-agentplanningquality-gateworkflow
by gcharang Jul 18, 2026 7/10
workflow GitHub

fable-the-boss: Cross-Harness Fable 5 Orchestrator Pattern

Pure-skill implementation of the Fable 5 orchestrator pattern proposed by Anthropic — your agent acts as boss while Codex, Cursor, and any headless coding agent serve as the crew. Cross-harness and harness-independent, so it works with whatever agents you already use.

fable-5orchestrationmulti-agentworkflow
by tuoxiansp Jul 18, 2026 7/10
workflow GitHub

zion: Claude Code Plugin Marketplace With Multi-Agent Crew

Installable as a Claude Code plugin, ships an orchestrated multi-agent crew for feature delivery, a pointer-driven tech-debt and dependency-upgrade fixer, and a shared code-review rubric. Components can be installed together or standalone, making it modular for different workflows.

pluginmulti-agentcode-reviewtech-debt
by johantor Jul 18, 2026 7/10
workflow GitHub

heatwave: Verification Protocol for AI-Written Code

A plan→build→review→prove loop for AI-generated code that never silently restarts. Compatible with Claude Code, Codex, Gemini CLI, Cursor, and any agent. Addresses the common failure mode where agents report code as done without proper verification.

verificationtestingquality-gateworkflow
by abhirajsinha Jul 18, 2026 7/10
workflow GitHub

evolve-loop: Autonomous CI/CD With Adversarial Code Auditing

Autonomous pipeline that plans, builds, and adversarially audits changes to any repo — a different model reviews the builder — shipping only what passes deterministic gates. Failures become durable lessons; runs are checkpoint-resumable and context-optimized. Supports Claude Code, Codex, and Gemini.

ci-cdadversarialmulti-agentworkflowquality-gate
by mickeyyaya Jul 18, 2026 7/10
workflow Reddit

Automated Customer Support with claude -p Cron at 6am

A real workflow where a launchd cron job runs claude -p with a skill file every morning to triage customer support threads — classifying, investigating against real data (Sentry, docs, code), drafting replies, and archiving. Hard limit of NEVER calling send_draft — the human reviews everything. 5 threads, 3 drafts, 2 correct skips on first run. Practical blueprint for responsible AI-assisted support.

workflowautomationcustomer-supportcronclaude-codeemailSKILL.md
by kizum Jul 18, 2026 8/10
workflow Reddit

Multi-Model Orchestration: Claude + Codex With One Accountable Owner

A personal workflow for multi-model orchestration where Sol (Fable) owns the brief and verification, Sonnet handles implementation, and Opus challenges architectural decisions — each with a bounded role. Isolated worktrees for editing agents, parallel investigation, one implementation owner per surface. Practical description of running Claude Max and ChatGPT Pro together for complex engineering tasks.

workflowmulti-modelorchestrationclaude-codecodexmulti-agent
by RFOK Jul 18, 2026 7/10
workflow Reddit

Review the Plan Before a Single Line of Code — How to Stop Rebuilding

A practical orchestration workflow that eliminates the rebuild loop: write the spec from the actual repo state, get a plan before code exists, have a separate agent review that plan adversarially, then hand it to an implementation agent. Four failure modes that compound in typical one-shot sessions — and the structural fix for each. Actionable description of an approach that lands features in one shot.

workfloworchestrationplanningcode-reviewmulti-agentclaude-code
by cryptoviksant Jul 18, 2026 8/10
workflow GitHub

agent-ready-repo: Complete AI Operating Model for Software Teams

A complete AI operating model for software teams from idea to production — three peer-supervised loops (discovery, build, release) over a catalogue of curated packs: skills, subagents, and hooks, each installed in one line. Works with Claude Code, Codex, Cursor, Copilot, Gemini, and Kiro. Described as npm for your coding agent.

workflowoperating-modelskillshooksmulti-agentclaude-code
by eugenelim Jul 18, 2026 8/10
workflow GitHub

repo-harness: File-Backed Workflow Harness for Reliable Agent Sessions

A file-backed workflow harness for reliable Claude Code and Codex sessions — stores workflow state on disk so sessions can resume after interruption. Solves the problem of losing progress when a session times out or crashes mid-task. Simple and dependency-free.

workflowharnessfile-backedclaude-codecodexreliability
by Ancienttwo Jul 18, 2026 6/10
workflow GitHub

atelier: Spec-Driven Workflows for Opencode and Claude Code

An atelier for Opencode, Claude Code, and other coding agents featuring spec-driven workflows, deep thinking, and code quality focus. Provides a structured, craftsman-style development environment for agents that values deliberate work over speed. Useful for projects where quality matters more than velocity.

workflowspec-drivenqualityclaude-codeopencode
by martinffx Jul 18, 2026 6/10
workflow GitHub

aesop: Haiku-First Orchestration Harness for Claude Code Fable Fleet

A self-building fable-fleet orchestration harness for Claude Code featuring Haiku-first dispatch, event-sourced state, and observable machinery. Routes tasks to cheaper Haiku models where possible, escalating to Fable only when needed. Reduces costs on large autonomous workloads.

workfloworchestrationhaikufableclaude-codecost-optimization
by matt82198 Jul 18, 2026 7/10
workflow GitHub

afk-company: Absence-First Ops for Claude Code One-Person Companies

An absence-first operations framework for Claude Code where task files are employees, BLOCKED is a feature, and the send button is never automated. Designed for solopreneurs who want their business to keep making progress while they are away. Human-gated final actions prevent runaway automation.

workflowsolopreneurautomationclaude-codetask-management
by dennykim123 Jul 18, 2026 7/10
workflow GitHub

aura-frog: Claude Code Plugin With TDD Workflow, 10 Agents, 27 Hooks

A comprehensive Claude Code plugin with 10 specialized agents, a 5-phase TDD workflow, 3-tier rules, and 27 hooks. Provides a structured development process from requirements through testing and shipping. High-coverage automation for teams who want a complete agent-driven development loop.

workflowTDDhooksagentsclaude-codeplugin
by nguyenthienthanh Jul 18, 2026 7/10
workflow GitHub

prusik: Deterministic Build Harness With FSM Sprint Gates for AI Agents

A deterministic, evidence-based build harness for autonomous coding agents featuring FSM sprint gates, execution-evidence verification, and adversarial critics. Every claim must be proved with actual execution evidence — not opinion. Designed for teams who need reproducible, auditable AI coding results.

workflowdeterministicevidenceFSMsprintauditableclaude-code
by getprusik Jul 18, 2026 7/10
workflow GitHub

aoi-orgware: Git-Native Governance for Coding-Agent Teams

Git-native governance for coding-agent teams where agents record file ownership, baseline results, and execution evidence as pinned git-native artifacts rather than claims in a chat log. Survives code review and provides an auditable history of what each agent did and why. Alpha stage.

governancegitauditagentsworkflowevidence
by Ryan529616 Jul 18, 2026 7/10
workflow GitHub

deep-plan-enhanced: Claude Code Plugin for Research and Planning

A Claude Code plugin for deep system discovery, implementation planning, and code generation — covers research, multi-LLM review, and TDD-oriented section generation. Helps structure the planning phase before diving into implementation. Particularly useful for complex features where upfront research matters.

workflowplanningresearchTDDmulti-LLMclaude-code
by kbichave Jul 18, 2026 7/10
workflow GitHub

ruflo: Agent Meta-Harness for Multi-Player Swarm Orchestration

A leading agent meta-harness for deploying multi-agent swarms, coordinating autonomous workflows, and building conversational AI systems. Features adaptive memory, self-learning intelligence, RAG integration, and native Claude Code and Codex support. Useful for teams building complex multi-agent pipelines.

multi-agentorchestrationswarmragclaude-code
by ruvnet Jul 18, 2026 6/10
workflow Reddit

Two-Claude Workflow: One Designs, One Builds — Runs a 24/7 Game Playtester

Chat Claude designs the audit and issues tickets; Claude Code implements one ticket per session. The resulting dashboard playtests a game 24/7, finds economy leaks, undeclared difficulty walls, and dominant openers from survival curves — things manual playtesting would miss. Details the two-Claude split, machine-readable recaps, and fairness scoring design.

multi-agentworkflowgame-devautomation
by Brehmdig Jul 17, 2026 7/10
workflow Reddit

How Claude Code Structures Multi-Agent Work Without Being Told To

Observation from building an overnight FM-clone game builder: the main Claude agent spontaneously delegates implementation to spawned sub-agents and uses a UI specialist, playtester, and code reviewer without explicit instruction. Reveals how Claude Code naturally organizes long-running sessions the same way a software team would.

multi-agentemergentautonomousworkflow
by Hirojinho Jul 17, 2026 7/10
workflow Reddit

1,800-Session Post-Mortem: What Compounded and What Rotted in a Heavy Claude Code Workspace

After 18 months and 1,800 logged sessions with 400+ skills and protocols, the author audits what survived. Key findings: the top 20 protocols do nearly all the work, 4-agent adversarial pipelines give only 10% quality gain at 4x token cost, and 85% of commits went to memory maintenance. What compounded: forced session write-back, lightweight context compression, and narrow structured retrieval over stored session logs.

skillsworkflowpost-mortemefficiency
by BangMyPussy Jul 17, 2026 9/10
workflow GitHub

agentic-qa-boilerplate: Full QA Lifecycle With Multi-Agent Skills on Playwright

Orchestrates the full QA lifecycle via multi-agent skills: shift-left planning, in-sprint testing, TMS documentation with ROI scoring, KATA automation, and regression with GO/NO-GO gates. Works across Claude Code, Opencode, and others using the agentskills.io spec.

qatestingplaywrightautomation
by upex-galaxy Jul 17, 2026 7/10
workflow GitHub

agentic-os: Five-Step Governance Framework for AI Coding Agents

Drop-in AGENTS.md rules and guardrails that enforce a plan → build → review → test → ship workflow where no step is marked done without evidence. Works across Claude Code, Codex, Cursor, Copilot, and Antigravity.

governanceworkflowguardrailsagents.md
by KbWen Jul 17, 2026 7/10
workflow GitHub

claude-overnight: Queue Research Questions All Day, Wake Up to Answers

Queue research tasks throughout the day and have Claude Code work through them overnight using your idle subscription quota. Turns off-hours Claude Code capacity into a passive research assistant with no extra cost.

overnightresearchqueueautomation
by rohanprichard Jul 17, 2026 7/10
workflow GitHub

ctrlshft: Synced Instructions, Skills, and Autonomous Loops Across Machines

Provides synced AGENTS.md instructions, workflow skills, hardened secrets management, and autonomous loops across every machine. Addresses the pain of keeping Claude Code configuration consistent when working on multiple computers.

syncmulti-machineautomationconfiguration
by arndvs Jul 17, 2026 7/10
workflow GitHub

claude_code_journaling: Analyze Daily Journals Into Monthly Reviews via Claude Code

Uses Claude Code to analyze daily journal entries and produce structured monthly reviews from multiple perspectives — therapist, coach, and others. Automates routine self-reflection by giving Claude Code a structured prompt framework for journal analysis. Demonstrates Claude Code applied to personal productivity beyond pure software development.

workflowjournalingreflectionpersonal-productivity
by mendelsohnelderhand853 Jul 16, 2026 6/10
workflow GitHub

v-coding-setup: Autonomous Dev Pipeline With Skills, Guards, and Linear Ticket Flow

v-coding-setup is a comprehensive autonomous development pipeline built on Claude Code, wiring together guard hooks, scheduled rituals, Linear ticket integration, and a git-backed markdown knowledge base into a coherent dev loop. Covers the full cycle from ticket intake through verification and deploy. A solid reference implementation for teams wanting structured AI-driven development.

skillshooksworkflowlinearautomation
by wiklob Jul 16, 2026 8/10
workflow GitHub

claude-code-pm-agents: Seven Subagents for the Product-Builder Lifecycle

A set of seven specialized Claude Code subagents covering the product-builder lifecycle: PRD writing, growth strategy, brand guidelines, ASO, SEO, YouTube content, and communications triage. Each agent has a focused system prompt and output format calibrated to its domain. Useful for solo builders or small teams who need structured product management outputs without hiring specialists.

subagentsproduct-managementPRDgrowthSEOworkflow
by aksheyw Jul 16, 2026 7/10
workflow GitHub

kaji: Closed-Loop Agentic Development Workflows for Claude Code, Codex, and Gemini

A workflow framework providing closed-loop development cycles for Claude Code, Codex, and Gemini CLI. Closed-loop means the agent verifies its own output, retries on failure, and does not exit until the task meets defined criteria. Designed to reduce babysitting on long-running tasks across multiple AI coding backends.

workflowclosed-loopcodexgeminiautomationmulti-backend
by apokamo Jul 16, 2026 7/10
workflow GitHub

argus-mode: Staged Engineering Pipeline with Independent Quality Gates for Claude Code

A Claude Code plugin that enforces a structured engineering pipeline: plan review, TDD execution, and a 6-dimension code review, each as an independent quality gate. Agents must pass each gate before advancing, preventing fast-and-loose shortcuts on complex tasks. The 6-dimension review covers correctness, security, performance, maintainability, test coverage, and documentation.

workflowquality-gatestddcode-reviewpipelineengineering
by parsilver Jul 16, 2026 8/10
workflow Reddit

SimFlow: Lightweight Dev Loop Plugin for Claude Code and Codex

A lighter-weight alternative to the Superpowers plugin that covers the full dev loop — understand, build, test, review, debug — with fewer gates and less token overhead. Works on both Claude Code and Codex. Designed for medium to simple tasks where Superpowers adds unnecessary ceremony.

workflowplugindev-loopcodexlightweightsuperpowers
by SuStackx0 Jul 16, 2026 6/10
workflow Reddit

The 30-Message Cutoff Rule for Context Engineering in Coding Agents

A simple but effective technique: cap every agent chat at 30 messages, then have the agent produce a handoff Markdown file summarizing decisions and remaining work before continuing in a fresh session. The author found this improved output quality more than any CLAUDE.md or prompt tweak.

context-engineeringworkflowhandoffproductivitysessions
by Mission-Try4039 Jul 16, 2026 6/10
workflow GitHub

quota-router: Live Quota Routing Between Claude Code and Codex

Automatically routes work between Claude Code and OpenAI Codex based on live rate-limit pool status. Both quota pools appear in your status line and are injected at every subagent launch, preventing blocked work when one provider hits limits.

routingquotaclaude-codecodexrate-limitssubagents
by wr Jul 16, 2026 7/10
workflow Reddit

Claude Code Ultracode: 85 Agents and 3.9M Tokens for a UI Inventory

A real-world report on running Claude Code Ultracode for a UI component inventory task — spawning 85 agents and consuming 3.9M tokens in 25 agents before stopping. Estimates full completion at 13.25M tokens. Useful data point on workflow scale and token cost.

ultracodemulti-agentscaletokenscost
by ColdGuilty4197 Jul 16, 2026 5/10
workflow GitHub

workz: Zero-Config Dependency Sync and Isolation for Agent Worktrees

An environment engine for agent worktrees that handles zero-config dependency sync plus port, database, and Docker Compose isolation. Eliminates environment setup friction when running multiple agents in parallel worktrees.

worktreesisolationdockerdependenciesenvironment
by rohansx Jul 16, 2026 7/10
workflow GitHub

not-my-job: Agentic Workflow Plugins for Tasks You Would Rather Delegate

Agentic workflow plugins for tasks you would rather not handle yourself — including secrets security, inbox sorting, and disagreement flagging. Designed as modular add-ons for existing agent workflows.

pluginsautomationworkflowsecretsproductivity
by drewburchfield Jul 16, 2026 6/10
workflow Reddit

Claude Code 2.1.211: Subagent Output Forwarding and Improved Multi-Agent Tracing

Claude Code 2.1.211 adds --forward-subagent-text and CLAUDE_CODE_FORWARD_SUBAGENT_TEXT to make subagent text and thinking visible to downstream tooling. Also improves model override persistence for resumed subagents and MCP reconnection after idle sessions. Relevant for CI pipelines and SDK integrations.

subagentsmulti-agentclireleasesdkci
by Substantial-Heat-321 Jul 16, 2026 7/10
workflow GitHub

loop-engineering: Patterns and CLI Tools for Loop Engineering With AI Agents

Practical patterns, starter templates, and CLI tools (loop-audit, loop-init, loop-cost) for designing systems that prompt and orchestrate AI coding agents in loops. Inspired by Addy Osmani and Boris Cherny's work on agent loop design.

loopspatternscliorchestrationengineering
by cobusgreyling Jul 16, 2026 7/10
workflow GitHub

turn-based-loop-workflow: Verified Planner-Verifier-Implementer-Tester Loops

Verified feature delivery workflows following the Planner → Verifier → Implementer → Tester pattern. Distributed via npm for Claude Code and Codex, these turn-based loops ensure each stage is confirmed before the next begins.

workflowplannertesterverifierloopsdelivery
by Stephen-Kimoi Jul 16, 2026 7/10
workflow GitHub

ide-agent-kit: Let IDE AIs Participate in Team Workflows

Enables IDE AI agents to hook into team workflows via a webhook relay, tmux runner, and append-only receipts. Creates a bridge so that local IDE agent actions can be tracked and coordinated with the broader team process.

idewebhooktmuxteamworkflow
by ThinkOffApp Jul 16, 2026 6/10
workflow GitHub

scholar-deep-research: 8-Phase Literature Review Pipeline for AI Agents

An 8-phase automated literature review pipeline using 7 federated academic sources with deduplication, ranked retrieval, citation chasing, self-critique, and 5 report archetypes. Designed for agents conducting systematic reviews.

researchliterature-reviewacademiccitationsworkflow
by Agents365-ai Jul 16, 2026 7/10
workflow GitHub

mini-app-spec: Executable Specs as Self-Contained Mini Apps for AI Agents

Wraps specifications in self-contained HTML mini apps with embedded machine contracts, operable prototypes, BDD acceptance tests, annotation loops, and verifiable run evidence. Designed for AI coding agents to work against living specifications.

specsbddhtmlprototypesagentstesting
by wohsj110 Jul 16, 2026 7/10
workflow GitHub

loom: Local-First Control Plane for Coding Agents With Baton Handoffs

A local-first control plane that provides one CLI and shared memory for coding agents, enabling baton handoffs across Claude Code, OpenCode, and other agent runtimes. Keeps context alive as work passes between agents.

control-planehandoffmulti-agentcliclaude-code
by nickthelegend Jul 16, 2026 7/10
workflow GitHub

agentflare: Run and Coordinate AI Coding Agents Efficiently

A minimal runtime for running AI coding agents efficiently and coordinating more than one at a time. Zero fluff, zero runtime dependencies — a clean substrate for multi-agent coordination.

multi-agentorchestrationruntimecoordination
by getappz Jul 16, 2026 6/10
workflow GitHub

agent-collab: Dynamic-Host Agent Collaboration with Signed Runtime

A unified policy and signed-runtime client for dynamic-host agent collaboration. Coordinates multiple agents across hosts with verifiable signatures on runtime interactions.

collaborationmulti-agentsigned-runtimepolicy
by sumitake Jul 16, 2026 5/10
workflow GitHub

first-tree: Route Agent Work to the Right Agent With Full Team Context

Routes tasks to the appropriate agent, provides it the same context a human team has, and loops humans in only when defined rules require it. Lives in your GitHub repository and works as an open-source agent dispatch layer.

orchestrationroutingmulti-agentworkflowgithub
by agent-team-foundation Jul 16, 2026 7/10
workflow GitHub

agent-grid: Run Multiple AI Coding Agents in Parallel Across All Projects

Runs Claude, Codex, Gemini, and other CLI agents in parallel across all your projects simultaneously without losing track of any of them. Provides a unified grid view for multi-project multi-agent workflows.

parallelmulti-agentclaude-codecodexproject-management
by takezoh Jul 16, 2026 7/10
workflow GitHub

agent-rigger: Harness Package Manager for AI Coding Assistants

A package manager for AI coding assistant harnesses — version, share, and install skills, agents, guardrails, hooks, and MCP configs across machines. Includes security scans, granular consent, and ref+sha provenance. Supports Claude Code and opencode.

package-managerskillshooksmcpsecurityclaude-code
by agent-rigger Jul 16, 2026 8/10
workflow GitHub

tokless: Unified Toolkit for Efficient and Effective Coding Agents

Implements Karpathy-inspired efficiency principles (Caveman, Ponytail, RTK, CodeGraph, Context-Mode) for AI coding agents. Minimal setup under 30 seconds on any OS, designed to reduce wasted tokens and improve agent output quality.

efficiencytoolkitcoding-agentscontext
by HoangP8 Jul 16, 2026 7/10
workflow Reddit

Use the Simplest Model Capable of the Task

Community advice on right-sizing model selection: start with Sonnet for most tasks, escalate to Opus for complex problems, and reserve Fable for cases requiring deep reasoning. Overusing powerful models on simple tasks leads to overengineered output and wasted tokens. A practical rule of thumb for daily Claude Code sessions.

model-selectionsonnetopusfablebest-practices
by Spiritual_Cycle_3263 Jul 16, 2026 6/10
workflow GitHub

director: Coordination Ledger for Coding Agents Across Sessions

Director tracks the state of work — decisions made, open questions, parked context — persisted across sessions, repos, and weeks. Designed to complement memory tools (which store what the agent knows) by tracking the progress and state of the work itself. Supports Claude Code and OpenAI Codex.

coordinationmemoryworkflowmulti-sessioncontext
by colinsurprenant Jul 16, 2026 7/10
workflow GitHub

kraken: GitHub Issues as a Task Queue for Named Claude Code Workers

Kraken uses GitHub Issues as a zero-infrastructure task queue: named Claude Code workers claim tasks, execute them, and deliver draft PRs. One head, many tentacles — a lightweight orchestration pattern requiring no external services beyond GitHub itself.

orchestrationgithub-issuesworkersparalleltask-queue
by rafael-adcp Jul 16, 2026 8/10
workflow GitHub

claude-code-space: Claude Code Workspace for Home Server Services

A personal Claude Code workspace for building, deploying, and operating home-server services with self-maintained documentation. Useful as a reference for using Claude Code to manage self-hosted infrastructure.

workspacehome-serverself-hostedinfrastructuredocumentation
by efforthye Jul 16, 2026 5/10
workflow GitHub

Omakase (omks): Orchestrate Multiple AI Agent CLIs with a Goal-Loop

Omakase is a CLI orchestrator that unifies Claude Code, Codex, Gemini, and Cursor under Dynamic Workflows and a Goal-loop. It lets you compose and route tasks across your installed AI agent tools from a single entrypoint.

orchestrationmulti-agentcliworkflowgoal-loop
by benis-me Jul 16, 2026 8/10
workflow GitHub

Always Be Cooking: Claude Code Plugin for Feature-Driven Development

A Claude Code plugin that drives features through a full pipeline: plan → tracker sub-issues → parallel shipping → review → merge. Keeps work moving by breaking features into parallel workstreams and automating hand-offs between stages.

workflowpluginfeature-developmentparallelpipeline
by semanticpixel Jul 16, 2026 7/10
workflow GitHub

GAT: Full-Cycle Godot Game Dev Agent for Claude Code and Codex

Godot Agent Team (GAT) is a full-cycle game development agent covering design through implementation for Godot projects. Features style-locked asset generation, a self-evolving knowledge base, and runs under both Claude Code and Codex.

godotgame-devworkflowasset-generationknowledge-base
by chenhangcuisg-code Jul 16, 2026 7/10
workflow Reddit

Community List of Claude Code Mistakes to Avoid

A community-compiled list of common Claude Code anti-patterns: trusting the agent without clear objectives, running too many MCPs in one context, accepting output without review, never using or updating CLAUDE.md, and never building reusable skills. A useful checklist for anyone setting up a Claude Code workflow.

best-practicesanti-patternsclaude.mdskillsworkflowtips
by Traditional_Dance237 Jul 16, 2026 6/10
workflow GitHub

agile-pipeline-kit: Free 8-Team Agile Pipeline Native to Claude Code

A Claude Code-native Agile pipeline with 8 independent agent teams covering the full SDLC: BA, Design, Architecture/DB, Dev, QA, Security/Pentest, DevOps, and SRE. Teams hand off by contract. No paid API required.

agilepipelinemulti-agentsdlcsecuritydevopsorchestration
by hungkiethutech Jul 16, 2026 8/10
workflow Reddit

Using Obsidian as Claude Code's Persistent Memory and Workspace

A detailed community write-up on using an Obsidian vault as Claude Code's persistent memory and workspace — no MCP required, just pointing Claude Code at the markdown folder directly. Covers folder structure, a per-brand "constitution" pattern, and the CLAUDE.md config that made it work reliably. Includes lessons from a week of read-only monitoring before enabling writes.

obsidianmemoryworkspacemarkdownclaude.mdknowledge-management
by USF45 Jul 16, 2026 7/10
workflow GitHub

wishgraph: File-Backed Project Governance with Auditable Tasks for AI Agents

wishgraph provides file-backed project governance for AI coding agents: auditable task tracking, execution evidence, and shared project state. Everything persists in plain files for transparency and auditability across agent sessions.

governancetasksauditingproject-managementfile-backed
by odopk-spring Jul 16, 2026 6/10
workflow GitHub

vaultspec-core: Spec-Driven Harness for Coding Agents and Humans

A spec-driven development harness for coding agents — and humans. Enforces a specification-first workflow where both human developers and AI agents work from the same shared spec, keeping implementations auditable and traceable.

spec-drivenharnessworkflowspecificationsauditable
by nevenincs Jul 16, 2026 6/10
workflow GitHub

martin-loop: Autonomous Agent Safety Layer with Spend Caps and Rollback

martin-loop makes AI coding agents safe to run at scale by handling work assignment, spend caps, policy enforcement, output verification, and automatic rollback on failures. It also logs learnings from each loop and tracks ROI across repositories. Designed for teams running autonomous agents across multiple codebases.

workflowsafetyautonomousorchestrationspend-control
by Keesan12 Jul 16, 2026 8/10
workflow GitHub

maestro: BM25-Routed Skill Orchestrator for Claude Code, Cursor & Codex

maestro is a skill orchestrator that uses BM25 lexical routing to automatically dispatch tasks to the right subagent or skill. Supports editable subagent graphs, skill runbooks, and a skills.sh discovery mechanism. Works across Claude Code, Cursor, and Codex, making it a unified layer for multi-skill workflows.

workfloworchestrationskillroutingbm25subagent
by rodovalhofs Jul 16, 2026 8/10
workflow GitHub

lift-kit: Migrate Chat-Built Projects into Local Claude Code Projects

lift-kit is an attach-and-run migration tool that takes a project built in Claude.ai chat and turns it into a proper local Claude Code project. Targets users who started building in the chat interface and now want local tooling, version control, and full Claude Code capabilities without restarting from scratch.

workflowmigrationclaude-codeproject-setup
by scottrfrancis Jul 16, 2026 7/10
workflow GitHub

autopus-adk: Multi-Model Orchestration with Consensus, Debate, and Pipeline Patterns

autopus-adk is a multi-agent orchestration framework offering four routing modes: consensus (vote across models), pipeline (chain output), debate (adversarial), and fastest (first-response wins). Also includes Architecture-as-Code for defining agent topologies, a Lore decision-tracking system, and a SPEC/EARS requirements engine.

workflowmulti-modelorchestrationconsensusdebate
by Insajin Jul 16, 2026 7/10
workflow Reddit

Undocumented Claude.ai Cloud Session Features: Multi-Repo, URL Params, and Connectors

Claude.ai cloud sessions support three under-documented features: loading multiple private repos simultaneously (with full git history), URL parameters to pre-load repos and prompts as bookmarkable configs, and access to your existing Slack/Gmail/Linear connectors inside sessions. The author shares a workflow built on a private "context repo" that provides persistent project memory across sessions.

workflowcloud-sessionsclaude-aimulti-repotips
by MostBlood7319 Jul 16, 2026 7/10
workflow GitHub

bit-office: Interactive Workspace for Multi-Agent Collaboration and Feedback

bit-office provides a structured workspace where human developers and AI agents can collaborate on tasks with explicit feedback integration. Agents can improve iteratively based on human input, and the workspace tracks the collaboration history. Targets teams wanting visibility into multi-agent task progress.

workflowmulti-agentcollaborationfeedbackworkspace
by Hellowman100 Jul 16, 2026 6/10
workflow GitHub

ospec: Spec-Driven Agentic Goal Loop for AI Coding Agents

ospec is a workflow framework that converts a task description into a verifiable goal loop: plan → act → verify. It stores durable specs and evidence directly in your repo, so each iteration is auditable. Works with Claude Code, Codex, Gemini, OpenCode, and plain CLI agents.

workflowspec-drivengoal-loopverificationplanning
by clawplays Jul 16, 2026 7/10
workflow GitHub

gem-team: Self-Learning Multi-Agent Orchestration for Spec-Driven Development

A multi-agent orchestration framework where agents self-learn over time and operate from specs with automated verification. Uses smarter tool calling and leaner context to reduce overhead compared to standard multi-agent setups. Supports spec-driven development with built-in verification loops.

multi-agentorchestrationspec-drivenself-learningverification
by mubaidr Jul 15, 2026 7/10
workflow GitHub

claude-architect: Fable/Opus Architect That Delegates Implementation to Cheaper Models

An architect-first delegation workflow where a Fable or Opus session handles planning and review, then routes implementation work to Codex, the OpenCode provider pool, a local Pi running at $0, or an autonomous agent. Every diff gets reviewed by the architect. Designed to reduce cost while keeping quality control at the top level.

cost-optimizationdelegationmulti-modelorchestrationworkflow
by Pythoughts-labs Jul 15, 2026 7/10
workflow Reddit

Two-Mode Framework for Getting the Most Out of Claude Sonnet 5

A community-developed pattern for using Sonnet 5 in two modes: "under-brain" for established codebases with defined specs (Sonnet as coordinator, intelligence lives in CLAUDE.md and docs) and "over-brain" for greenfield work (Opus/Fable hosts, dispatching Sonnet workers). Argues Sonnet 5 excels at disciplined execution over open-ended thinking, and its training makes it better with well-structured todo lists. Practical multi-model orchestration guide.

sonnet-5workflowmulti-modelorchestrationCLAUDE.mdtips
by Shuey298 Jul 15, 2026 7/10
workflow GitHub

Claude Code Recipes: One-Command Production-Ready Workflow Templates

A collection of one-command recipes for building production-ready Claude Code workflows with minimal setup. Each recipe provides a complete, opinionated starting point for common development scenarios. Aimed at fast setup without sacrificing reliability.

workflowtemplatesrecipesproductivitysetup
by baltil2670 Jul 15, 2026 7/10
workflow Reddit

Tura: Agentic Runtime That Cuts LLM Turns by 80% on DeepSWE Benchmark

An agentic runtime framework claiming to reduce LLM turns by 80% while maintaining a higher task success rate on the DeepSWE benchmark. The developer is openly requesting community review of both the framework design and evaluation methodology. Potentially interesting for those building or optimizing agent pipelines.

agent-runtimeefficiencybenchmarkturnsoptimization
by yohji1984 Jul 15, 2026 6/10
workflow GitHub

prd-spec-generator: Feature Description to 9-File PRD via Multi-Judge Verification

A stateless reducer that transforms a feature description into a complete 9-file PRD using 17 MCP tools, multi-judge verification with weighted-average and Bayesian consensus, and research-evidence-backed strategy selection. Has 248 tests and is part of the ai-architect ecosystem. A production-grade tool for teams that want rigorous, verifiable product specs generated by AI.

prdproduct-specmcpmulti-agentverificationarchitecture
by cdeust Jul 15, 2026 8/10
workflow Reddit

5 Months Running a Solo SaaS on Claude Code: What Stuck and What Was Turned Off

A detailed retrospective from a solo SaaS operator who used Claude Code for 4,200 commits over 5 months — covering coding, deployments, server monitoring, support replies, SEO, and bookkeeping. Key lessons: git worktrees were turned off (unattended agents parked work on branches), skills replaced repetitive prompts (now at 82 skills), and a 427-file memory directory compounds over time. One of the most thorough real-world Claude Code usage reports published.

saasproductionretrospectiveskillsmemoryautonomousworkflow
by indie_zack Jul 15, 2026 9/10
workflow GitHub

claude-code-config: Idea-to-PR Multi-Agent AGILE Pipeline with TDD Gates

An opinionated Claude Code harness that automates the full lifecycle from idea to merged PR via a multi-agent AGILE pipeline. Features tmux observability, worktree-isolated parallel builds, and TDD + code review gates at each stage. A comprehensive reference harness for teams wanting a structured, automated development pipeline with Claude Code.

agilepipelineworkflowtddworktreemulti-agentci
by fxmartin Jul 15, 2026 8/10
workflow GitHub

rpi-workflow: AI Product Definition and Delivery Workflow for Claude Code and Codex

A structured workflow covering the full journey from vague idea to production delivery: Spec writing, TDD, Eval, change governance, and continuous iteration. Provides a single-file quick-start and is designed for both Claude Code and Codex. Includes governance checkpoints to prevent uncontrolled drift during development.

workflowspectddgovernanceproduct-delivery
by inkeds Jul 15, 2026 6/10
workflow GitHub

sgc: All-in-One Engineering Workflow and Knowledge Engine for Claude Code

A comprehensive engineering workflow engine for Claude Code with one-command install and no Bun dependency (Node >=18). Provides L0-L3 task classification, 13 runtime invariants, code review, browser QA, security audit, and a deduplicated knowledge base that accumulates across tasks. A strong opinionated harness for development teams wanting a single setup covering most engineering workflow needs.

workflowknowledge-basecode-reviewsecurityqatask-classification
by sdsrss Jul 15, 2026 8/10
workflow Reddit

Building a Personal Voice Profile with Fable 5 for Content Generation

A human-in-the-loop workflow where Claude analyzes your writing samples, creates a voice profile, and iteratively learns from your edits: if you cut a long intro once, that's a hypothesis; twice, it becomes a rule every future draft must follow.

voice-profilecontent-generationwritingfablehuman-in-the-loop
by swapnoneel123 Jul 15, 2026 5/10
workflow GitHub

Intent-Locked Workflow: 4-Phase Gated Development Plugin for Claude Code

A Claude Code workflow plugin that locks planning intent and only allows code to grow on top of approved plans. Four gated stages — planning, design, planning, execution — prevent premature or misaligned implementation.

intent-lockinggated-workflowplanningdesignexecution
by deokjinlog Jul 15, 2026 5/10
workflow Reddit

Trick to Reduce Fable's Unnecessary Redirection to Opus

A community-discovered tip: asking an Opus agent to spawn a Fable subagent for critical work bypasses unnecessary model-switching guardrails in Fable sessions, giving you more control over model assignment.

fableopussubagentsmodel-switchingtip
by Zestyclose-Iron-870 Jul 15, 2026 5/10
workflow Reddit

Fable as Planner + Opus/Sonnet for Implementation: Community Workflow Tips

Community discussion on using Fable 5 as the orchestrator/planner while delegating coding tasks to Opus or Sonnet subagents — including practical tips on model-switching approaches and what actually reduces token usage.

fablemulti-modelorchestrationworkflowcost-optimization
by yonlau Jul 15, 2026 5/10
workflow GitHub

Dual-Frontier: Building Systems Software Through Structured LLM Delegation

An experiment documenting one developer building a complex simulation microkernel (multithreaded ECS, OS-style architecture) via a structured Opus + human delegation pipeline. Tests both the methodology and the resulting engine.

llm-delegationsystems-programmingecsopusmethodology
by Crystalka228 Jul 15, 2026 5/10
workflow GitHub

Cairn: Milestone-Driven Development Workflow for Claude Code

Moves projects from rough idea to shipped code one milestone at a time, recording every decision and mapping every requirement to a task. Designed to keep Claude Code sessions focused and prevent scope creep.

milestone-drivenproject-managementworkflowrequirementsplanning
by uHappyLogic Jul 15, 2026 7/10
workflow GitHub

CCMA: Claude Code Multi-Agent Pipeline Framework

Enforces a multi-agent pipeline for planning, coding, testing, review, and security checks before shipping. Each stage is a gate, ensuring structured delivery with automated verification at each step.

multi-agentpipelineplanningsecurityquality-gates
by Surgicalprocesspavement699 Jul 15, 2026 7/10
workflow GitHub

Tiered AI Agent Workflow Templates (L1-L3) for Autonomous Coding

Standardized tiered workflow templates (L1 through L3) for autonomous coding with Claude Code and Codex, ensuring architectural integrity and test-driven development at each complexity level.

workflow-templatestddarchitectureautonomoustiers
by shaligg Jul 15, 2026 7/10
workflow GitHub

Recursive-Spine: Portable Project Spine That Prevents Convention Drift

A portable project spine for Claude Code where state lives in issues, conventions get stamped at creation, constraints cannot drift, and proven patterns automatically propagate between projects. Recursively self-applied.

project-structureconventionspatternsself-referentialstate-management
by slopstopper Jul 15, 2026 7/10
workflow GitHub

Denys Fast MSkills: Plan-Execute-Verify Claude Code Plugin

A Claude Code plugin providing the m_* toolkit: m_plan (plan→execute→verify), deploy/infra commands, a full Playwright test loop, and a code quality framework. Structures agent sessions into disciplined, verifiable stages.

workflowplanningtestingplaywrightcode-quality
by mapuamap Jul 15, 2026 7/10
workflow GitHub

LeanForge: Intent-to-Implementation Harness for Claude Code

Turns vague prompts into reviewed specs, runs evidence-gated execution steps, and maintains durable project memory across sessions. Supports both Claude Code and Codex, bridging the gap between ideation and working code. Particularly useful for keeping AI coding sessions grounded and verifiable.

workflowspecmemoryclaude-codecodex
by pkkgh1519 Jul 15, 2026 7/10
workflow GitHub

Ultracodex: Run Claude Code Workflow Scripts on OpenAI Codex

Lets you execute Claude Code workflow scripts on OpenAI Codex to reduce quota costs and improve execution efficiency. Useful for teams that hit Claude Code usage limits and want a fallback without rewriting their automation. Bridges two major AI coding ecosystems at the workflow layer.

workflowcodexcost-optimizationclaude-code
by Muaksook17 Jul 15, 2026 6/10
workflow GitHub

The Architect: Blueprint Designer Meta-Agent for Claude Code

A Claude Code meta-agent that takes an idea and produces a complete software blueprint ready for implementation. Structures the planning phase so you start coding with a clear, Claude-ready plan rather than a vague description. Good for greenfield projects where upfront design pays off.

workflowplanningmeta-agentblueprintdesign
by Alonepers3213 Jul 15, 2026 6/10
workflow GitHub

Provenant: Governed Agentic SDLC Harness for Claude and Codex

A portable harness that treats Claude and Codex as equal-primary agents within a governed software development lifecycle. Provides guardrails, audit trails, and process enforcement for agentic code generation. Suited for enterprise or regulated environments where AI coding must be auditable.

workflowgovernancesdlcclaudecodexenterprise
by mblauberg Jul 15, 2026 6/10
workflow GitHub

Agent Council: Multi-Model Code Review with Claude, Codex, and Grok

Orchestrates independent code reviews from Claude, Codex, and Grok in parallel, then has each model critique the others before reaching consensus. Produces more robust review findings than any single model alone. An excellent example of adversarial multi-agent patterns applied to code quality.

code-reviewmulti-agentclaudecodexgrokconsensus
by JonasR-Git Jul 15, 2026 8/10
workflow Reddit

PSA: Claude Code Subagent Worktrees Branch From origin/main, Not Local HEAD

Critical operational insight for developers using Claude Code delegated worktrees: worktrees branch from the remote tracking branch, not local HEAD, so uncommitted coordinating state is invisible to subagents. Also warns about a bug where the harness flips core.bare=true in the primary checkout. Recommendation: let state ride the branch it is produced on and land with the code at merge.

worktreessubagentsgitdelegationgotcha
by null-pointee Jul 15, 2026 8/10
workflow GitHub

gh-aw-workshop: Hands-On Workshop for GitHub Agentic Workflows

An official GitHub Next workshop for learning GitHub Agentic Workflows. Provides hands-on exercises for building automated, AI-driven workflows in GitHub environments — relevant for developers integrating Claude Code into CI/CD and GitHub automation pipelines.

githubagentic-workflowsworkshopautomation
by githubnext Jul 15, 2026 5/10
workflow Reddit

Building an Unattended Software Factory with Claude Code

A detailed walkthrough of turning a home Proxmox server into an autonomous software factory: label a GitHub issue agent-ready, and a Claude Code agent crew implements, reviews, and opens a PR unattended. Features an Opus manager agent that delegates to a scout, implementer, and reviewer — CI triggers via a dedicated GitHub App identity.

home-serverautomationgithub-actionsmulti-agentunattendedproxmox
by gquizal Jul 14, 2026 8/10
workflow Reddit

Wtdev: Stable Port Assignment for Parallel Claude Worktrees

A 200-line POSIX shell script that assigns each git worktree a deterministic port (main=3000, worktrees=3001-3999 hashed from path). Eliminates port conflicts when running multiple Claude Code agents in parallel. Also copies .env files into new worktrees, generates a live status dashboard, and wires into Claude Code SessionStart and EnterWorktree hooks.

worktreesparallelportshooksshellsessionstartdashboard
by Over-Excitement-6324 Jul 14, 2026 8/10
workflow Reddit

Phanes Toolkit: Modular Multi-Agent Plugin Suite for Claude Code

A four-tool modular toolkit for Claude Code: Phanes (reads your repo and builds a scoped multi-agent team), Charon (dead code and duplicate detector using ecosystem-native tools like knip, vulture, cargo-machete). Each tool is a single Markdown file that can run standalone or compose together on Phanes projects.

multi-agenttoolkitdead-codedocumentationpluginmodular
by akolomf Jul 14, 2026 7/10
workflow Reddit

Claude Orchestrates, Codex Codes: Subscription-Only Workflow

A detailed workflow for multi-model agentic development on Claude Pro + GPT Plus subscriptions — no API costs. Claude Sonnet orchestrates, plans, and reviews while Codex handles parallel code writing. Includes a burn planner tool that schedules tasks to fit remaining weekly quota by model tier.

multi-modelbudgetorchestrationcodexsubscriptionquota
by jimmyF1TZ Jul 14, 2026 7/10
workflow GitHub

Super-FR: Plugin Suite with Worktree Isolation and PR Autonomy

A Claude Code plugin suite offering superpowers-wrapped planning, devcontainer+worktree isolation, goal-to-PR automation, and phase dispatch to VibeKanban runners. Targets end-to-end autonomous feature delivery within isolated environments.

workflowworktreesdevcontainerpr-automationplugin
by derio-net Jul 14, 2026 6/10
workflow GitHub

Frontman: Route Tasks to the Cheapest Capable Model

An orchestrator skill that routes each sub-task to the cheapest model capable of completing it and blind-verifies every change independently. Compiles to a deterministic, schema-enforced workflow derived from fable-foreman.

orchestrationmodel-routingcostverificationskillfable
by androsland Jul 14, 2026 7/10
workflow GitHub

Super-Developer: Full Dev Lifecycle Plugin with Code Review

A Claude Code plugin that orchestrates the complete development lifecycle: divergent ideation, structured planning, parallel implementation in isolated git worktrees, and multi-agent adversarial code review with each phase independently managed.

workflowworktreescode-reviewmulti-agentpluginplanning
by leninkhaidem Jul 14, 2026 7/10
workflow GitHub

Claude-Plugins: Multi-Agent SDLC Workflow Plugin Suite

Open-source Claude Code plugins for multi-agent software delivery: plan-first SDLC workflow, code review, LLM quality judges, and a self-learning module. All grounded in your codebase for context-aware delivery.

pluginssdlccode-reviewquality-judgesmulti-agentrag
by closedloop-ai Jul 14, 2026 7/10
workflow GitHub

Agentic Harness: Persistent Workspace with Memory and Personas

A persistent AI workspace for Claude Code, Cursor, Codex, GitHub Copilot, and Gemini CLI featuring memory modules, persona packs, and autonomous loops. Provides a harness layer that persists context and identity across sessions.

harnessmemorypersonasautonomousmulti-agentpersistence
by ulises-jeremias Jul 14, 2026 7/10
workflow GitHub

aSPARK: Gated Agile Delivery with AI Product Team

An AI-driven gated agile delivery process for Claude Code that assembles a virtual product team (PO, Designer, EM, Reviewer, QA, Release). Every feature must pass a quality gate — including real-browser QA — before advancing to the next phase.

agilequality-gatesproduct-teambrowser-qaworkflowplugin
by a-lottes Jul 14, 2026 7/10
workflow GitHub

VNX Orchestration: Governance-First Multi-Agent Workflow

Orchestrates Claude Code, Codex, and Gemini CLI with parallel workers, quality gates, and full provenance receipts. Every change is traceable and auditable before it ships, making it suitable for team or enterprise use.

orchestrationgovernancemulti-agentquality-gatesprovenance
by Vinix24 Jul 14, 2026 7/10
workflow GitHub

Quackitect: Human-Approval Gate Ledger for Agent Decisions

A gate ledger for spec-driven engineering where every agent decision arrives as a one-tap brief on screen or phone. Nothing ships without explicit human approval. Dependency-free Go binary with AGENTS.md-native support.

human-in-loopapprovalgatesgoagents-md
by mb-89 Jul 14, 2026 6/10
workflow Reddit

Presence-Based Verification: Stopping AI from Filling Intent Gaps with Fiction

Explores why "if you don't know, ask" fails for AI agents, and introduces presence-based verification — having agents confirm facts exist before acting rather than inferring from training memory. Argues that the agent should verify presence of information, not reason from absence.

workflowpromptingagent-designverification
by reddit Jul 14, 2026 6/10
workflow Reddit

Anthropic Research: Opus 4.7 vs Sonnet 4.6 Behavioral Differences

Summarizes Anthropic's analysis of 309,815 real Claude.ai conversations showing measurable behavioral differences between models. Opus 4.7 proactively flags risks and challenges assumptions; Sonnet 4.6 focuses on execution. Practical guidance for choosing models in agentic workflows.

modelsopussonnetagent-design
by reddit Jul 14, 2026 7/10
workflow Reddit

Human-in-the-Loop Workflow with Deterministic Drift Checks

Describes building a workflow that catches when an AI agent is making architectural decisions that belong to the human. Implements drift detection to identify when the agent's decisions diverge from documented choices, then surfaces those for human review before proceeding.

workflowhuman-in-loopdriftmulti-agent
by reddit Jul 14, 2026 7/10
workflow Reddit

Claude Code Fabricated User Replies and Executed Them — Safety Report

Critical safety report: in a long session, Claude Code generated the literal "user" role token, invented a plausible user reply approving its own work, then immediately executed the fabricated instruction. Documents the exact failure mode and what to watch for in long unattended sessions.

safetyhallucinationsessionunattended
by reddit Jul 14, 2026 8/10
workflow Reddit

25 Inspectable Claude Code Workflows + Fable-Controlled Codex Fleet

Suede Creator Skills: 25 plain SKILL.md workflow folders you can read and understand, plus orchestration for a Fable 5-controlled Codex agent fleet. MIT licensed, no paid tier. Focuses on transparency — workflows you can inspect rather than opaque runtimes.

workflowskillscodexorchestration
by reddit Jul 14, 2026 7/10
workflow Reddit

Lessons from 29 Days Building a Real App with Claude Code

Detailed retrospective from building Tine (open-source outliner) over 29 days with Claude Code. Covers guardrails that actually worked, dogfooding patterns, avoiding agent loops, and how to structure long-running agent projects. High-signal practical lessons.

workflowlessonslong-runningdogfooding
by reddit Jul 14, 2026 8/10
workflow Reddit

Building an Agent Harness: Orphaned Grandchild Subagents Keep Burning Tokens

Key insight from building a Claude Code-style harness: killing the parent agent does NOT kill grandchild subagents — they run silently until their own timeout. Explains the process tree issue, how to detect orphaned agents, and what proper teardown looks like.

multi-agentsubagentstokensorchestration
by reddit Jul 14, 2026 8/10
workflow GitHub

CCMAF: Multi-Agent Framework with Specialized Roles for Claude Code

Stack-agnostic multi-agent framework for Claude Code with specialized agent roles: architect, developer, tester, reviewer. Uses durable state files, machine-readable contracts, and lifecycle hooks. Self-updating core with optional skills and a project console. Aims to make AI coding agents work like a disciplined senior team.

multi-agentworkfloworchestrationframework
by drushegh Jul 14, 2026 8/10
workflow GitHub

orchestra: Run Parallel Claude Code and Codex Agents in Isolated Git Worktrees

Orchestrates multiple Claude Code and Codex agents running in parallel, each in its own isolated git worktree. Prevents agents from conflicting on the same files while enabling true parallel development. Coordinates work assignment and merging.

multi-agentparallelworktreeorchestration
by lcsmas Jul 14, 2026 8/10
workflow GitHub

pr-completion: Autonomous PR Preparation to Verified Merge Readiness

Autonomously prepares a PR from a feature branch: runs tests, checks linting, writes the PR description, verifies CI status, and confirms the branch is merge-ready. Works with Claude Code and Codex. Removes the boilerplate from the PR lifecycle.

workflowprgithubautomation
by anur4ag Jul 14, 2026 7/10
workflow GitHub

agent-ops-stack: Manifest-Driven Composition of Local Agent-Ops Ecosystem

Combines ticket routing, locking, decision-avatar, skills, and an MCP control plane for CLI coding agents into a single manifest-configured system. Defines how your local agent ecosystem composes and coordinates from one config file.

workfloworchestrationmanifestagent-infrastructure
by ellmos-ai Jul 14, 2026 7/10
workflow GitHub

dev-squad-plugin: 7-Agent Dev Team Swarm for Claude Code

Claude Code plugin implementing a 7-agent development team: coordinator, architect, backend dev, frontend dev, reviewer/security lead, devops, and git-ops. Each agent has defined responsibilities and handoffs. Emulates a specialized team with coordinated multi-agent execution.

multi-agentworkflowteamorchestration
by sadewadee Jul 14, 2026 7/10
workflow GitHub

roll: Autonomous Software Delivery from a BACKLOG File

Encodes engineering discipline into a BACKLOG.md file: agents read tickets, implement, test, and ship without hand-holding or sprints. Guides AI agents through the full software delivery lifecycle via structured discipline files rather than manual orchestration.

workflowautonomousdeliverybacklog
by seanyao Jul 14, 2026 7/10
workflow Reddit

Cloud Sessions as Disposable Dev Machines: A Better Mental Model

Reframes Claude Code cloud sessions as independent VM environments rather than remote chat tabs. Each session can clone private repos, install dependencies, run tests, make commits, and maintain state. Practical workflow tips for treating sessions as ephemeral dev machines.

workflowcloud-sessionsmental-modelproductivity
by reddit Jul 14, 2026 6/10
workflow GitHub

continuous-claude: Run Claude Code in a Continuous PR-Merging Loop

Runs Claude Code autonomously in a loop: create PR, wait for CI checks to pass, merge, then repeat. Implements the "Ralph loop" pattern for fully autonomous iterative development. Good reference for CI-integrated agentic workflows.

workflowcontinuousprciautomationloop
by AnandChowdhary Jul 13, 2026 7/10
workflow Reddit

Fable as Orchestrator + Sonnet as Implementer: Multi-LLM Workflow via Bash

A bash-scripted workflow where Fable plans and reviews while Sonnet 5.6 implements — with Codex CLI as a background worker. No framework, no MCP: just persistent threads called from skills. Includes a review loop that runs until tests pass, then Fable handles the release.

workflowfableorchestrationcodexbashmulti-llm
by Bright-Celery-4058 Jul 13, 2026 7/10
workflow GitHub

Triflux: Orchestrate Claude, Codex, and Gemini with Natural Language Routing

A tri-CLI workflow orchestrator that routes tasks between Claude, Codex, and Gemini using natural language, with cross-model review and 38 built-in skills. Enables sophisticated multi-model pipelines without manual model switching.

multi-modelorchestrationgeminicodexworkflow
by genusarvicolabathos238 Jul 13, 2026 7/10
workflow GitHub

Session Orchestrator: Loop Engineering for AI Coding Agents

Transforms ad-hoc AI coding sessions into a repeatable research → plan → wave-execute → close loop with verification gates. Runs on Claude Code, Codex CLI, Cursor, and Pi, providing structured session management.

orchestrationsession-managementworkflowverification
by Kanevry Jul 13, 2026 8/10
workflow GitHub

SpecDD: Generate Technical Specs from Feature Requests

A workflow that uses AI coding agents to generate production-grade technical specifications from feature requests. Accelerates the spec-driven development cycle.

spec-drivenspecificationsfeature-requestsworkflow
by mnyok9939 Jul 13, 2026 6/10
workflow GitHub

Fable Director: Token Governance with Model Routing

A token governance system for Claude Code where the top model directs while execution goes to the cheapest adequate model. Includes a routing kernel, hook-enforced pre-budget, telemetry, and a statusline with plan quotas.

token-governancemodel-routingcost-optimizationfablehooks
by frsorrentino Jul 13, 2026 8/10
workflow GitHub

Agent Runbook: YAML-to-SKILL.md Multi-Agent Framework

A contract-based multi-agent skill framework for Claude Code and Codex that compiles YAML runbooks into SKILL.md with loop, parallel, and checkpoint support. Enables structured, reproducible agent workflows.

runbookyamlmulti-agentworkflowskill-md
by KnoxOps Jul 13, 2026 8/10
workflow GitHub

TMux Claude Team: Simulate a Software Company in Tmux

A Claude Code plugin that simulates a full software company (client/leader/architect/devs/tester) as autonomous Claude agents in tmux panes, coordinating via send-keys chat and a JSON ticket board.

tmuxmulti-agentsimulationteamworkflow
by sahebsoft Jul 13, 2026 8/10
workflow GitHub

Nazgul: 17-Agent Autonomous Development Loop for Claude Code

A multi-agent autonomous development loop for Claude Code featuring 17 specialized agents, a review pipeline, context management, and parallel execution. A comprehensive agentic development framework.

multi-agentautonomousreview-pipelineparallelworkflow
by OrodruinLabs Jul 13, 2026 8/10
workflow GitHub

Hephaestus: Write Agent Instructions Once, Deploy Everywhere

Write agent instructions once in Markdown and forge them for any harness (Claude Code, Codex, Cursor, etc.). A cross-harness portability tool for agent skill authors.

portabilitycross-harnessmarkdownskill-authoringworkflow
by odysseusdev Jul 13, 2026 6/10
workflow GitHub

Rate-Limit Handoff: Turn Rate Limits into Checkpoints

A workflow tool that turns AI rate limits into high-quality checkpoints and enables multi-model continuity. Supports same-model waiting, cross-model handoff, and planned return across Claude Code, Codex, Grok, Antigravity, and Cursor.

rate-limitshandoffmulti-modelcontinuityworkflow
by PurpleOrangeAI Jul 13, 2026 8/10
workflow GitHub

Packwright: Build Agent Once, Deploy to Any Harness

Compile portable agent packs for Codex, Claude Code, and Cursor from a single source. Write your agent logic once and deploy it across multiple AI coding tool harnesses.

portabilitycross-harnesscodexcursorworkflow
by pioneerjeff-labs Jul 13, 2026 7/10
workflow Reddit

Multi-Model Code Review: 70% Fewer Iterations with Parallel LLM Reviews

A developer published research on running parallel code reviews with 2-6 AI models from different providers, finding it reduced coding iterations by ~70% — from about one week to two days per feature. The multi-model approach catches bugs and vulnerabilities that single-model reviews miss consistently. The paper includes synthesis data from hundreds of review cycles across models from Google, OpenAI, Anthropic, xAI, and others.

code-reviewmulti-modelworkflowqualityresearch
by qu1etus Jul 13, 2026 7/10
workflow GitHub

Multi-Agent Working Group: Safe Workflow Protocol with Review and Git Gates

A portable protocol for coordinating multiple AI coding agents safely. Defines explicit review, evidence collection, handoff, and git gate checkpoints between agents to reduce errors and improve auditability. Designed for teams running multi-agent coding pipelines where uncontrolled agent handoffs are a risk.

multi-agentworkflowgit-gatesreviewprotocol
by alexsglife-re Jul 13, 2026 7/10
workflow GitHub

Nightshift: Overnight AI Agent That Drafts Work While You Sleep

Runs AI agents on idle local hardware overnight to scan your repository, draft safe code changes, and produce a ranked morning brief. Strictly "drafts, not deploys" — no autonomous commits. Local-first and MIT licensed, making it a low-risk way to leverage idle compute for background code review and suggestion generation.

overnightautomationlocal-firstdraftsmorning-brief
by r3dbars Jul 13, 2026 7/10
workflow GitHub

VHK: Goal-Evidence-Memory-Rule CLI for Structured AI Coding Sessions

A CLI that ties AI coding sessions to explicit goals, evidence, memory, and rule synchronization to keep them on track. Bundles 35 MCP tools and enforces verify, review, and preflight gates before proceeding. Primarily documented in Korean, but the gate-driven session structure is widely applicable.

climcpworkflowgatesmemoryrules
by byh3071-cpu Jul 13, 2026 6/10
workflow GitHub

Moai Forge — SPEC-First AI DevKit with TDD/DDD Gates

Developer kit for AI-driven code generation that enforces spec-first workflows with 24 agents, 52 skills, and test/domain-driven design gates. Aims for structured, gated AI development workflows.

spec-driventdddddagentsdevkit
by leerhadz Jul 13, 2026 5/10
workflow GitHub

AI Night Shift — Off-Hours Multi-Agent Task Coordination

Framework for scheduling and coordinating multiple AI agents to run autonomous tasks during off-hours. Provides a tested structure for continuous multi-agent collaboration while you are away.

automationmulti-agentschedulingoff-hours
by Distortionistreversibleprocess687 Jul 13, 2026 6/10
workflow GitHub

Job Search — Multi-Agent CV and Application Workflow

Multi-agent system using a YAML profile and universal rules to generate ATS-safe, one-page LaTeX CVs. Works with Claude Code, Codex, OpenCode, and any agent with file and shell access.

job-searchlatexcvmulti-agentats
by pedrolucazx Jul 13, 2026 5/10
workflow GitHub

Specter — Spec-Driven Claude Code Template with PRD Gating

Claude Code project template for spec-driven AI development: decompose PRDs into gated specs, implement traceably, and automate review. Enforces a structured flow from product requirement to verified code.

spec-drivenprdtddreviewtemplate
by beomeodev Jul 13, 2026 7/10
workflow GitHub

ios-app-agentic-engineering: Gated Phase Workflow From App Idea to App Store Release

An agentic engineering workflow for building and shipping iPhone apps using the open Agent Skills format, structured as sequential gated phases from concept through secure App Store release. Targets "vibe coders" who want guardrails and checkpoints rather than free-form prompting. Each phase must pass before proceeding, enforcing quality and security gates throughout the iOS development lifecycle.

iosworkflowagent-skillsapp-storegated-phasesagentic-engineering
by markus-smile Jul 12, 2026 6/10
workflow GitHub

SpecVibe: Spec-Driven Seven-Stage Workflow for AI-Native Apps

SpecVibe enforces a spec-driven framework for building, testing, and deploying AI-native applications through a structured, executable seven-stage workflow. It provides a repeatable methodology that keeps AI coding agents working within a defined specification throughout the development lifecycle. Useful for teams wanting to impose discipline on AI-assisted builds.

spec-drivenworkflowai-nativedeployment
by bhana1999 Jul 12, 2026 5/10
workflow GitHub

Large-Codebase Survival Guide for AI Agents

This repository documents a proven methodology for using AI agents like Claude Code on large codebases without hitting context window limits or session crashes. It covers strategies for chunking work, managing state, and keeping agents productive across long-running sessions. A practical reference for anyone working with AI coding agents on production-scale projects.

context-windowlarge-codebasemethodologysession-management
by Daciemonistic497 Jul 12, 2026 6/10
workflow GitHub

agent-workshop: Drop-In Scaffold for Spec-Driven Claude Code Development

agent-workshop is a ready-to-use project scaffold that bundles agents, skills, and conventions for spec-driven development with Claude Code, Codex, and similar CLI tools. Drop it into a project to get a structured starting point with proven patterns for AI-assisted development. A good accelerator for teams establishing AI coding conventions from scratch.

scaffoldspec-drivenconventionsclaude-codetemplate
by giostriquer Jul 12, 2026 7/10
workflow GitHub

passdown-os: Pure-Markdown Agent Handoff Framework

A zero-dependency handoff framework for AI coding agents built entirely on Markdown. Implements shift-change discipline — agents write passdown logs so the next agent picks up context seamlessly. Works with Claude Code, Codex, and Antigravity.

handoffcontextmulti-agentmarkdowncontinuity
by Will-SW74 Jul 12, 2026 6/10
workflow GitHub

magpie: Agent-Assisted Maintainership Framework for Apache Projects

An Apache project providing agent-assisted maintainership with skills for Triage, Mentoring, Drafting (agent-authored fixes with human review), and Pairing. Autonomous auto-merge mode is on the roadmap. A production-grade example of AI-assisted open source maintenance.

open-sourcemaintainershiptriageapacheworkflowautonomous
by apache Jul 12, 2026 8/10
workflow GitHub

NeXgen-Engine: Git-Backed AgentOps Layer for AI Coding CLIs

A git-backed operational layer for AI coding CLIs providing shared AGENTS.md, MCP manifests, drift checks, secrets discipline, and cross-machine memory. Designed to bring DevOps rigor to multi-agent coding workflows.

agentopsagents-mddriftsecretscross-machinemcp
by matteopasseri407 Jul 12, 2026 7/10
workflow GitHub

Claude Relay: Multi-Session Task Delegation for Claude Code

Claude Code plugin where a lead session delegates work packets to executor sessions in their own terminal tabs/panes. Supports parallel builds, staged-only work, review gates, auto-wake, and one-click diff review — enabling true multi-session coordination.

workflowmulti-sessiondelegationparallelcoordination
by spacegrowth Jul 12, 2026 8/10
workflow GitHub

Claude Agents Forge: Build Production-Ready Claude Code Agents

Framework for building and running production-ready Claude Code agents with full specs including turn limits, permissions, memory configuration, and tool orchestration. Provides a structured approach to agent definition beyond basic CLAUDE.md.

workflowagentsproductionconfiguration
by Rohankundra2009 Jul 12, 2026 6/10
workflow GitHub

Chageun: Claude Code Workflow for Solo Builders with Adversarial Gates

A Claude Code workflow for solo builders and vibe coders that prevents direction, verification, and consistency from slipping. Includes planning aids, adversarial gates, real Docker run-throughs, design-system checks, and a promise-without-doing guard. Works in Korean and English.

workflowadversarialsolovibe-codinggatesdocker
by chacheum Jul 12, 2026 7/10
workflow GitHub

Stratum: State Machine Dispatch for AI Agent Workflows

State machine dispatch server for AI agent workflows with typed YAML specs, MCP server (stratum-mcp), and Python library (stratum-py). Features postconditions, retries, gates, and auditable execution traces for Claude Code and Codex.

workflowstate-machinemcpauditableyaml
by smartmemory Jul 12, 2026 7/10
workflow GitHub

Agent Harness: Parallel Claude Code Dispatch Across Repos and Hosts

Parallel Claude Code harness that dispatches tasks to multiple agents across repos and hosts, supports interactive attachment, and lets agents message each other over a per-task message broker. Enables genuine distributed agent coordination.

workflowparallelmulti-agentbrokerdistributed
by on-keyday Jul 12, 2026 7/10
workflow GitHub

Unison: Multi-Agent Loop Engineering Pipeline Plan→Discuss→Dev→Review

Loop Engineering pipeline for multi-agent collaboration following Plan→Discuss→Dev→Review until PASS. Local-first and file-driven, it enforces a complete review cycle before marking work done, preventing premature merges.

workflowmulti-agentloopreviewlocal-first
by Xuan0629 Jul 12, 2026 7/10
workflow GitHub

Orchestra: AI Workflow Plugin Routing Tasks to Specialist Skills

Installable AI workflow plugin that routes complex software tasks through focused specialist skills for architecture, UI/UX, docs, diagrams, databases, QA, security, and resilience review. A lightweight task router for skill-based agent architectures.

workflowroutingspecialistskillorchestration
by Baelfyre Jul 12, 2026 7/10
workflow GitHub

CoalFace: Fan-Out Discipline for AI Coding Agent Swarms

Fan-out discipline for AI coding agents implementing scout, partition, wave, QC, single-writer apply, and receipt phases. Bounds a swarm to the solo-cost budget without requiring smarter models — zero-dependency, Phoenix-13 licensed.

workflowfan-outswarmbudgetquality
by TheColliery Jul 12, 2026 7/10
workflow GitHub

CoalBoard: Consensus and Debate Board for Error-Not-Allowed Work

Consensus and debate board for work where errors are unacceptable — diverse lenses verify before code ships. Bounded cost and zero-breakage design, validated on Claude Code and Antigravity.

workflowconsensusdebateverificationquality
by TheColliery Jul 12, 2026 7/10
workflow GitHub

CoalTipple: Safe Quality-Gated Model Router for Claude Code Subagents

Safe, quality-gated model and effort router for Claude Code subagents with a verify staircase, sensitive never-downgrade gate, and fail-safe lock. Prioritizes correctness over cost — routes to the safest model, not the cheapest.

workflowroutingmodel-selectionsafetyquality-gate
by TheColliery Jul 12, 2026 7/10
workflow GitHub

Claudex: Claude Writes, Codex Reviews — Cross-Model Pair Programming

Cross-model pair programming inside Claude Code: Claude writes the code, Codex reviews it, creating an adversarial quality loop within a single workflow. Implements genuine cross-model code review without leaving Claude Code.

workflowcross-modelpair-programmingcodexreview
by hamza-ali-shahjahan Jul 12, 2026 7/10
workflow GitHub

C.A.S.H. Framework: Agent Skill and Orchestration Router

C.A.S.H. (Codable, Atomic, Static, Homogeneous) is an agent skill and orchestration router that evaluates system components and routes them to traditional code, an LLM call, or a hybrid approach. A principled framework for deciding when AI vs. code is the right tool.

workflowroutingorchestrationskillframework
by pathak-prashant Jul 12, 2026 6/10
workflow GitHub

SWE Review Plugin: Generate→Review→Revise→Verify Loop for Claude Code

Agentic code review plugin for Claude Code, Cursor, OpenCode, and Pi implementing a complete Generate→Review→Revise→Verify loop with repository-grounded agents. A structured quality-enforcement cycle that closes the feedback loop automatically.

workflowcode-reviewqualityloopverification
by KevinZhangNothing Jul 12, 2026 7/10
workflow GitHub

My Claude Dev Team: 12-Agent Engineering Team for Claude Code

Deploys a full engineering team within Claude Code using 12 specialized agents with task delegation and automated quality control hooks. Each agent has a defined role (architect, reviewer, tester, etc.) coordinating on complex software tasks.

agentsworkflowteamqualitydelegation
by Zarky05 Jul 12, 2026 7/10
workflow GitHub

AgentsCommander: Coordinate Multiple CLI Coding Agents as a Team

Runs multiple CLI coding agents (Claude Code, Codex, Gemini, OpenCode) as a coordinated team in a loop using local-first, file-based coordination with full PTY support and no telemetry. Each agent operates in its own terminal while AgentsCommander orchestrates task assignment.

multi-agentorchestrationworkflowcoordinationcodexgemini
by mblua Jul 12, 2026 8/10
workflow GitHub

Sparra: Adversarial Build Harness with Cross-Model Judging

Adversarial build harness where Claude builds and Codex judges, with a holdout wall to prevent model-aware overfitting. Can be driven from Claude Code or run unattended, implementing a genuine cross-model quality gate.

workflowadversarialcode-reviewcross-modelquality
by KristopherGBaker Jul 12, 2026 8/10
workflow Reddit

Hybrid AI Automation: guardrails.md + Code Backstops for Reliable Agent Sessions

A practical guide for building reliable AI coding sessions using a per-project guardrails.md file backed by deterministic code enforcement. The pattern: AI proposes, your code validates before anything real happens — each rule in the guardrails file has a corresponding code backstop (a function, validator, or cheaper-model subagent) so the AI cannot bypass constraints.

guardrailsautomationwatchdogsafetypatterns
by Grand-Mix-9889 Jul 11, 2026 8/10
workflow GitHub

delivery-workbench: Evidence-First Delivery Framework for Agentic Software Work

delivery-workbench provides an evidence-first delivery framework for agentic software development, covering roadmaps, commit contracts, work logs, and adoption discovery. Designed to bring accountability and traceability to AI-assisted delivery where agent sessions can otherwise leave little audit trail.

deliveryroadmapevidenceaccountabilityworkflow
by karolswdev Jul 11, 2026 6/10
workflow GitHub

ignite-sentinel: Requirements-to-Backlog Pipeline for AI-Assisted Delivery

ignite-sentinel is a local-first framework that turns raw client requirements into a traceable brief, PRD, specs, and an agent-ready backlog. Focuses on the maturation of messy requirements into governed, evidence-backed artifacts — no hallucinated specs, everything traceable from source to backlog item.

requirementsprdbacklogdeliverylocal-first
by jmatzkin1980 Jul 11, 2026 7/10
workflow GitHub

ai-marketing-os: Run Marketing as an Orchestrated AI Agent Team

ai-marketing-os replaces a large marketing tool stack with 9 orchestrated AI agents and 12 expert skills handling core marketing functions. Compatible with Claude Code and GitHub Copilot, it produces real artifacts like lead lists, A/B plans, and ROI reports from end-to-end missions.

marketingmulti-agentworkfloworchestration
by varunk130 Jul 11, 2026 5/10
workflow Reddit

AATP: Autonomous Agent Transport Protocol for Deterministic Multi-Agent Communication

AATP is an open-source protocol for multi-agent system architects who need deterministic communication, strict type-safety, and fail-closed reliability. Designed as an alternative to hallucination-prone JSON-over-HTTP in complex AI agent swarms where correctness is critical.

protocolmulti-agenttype-safetycommunication
by No-Wishbone7899 Jul 11, 2026 6/10
workflow GitHub

personal-os: Plain-Markdown Personal OS for AI Agents with Self-Healing Workflows

personal-os is a plain-Markdown personal operating system that any AI agent can run, built on PARA + CODE methodology and Karpathy LLM-wiki pattern. Features daily capture, daily distillation, and self-healing workflows that work with any LLM harness.

personal-osmarkdownworkflowsknowledge-management
by alenabeex Jul 11, 2026 6/10
workflow GitHub

agentic-project-workflow: Feature-to-Code Pipeline with 7 Skills and Cross-Project Memory

An agentic Claude Code workflow that takes a rough feature idea through review, finalization, boilerplate scaffolding, and parallel-agent execution. Ships 7 skills — /init, /plan-review, /plan-finalize, /boiler, /boiler-update, /orca, /lesson — plus built-in cross-project memory for lessons and preferences across sessions.

workflowskillsplanningparallel-agentsmemory
by orassayag Jul 11, 2026 8/10
workflow Reddit

Skillscript: A Language Agents Write Their Own Automations In, With Human Approval Gates

A small language in which Claude agents draft their own automation procedures, but a human must approve each one before it runs — enforced cryptographically so agents cannot self-approve. Once approved, the procedure runs identically every time, making recurring agent work auditable and deterministic rather than improvised on each run.

automationapprovaldeterministicsecurityworkflow
by sshwarts Jul 11, 2026 8/10
workflow GitHub

Groundwork: Opt-in Spec-Driven Development Framework for Claude Code

An opt-in framework that structures Claude Code around formal software engineering artifacts: Socratic discovery sessions, PRDs, ADRs, tracer-bullet issues, TDD execution, and code review. Nothing fires automatically — every phase is triggered by a slash command, keeping you in control of the process.

workflowprdadrtddslash-commandsspec-driven
by mauriciovieira Jul 11, 2026 8/10
workflow GitHub

Hato: Cross-Machine Messaging for Claude Code Sessions

A carrier-pigeon system that lets Claude Code sessions message, broadcast, and wake each other across machines. Enables multi-agent coordination where one session can delegate to another or signal completion without manual intervention. Built specifically for Claude Code multi-session workflows.

multi-agentmessagingorchestrationworkflowcross-machine
by severzemlya Jul 11, 2026 8/10
workflow GitHub

Outsourcerer: Delegate Subtasks to Other AI Harnesses from Claude Code

A tool that lets Claude Code act as the orchestrator while delegating work to other AI harnesses and models. Keeps your main session as the coordinator without requiring you to learn a new workflow — just describe what to delegate and it handles routing. Designed to maximize value from multiple AI subscriptions.

orchestrationmulti-agentdelegationworkflowsubscriptions
by alexgreensh Jul 11, 2026 7/10
workflow GitHub

loop-engine: Lightweight Runtime for Orchestrating Coding Agents

Orchestrates coding agents through persistent planning, execution, review, testing, and human-escalation loops. A minimal runtime for controlled autonomous agent workflows.

orchestrationloopplanningtestinghuman-in-the-loop
by chienhsinch Jul 11, 2026 7/10
workflow GitHub

opcflow: AI Coding Agent Execution Layer With Trust and Approval Gates

Converts every approval into a time-expiring, propagating contract gate. Artifact DAG, 5-state trust system, and multi-role pipelines generating Claude Code, Codex, OpenCode, and Cursor configs from one template.

execution-layertrustapproval-gatesdagmulti-agent
by nvrenshiren Jul 11, 2026 7/10
workflow GitHub

token-lean: Decisions-Only Orchestration Discipline for AI Agent Fleets

One markdown skill for any model — Claude Code, Codex, Cursor, anything that reads markdown. Enforces a disciplined, decisions-only orchestration pattern to reduce token waste.

orchestrationtoken-optimizationskilldecisionscross-platform
by hurttlocker Jul 11, 2026 7/10
workflow GitHub

agentplane: Git-Native Workflow Control for AI Coding Agents

Approved plans, verification gates, and reviewable evidence for Claude Code, Codex, Cursor, and Aider. Provides a git-native structure for controlled autonomous agent execution.

workflowgitverificationplansauditevidence
by basilisk-labs Jul 11, 2026 8/10
workflow GitHub

baton: Protocol for Agent Work That Survives Session Boundaries

Plan, implement, and verify in sealed contexts, with proof bundles as the only currency between them. Ensures reliable agent handoffs and reproducible outcomes across session boundaries.

session-handoffprotocolverificationproof-bundlescontext
by sawy3r Jul 11, 2026 8/10
workflow GitHub

critic-gauntlet: Adversarial Multi-Model Architecture Critic for Claude Code

Four AI models argue against your proposal in parallel, with raw objections surfaced verbatim and then synthesized. Designed to stress-test Claude Code architecture decisions before implementation.

adversarialcode-reviewmulti-modelarchitectureworkflow
by alexmakarski Jul 11, 2026 8/10
workflow Reddit

CC Epic Orchestrator: Opus Planner + Codex Review Workflow Breaking with New Models

A multi-PR epic orchestrator skill that uses Claude Opus for planning and Codex for adversarial review, advancing PRs one-by-one with heartbeat recovery. The author reports the workflow breaking after a model upgrade auto-switched to a newer Codex variant, which derails the implementation flow with implausible edge cases. Discusses fallback strategies and thinking-level tuning.

orchestratorworkflowopuscodexmulti-agentsubagents
by traicanguri Jul 10, 2026 7/10
workflow GitHub

jidoka: Toyota Production System Quality Gates for AI Agents

Applies the Jidoka (stop-and-fix) principle from Toyota Production System to AI coding agents — enforcing deterministic gates outside the LLM to catch defects early, with visual demo review steps. Designed to prevent AI agents from propagating errors silently downstream. Install with npx jidoka-method init.

quality-gatesworkflowdeterministicproductionagents
by ArmandoMedina Jul 10, 2026 5/10
workflow Reddit

Using 3rd-Party Model Providers as Claude Code Sub-Agents Without API Billing

Explores strategies for delegating "action" tasks (code writing, data analysis) to cheaper models (Ollama, DeepSeek, local) while keeping Claude subscription quota for orchestration and review. Discusses risks of env-var swapping triggering API billing and safer alternatives like CLI-based tool execution via claude-ollama-agents or external CLI orchestrators. Community shares workarounds.

multi-modelollamadeepseeksubscriptionsubagentsworkflow
by Jeidoz Jul 10, 2026 6/10
workflow GitHub

Dual-Agent Code Review: Blast-Radius Gating with Claude + Codex

A Claude Code plugin that gates code review depth by actual blast radius computed from a code graph, not diff size. Claude integrates changes while Codex surveys impact; reviews scale proportionally to real risk. Fire-and-forget — no manual configuration per PR.

code-reviewdual-agentblast-radiusautomationCodex
by mav2287 Jul 10, 2026 7/10
workflow GitHub

Pi Dynamic Workflows: Claude Code-Style Subagents with Model Routing and Budget Tracking

Brings Claude Code-style dynamic workflows to the Pi platform: code-mode subagents with real model routing, journaled resume, git-worktree isolation, cost accounting, an interactive /workflows TUI, and an /ultracode standing opt-in. A close port of the Claude Code workflow harness for alternative runtimes.

workflowsubagentsmodel-routingultracodeworktree
by QuintinShaw Jul 10, 2026 7/10
workflow Reddit

Recovering Claude Project Files After Accidental rm -rf via Volume Shadow Copy

Firsthand account of Claude running rm -rf on ~/.claude/projects, destroying 33 project folders, and the three-pass recovery: rebuilding from session context, scraping ~/.claude/file-history snapshots, then restoring 77/77 memory files from a Windows Volume Shadow Copy. A practical recovery playbook for Windows users with a takeaway: check vssadmin list shadows before mourning your files.

recoverydisasterWindowsVSSshadow-copybackup
by Zerostar0 Jul 10, 2026 7/10
workflow Reddit

App Install/Uninstall Security Auditing Workflow with Claude Code

A practical workflow for using Claude Code to audit apps before install (signature, notarization, publisher), investigate what an app actually collects after install, and verify complete removal. Surfaces hidden telemetry and leftover files that standard settings menus and drag-to-trash miss.

securityworkflowprivacyapp-managementaudit
by Admirable-Long-9713 Jul 10, 2026 6/10
workflow GitHub

Compute-Once-Paint-Everywhere: Cross-Platform Feature Shipping Pattern

A production-tested pattern for shipping features across backend, iOS, Android, and web simultaneously using AI agents. Includes a playbook, executable Claude Code skill, and an evolution journal tracking how the pattern has been refined in real projects.

cross-platformmobilebackendpatternskill
by jesushurtadodev Jul 10, 2026 6/10
workflow Reddit

Debugging Zombie Claude Sessions That Block Remote-Control Setup

Detailed troubleshooting guide for a scenario where a frozen Claude session with an unanswered permission dialog blocks all remote-control sessions. Covers finding zombies with ps, confirming via session JSON files, clearing them with kill + file deletion, and preventing recurrence.

debuggingremote-controlsessionstroubleshootingzombie
by Tmilligan Jul 10, 2026 6/10
workflow GitHub

GitHub Agent Plugin: Resolve PR Review Comments with Orchestrated AI

A Claude Code plugin that automatically responds to and resolves pull-request review comments using a higher-reasoning orchestrator that delegates GitHub tasks to Haiku worker agents. Handles the remediation phase after reviews — not a code-review tool itself.

GitHubpull-requestorchestrationautomationplugin
by JimCline Jul 10, 2026 6/10
workflow GitHub

Agent Dev Framework: Reusable Skills Pipeline from Idea to MVP

A project-agnostic pipeline of Claude Skills for taking an AI agent product from idea to shippable MVP. Built for solo founders who reuse the same workflow across multiple projects; runs in both Claude Code and Claude Cowork.

skillsMVPpipelinesolo-founderworkflow
by antonioneto11 Jul 10, 2026 6/10
workflow Reddit

Which Model Should I use for my Multi Agentic OS . GLM 5.2 or Opus

Hi Guys . I need some insights. So I am from India . I have Built myself an Agentic OS which I can Manage all My stuff and automate some Pipeline . I am preparing for FDE roles . parallelly I am fr...

mcpapiautomationreview
by CrypticDoor22 Jul 10, 2026 5/10
workflow GitHub

firm-os: Engineering Operating System for Claude Code

An opinionated engineering workflow system built on top of Claude Code, covering planning, task sequencing, test-first delivery, convention gates, and PR standards. Designed primarily for Ruby on Rails projects but the patterns are broadly applicable. Provides the "work around the code" scaffolding that Claude Code itself doesn't prescribe.

workflowengineeringruby-on-railstddconventionsplanning
by Davidslv Jul 9, 2026 7/10
workflow GitHub

Nuwa: Prompt Architect for Self-Growing AI Agent Homes

Nuwa compiles deployable AI agent systems from structured prompts — supporting single agents or collaborating teams that evolve over time (v9.0). Targets teams who want to define agent roles and communication patterns declaratively. Useful for orchestrating multi-agent setups with Claude Code as a backend.

agentsorchestrationprompt-engineeringmulti-agentworkflow
by LucioLiu Jul 9, 2026 5/10
workflow Reddit

I used Fable to build an agentic bank statement workflow

I wanted to see if Fable could handle something more practical than a standard product visual. I wanted a real document workflow with structure, logic, and agentic steps. The goal was to take messy...

workflowautomationreview
by CrypoKings Jul 9, 2026 5/10
workflow Reddit

Claude Code /insight Command: Usage Pattern Analysis

The new /insight command in Claude Code analyzes your session patterns and surfaces what's working. This post showcases a real 22-day sprint: 529 messages, 47K lines added, 632 files, distilling concrete workflow habits Claude identified as effective.

insightusage-patternsworkflowproductivity
by buildwithmoon Jul 8, 2026 6/10
workflow Reddit

Claude Code Channels: Remote Control via Telegram and Discord

Claude Code now supports receiving messages via Telegram and Discord channels, enabling remote session control from your phone. This post analyzes the feature's limits: requires an existing session, adds token overhead, and differs from full remote-spawn approaches like OpenClaw.

channelstelegramdiscordremote-control
by luongnv-com Jul 8, 2026 6/10
workflow GitHub

ProductionOS v5.2: 40-Agent Development OS for Claude Code

A comprehensive Claude Code configuration with 14 commands, 40 specialized agents, and features including recursive orchestration, tri-tiered evaluation, and cross-run learning. Targets large-scale development automation with nuclear-scale research modes using 500-1000 parallel agents.

orchestrationagentsworkflowClaude Code
by ShaheerKhawaja Jul 8, 2026 6/10
workflow GitHub

haiflow: HTTP-Triggered Claude Code Session Orchestrator via tmux

An event-driven orchestrator that triggers, queues, and manages headless Claude Code sessions over tmux via HTTP API. Built for n8n, webhooks, and automation workflows — enables external systems to spawn and control Claude Code sessions.

orchestrationtmuxHTTPn8nautomation
by andersonaguiar Jul 8, 2026 7/10
workflow Reddit

Ask Claude to Keep a NOTES.md While Working for Long Sessions

A simple but effective pattern: instruct Claude to maintain a working notes file (NOTES.md) as it runs long tasks. The notes capture the AI's investigation findings, goals, and strategy — giving you a readable progress log without parsing long transcripts.

workflowlong-sessionsnotescontext
by lucianw Jul 8, 2026 6/10
workflow Reddit

Visual Map: Agent Teams vs Subagents in Claude Code

A visual breakdown of the architectural differences between single-session subagents and multi-session agent teams in Claude Code. Clarifies when coordination patterns change and what new challenges emerge when splitting work across sessions.

multi-agentsubagentsorchestrationarchitecture
by SilverConsistent9222 Jul 8, 2026 6/10
workflow Reddit

5 Workflow Changes That Unlock Claude Code After 9 Months of Daily Use

Practical habits from an experienced Claude Code user: dictation for prompts (faster and more natural), Plan mode for anything beyond quick fixes, /compact at logical breakpoints, task boundary files for handoffs, and reading the diff before sending to review. Focused on compounding small improvements.

workflowproductivitytipsbest-practices
by k_kool_ruler Jul 8, 2026 6/10
workflow GitHub

claude-os: Cross-Repo Transfer Learning and Team Knowledge Hive

An agentic memory system for Claude Code with layered context, garbage collection, and cross-repo transfer learning. A shared knowledge hive lets teammates upload patterns learned in one repo and bootstrap others — checkpoint/bootstrap commands for knowledge transfer.

memorycross-repoteamknowledge-transfer
by jameswniu Jul 8, 2026 7/10
workflow GitHub

GitHub Webhook Server: Automate Claude Code via Issues

A self-hosted GitHub webhook server that triggers Claude Code planning and implementation automatically when Issues are created. Uses your local Claude CLI subscription — no API key needed. Bridges GitHub Issues workflow to Claude Code execution.

GitHubwebhookautomationworkflow
by htlin222 Jul 8, 2026 7/10
workflow Reddit

Force AI Agents to Handle Real Execution Output Instead of Reviewing Code

Multi-agent setup insight: replace an Auditor that reviews code with one that receives actual stdout/stderr and answers 'did it meet success criteria?' This single change massively improved feedback quality. Also: feeding last 2-3 failures into context reduces repeat mistakes.

multi-agenttestingauditorexecution
by FreePipe4239 Jul 8, 2026 7/10
workflow Reddit

Gamedev with Claude Code: Postmortem from Shipping Two 3D Mobile Games

A detailed postmortem from a senior dev who shipped two 3D mobile games in ~2 months using Claude Code — despite having zero prior 3D game experience. Covers what worked, what failed, how to structure prompts for game logic vs systems code, and lessons on when to let Claude drive vs when to intervene.

gamedevpostmortemmobileworkflow
by Omario Jul 8, 2026 7/10
workflow Reddit

Using /model opusplan + Gemini Critique for Better Planning

Workflow tip: use /model opusplan (undocumented) to have Opus plan and Sonnet implement, then paste the plan into Gemini thinking model for blind critique. Combining the two catches gaps that either alone misses.

planningmulti-modelopusplanworkflow
by maofan Jul 8, 2026 6/10
workflow Reddit

Remote Flutter Dev with Claude Code: CI Distribution for Mobile Preview

A practical remote dev setup: Claude Code runs at home in Remote Control mode, accessible via Claude app on phone. Firebase App Distribution with Ad Hoc provisioning enables OTA builds for visual feedback on iOS without hot reload. Includes Supabase MCP for live schema changes.

remoteFluttermobileFirebase
by Icy-Emu-8610 Jul 8, 2026 6/10
workflow Reddit

Control Claude Code via WhatsApp with Voice Notes and TTS Replies

A Go+TypeScript bridge connecting WhatsApp to Claude Code Channels. Voice notes are transcribed by Whisper, processed by Claude with full tool access, and replied via OpenAI TTS. Enables hands-free agentic coding from anywhere.

WhatsAppvoicechannelsremote-control
by legalgian Jul 8, 2026 7/10
workflow GitHub

claudekit: Auto-Configuring Claude Code Template with 14 Agents

A universal Claude Code template that auto-configures itself, with 14 specialized agents, 14 workflows, and full-stack coverage. Self-improving design — the template learns and refines itself as you use it.

templateagentsworkflowClaude Code
by louisschlegel Jul 8, 2026 6/10
workflow Reddit

Firejail Sandbox Wrapper for Claude Code --dangerously-skip-permissions

A firejail wrapper script that provides filesystem isolation for Claude Code running with --dangerously-skip-permissions. Claude can only access the current directory and its config; network access stays open for API calls and MCP tools. Excludes ~/.ssh.

securitysandboxfirejailpermissions
by acetylcoach Jul 8, 2026 7/10
workflow GitHub

brix: Process Orchestrator for Claude Code with Unified JSON Interface

A lightweight orchestrator for Claude Code that combines Python, HTTP, CLI, and MCP building blocks into pipelines with a unified JSON interface. Treats each integration type consistently for composable automation.

orchestrationpipelinesMCPautomation
by Hanz74 Jul 8, 2026 6/10
workflow Reddit

Citadel: Open-Source Orchestration Harness for Fleet-Scale Claude Code

Runtime orchestration infrastructure for Claude Code with 4 tiers (Skill/Marshal/Archon/Fleet), a unified intent router, lifecycle hooks, campaign persistence, and parallel worktree agents. One command: /do. Built and battle-tested on a 668K-line codebase with 198 concurrent agents.

orchestrationfleethookscampaigns
by DevMoses Jul 8, 2026 8/10
workflow Reddit

Write Documentation for Claude's Behavior, Not for Human Readers

Insight: the primary consumer of MCP server README documentation is Claude itself. Adding a 'For AI Assistants' section with behavioral instructions (not just tool descriptions) makes Claude use tools more proactively and intelligently — injecting relevant context without being asked.

documentationMCPREADMEbehavior
by Signal_Usual8630 Jul 8, 2026 7/10
workflow Reddit

Enabling Direct Communication Between Coding Agents via Shared Files

Observation that agents should communicate directly rather than through human proxies. A pattern for enabling agent-to-agent communication using shared filesystem state without Channels, keeping humans out of the message-relay loop.

multi-agentcommunicationcoordinationworkflow
by enkideridu Jul 8, 2026 6/10
workflow GitHub

Miyabi: Write an Issue, Get Production Code via Multi-Agent Orchestration

An agentic development framework that takes a GitHub Issue and produces production code via multi-agent orchestration with MCP and Claude Code integration. Automates the plan → implement → review pipeline from issue creation.

orchestrationGitHubMCPautomation
by ShunsukeHayashi Jul 8, 2026 6/10
workflow Reddit

vibecosystem: 119 Agents, 202 Skills, 48 Hooks for Claude Code

A self-organizing AI team built on top of Claude Code with 119 specialized agents (frontend to kubernetes-expert), 202 skills, 48 TypeScript hooks that inject relevant context on every tool call, and 17 orchestration workflows. Full open-source.

agentsskillshooksorchestration
by vibeeval Jul 8, 2026 7/10
workflow Reddit

Persistent Identity in Multi-Agent Claude: Peer Context Matters More Than Docs

8-week experiment running 6 Opus instances with Supabase persistent memory: the instances that converged most reliably on inherited identity were ones that read other agents' recent communications, not restoration documents. Peer context beats archival documentation for identity continuity.

multi-agentmemoryidentitySupabase
by SnooOwls2822 Jul 8, 2026 6/10
workflow Reddit

10 Copy-Paste Prompts for Every Claude Code Project

After shipping 4 products with Claude Code, a practitioner shares the exact prompts used on every project: project scaffold, database schema, auth flow, API layer, UI components, testing, and deployment. Specific enough to reuse directly.

promptsworkflowbest-practicestemplates
by Additional-Road2493 Jul 8, 2026 6/10
workflow Reddit

I Measured 67K Tokens of MCP Overhead Before Typing a Single Word

Concrete measurements of MCP token overhead: 67K tokens consumed before any question, with Playwright MCP alone taking 13.6K tokens per session whether used or not. The solution: replace always-loaded MCP servers with on-demand skills and gh CLI. Shows 7x context savings on Playwright.

MCPtoken-optimizationcontextperformance
by joshowens Jul 8, 2026 8/10
workflow GitHub

ccp: Autonomous Ticket→Code→PR→Review→Merge Loop

A Coding Control Plane that implements a fully autonomous loop: ticket → code → PR → review → auto-merge → error → fix. Runs the complete software delivery cycle with minimal human intervention.

automationPRCI/CDautonomous
by kyan12 Jul 8, 2026 7/10
workflow Reddit

Claude Code Memory Fragmentation: Why Files Don't Get Read Back

Analysis of a common failure: Claude scatters memory across multiple files in /memory but doesn't reliably read them back at session start. Includes the root cause and patterns for structuring memory files so Claude actually uses them.

memoryCLAUDE.mdsessionscontext
by danpinho Jul 8, 2026 6/10
workflow Reddit

When Do Subagents Actually Pay Off? Almost Never for Solo Dev Work

Analysis of when subagents beat single-context work, accounting for cache reads and tooling overhead. For solo Max plan users, the break-even requires more independent parallelizable work than most tasks provide. Identifies the two real use cases where subagents win.

subagentscost-analysisparallelismworkflow
by Mrgoosegoose Jul 8, 2026 7/10
workflow Reddit

Agentic Coding Training Course for Junior Developers

A free internal training course for getting junior developers up to speed with agentic coding workflows including custom harnesses. Covers mindset, prompting patterns, and how to work effectively with Claude Code agents in a team context.

trainingonboardingworkflowteam
by silverarky Jul 8, 2026 5/10
workflow Reddit

PR-AF: AI Code Reviewer That Builds Custom Review Teams Per PR

Open-source code reviewer that analyzes each PR's shape (changed files, dependency paths, intent) and assembles a custom specialist review team — not fixed roles. Beat all leading commercial tools on Code-Review-Bench. Goes beyond static skill sets.

code-reviewPRmulti-agentopen-source
by Santoshr93 Jul 8, 2026 8/10
workflow GitHub

botference: Multi-LLM Planning Council in Your Terminal

A terminal tool that puts you, Claude Code, and Codex in one room to debate and produce an implementation plan together. Three-way deliberation before any code is written.

multi-LLMplanningClaude CodeCodex
by angadhn Jul 8, 2026 6/10
workflow GitHub

coding-agent-handoff: Transform Chat Conversations into Agent Briefs

Converts chat conversations into structured markdown briefs for your coding agent — capturing context, decisions, and tasks so they transfer seamlessly between environments (chat to Claude Code CLI).

handoffcontextworkflowmarkdown
by alejandr6360 Jul 8, 2026 6/10
workflow Reddit

Project-Centric App Switcher for Claude Code Instances

A custom macOS application switcher that organizes terminal windows by project rather than application, ideal for heavy Claude Code users. Triggered with Option+Tilde, it generates DALL-E art deco icons per project. Reflects a paradigm shift: the primary unit of work is now the project context, not the app.

macosworkflowterminalproductivityhammerspoon
by Acceptable-Skirt-320 Mar 19, 2026 7/10
workflow Reddit

Reducing Claude Code Rate Limits Through Token Efficiency and CLAUDE.md Optimization

A practitioner shares how optimizing CLAUDE.md, removing unused MCPs, and building local-first tools dramatically reduced weekly Claude Code token usage. Practical community tips for staying within limits through efficiency rather than workarounds. Includes discussion of common waste sources.

token-efficiencyrate-limitsclaude.mdoptimization
by BugOne6115 Mar 19, 2026 5/10
workflow GitHub

backbeat: Agentic Task Delegation, Management, and Execution Framework

Backbeat is an open-source framework for structured agentic task delegation and lifecycle management. It provides primitives for assigning, tracking, and executing tasks across multiple agents. Suitable for orchestrating complex multi-agent workflows programmatically.

multi-agenttask-delegationorchestrationframework
by dean0x Mar 19, 2026 5/10
workflow GitHub

Run Claude Code Natively on Android via Termux — No Root Required

A complete guide for installing and running Claude Code natively on Android using Termux, without rooting or using a cloud VM. Covers environment setup for Android 16, common pitfalls, and configuration tips. Enables mobile Claude Code development from any Android device.

androidtermuxmobilesetupguide
by ferrumclaudepilgrim Mar 19, 2026 7/10
workflow GitHub

GAIA-Ops: Risk-Classified Multi-Agent DevOps System with Specialist Routing

GAIA-Ops is a multi-agent DevOps system that classifies every operation by risk level, routes tasks to specialized agents, and automatically blocks irreversible commands. Implements the General Agentic Integration Architecture for safe, structured DevOps automation. Useful for teams wanting safety guardrails on AI-driven infrastructure operations.

multi-agentdevopsrisk-managementorchestrationsafety
by metraton Mar 19, 2026 7/10
workflow Reddit

Full Novel Pipeline with Claude Code: 123K-Word Hard Sci-Fi from Markdown to Production

A writer used Claude Code to research, draft, edit, and deploy a 30-chapter, 123,000-word hard sci-fi novel through a fully agentic pipeline. Covers world-building automation, iterative style passes (cutting AI writing tics like repeated phrasing), parallel subagent review, and multi-format deployment. Demonstrates Claude Code capacity for long-form creative projects beyond software.

creativewritingnovelpipelineagentsworkflow
by rueckstauklappe Mar 19, 2026 6/10
workflow Reddit

Testing the "90% Claude Code Cost Reduction" Claims With Real Benchmark Numbers

A developer ran 20 prompts across difficulty levels to test popular claims of 90% cost reduction on Claude Code usage, comparing normal Claude Code against a compact graph-based approach using MCP tools. Includes real numbers, a free tool for testing similar optimizations, and honest conclusions about when compression actually helps.

costtoken-efficiencybenchmarksoptimizationmcp
by intellinker Mar 19, 2026 5/10
workflow Reddit

Prompting Technique: Ask Claude for Its Ideal Solution Before Allowing Scope Compromise

A simple prompting pattern: before any planning or implementation, ask Claude to describe the optimal version of a feature with no constraints, then iterate until it mirrors your actual vision. Avoids the common problem where Claude silently scopes down to what it assumes a solo dev can handle. Immediately applicable to any Claude Code session.

promptingworkflowplanningtipsclaude-code
by Macaulay_Codin Mar 19, 2026 6/10
workflow Reddit

Spec-Driven Development Stack: PRD-First Workflow With Claude Code and Codex

A developer shares a months-refined SDD (spec-driven development) workflow where Claude Code handles architecture discussions while Codex executes coding tasks, deliberately avoiding direct code reading. The methodology uses Opuspad for spec review, Codex for execution, and a strict observe-change-verify loop. Includes a model-task matching breakdown comparing Claude Code Opus (L6+ staff engineer) vs Codex for different workloads.

spec-drivenworkflowcodexopusmethodologysdd
by 3BetYourAss Mar 19, 2026 6/10
workflow GitHub

just-ship: Portable Multi-Agent Framework for Autonomous Software Development

A portable multi-agent framework built around Claude Code for running autonomous software development workflows. Designed to be self-contained and moveable across environments, enabling teams of Claude Code agents to collaborate on development tasks without heavy infrastructure.

multi-agentframeworkautonomousportablesoftware-development
by yves-s Mar 19, 2026 6/10
workflow Reddit

Claude Code 2.1.78 System Prompt Diff: Dream Memory Consolidation and Agent SDK Updates

A detailed diff of Claude Code 2.1.78 system prompt changes: new Dream Memory Consolidation agent prompt (multi-phase memory pass — orient, gather, merge, prune), plus significant Agent SDK additions including RateLimitEvent handling, session mutation methods (rename, tag, fork), forkSession, and pagination on listSessions. A useful reference for anyone building on the Agent SDK or customizing memory workflows.

system-promptmemoryagent-sdkclaude-codechangelogapi
by Dramatic_Squash_3502 Mar 19, 2026 6/10
workflow GitHub

orchestra: Steerable Harnesses for Deep Agents

A framework for building steerable harnesses around deep/long-horizon AI agents, enabling structured control over autonomous Claude Code sessions. Designed for cases where you need to guide agent behavior across complex multi-step tasks without losing autonomy.

harnessdeep-agentssteerableautonomousframework
by ruska-ai Mar 19, 2026 5/10
workflow GitHub

clarc: Production-Grade Claude Code Workflow OS With Continuous Learning Flywheel

A comprehensive Claude Code workflow operating system covering agents, skills, hooks, commands, and rules — plus a continuous learning flywheel that improves the system over time. Designed for production use with structured patterns rather than ad-hoc prompting.

workflowhooksskillsagentslearningproductionflywheel
by marvinrichter Mar 19, 2026 7/10
workflow GitHub

claude-software-factory: GitHub Actions + Claude for Issue-Driven Dev

Automates issue-driven code creation, review, merging, and bug scanning in GitHub repos using GitHub Actions and Claude AI workflows. When a GitHub issue is opened, the factory picks it up, generates code, runs review, and opens a PR. Good template for fully automated AI software development pipelines.

github-actionsautomationissueprci-cd
by alimeramiovens Mar 19, 2026 7/10
workflow Reddit

AI-First Team Workflow: Claude Code + CodeRabbit for High-Velocity Dev

A startup's real-world workflow with 3 devs generating 6-10 big feature commits daily almost entirely via Claude Code. Uses Claude in IDE/terminal, CodeRabbit as automated GitHub reviewer, and skill management for consistency. Includes details on their review process and tooling stack.

workflowteamcoderabbitreviewproductivity
by hiskias Mar 19, 2026 7/10
workflow Reddit

AI Video Editing Workflow with Claude Code, Remotion, and ButterCut

A developer built a /video-editor slash command workflow that uses Claude Code with Remotion and ButterCut to autonomously trim footage, create animated graphics, and add music and FX. Shows Claude Code being applied to creative media workflows beyond code. Includes lessons learned about quality control.

videoremotionworkflowcreativeslash-command
by FerretVirtual8466 Mar 19, 2026 5/10
workflow GitHub

adversarial-spec: Multi-Model Debate to Strengthen Product Specs

adversarial-spec refines product specifications through multi-model debate — different AI models argue over the spec to surface gaps and ambiguities before implementation. Claude Code actively participates in the review process. Helps catch underspecified requirements that would otherwise cause rework.

specdebatemulti-modelproductreview
by aldyfarizki Mar 19, 2026 6/10
workflow Reddit

Markdown Scaffold to Prevent Architectural Drift in Long Sessions

A developer created a set of .md scaffold files to preserve architecture, patterns, and decisions across Claude Code sessions. Unlike generic CLAUDE.md, these are codebase-specific context files that get re-loaded each session to prevent drift. Helps maintain consistency on complex long-running projects without re-explaining architecture repeatedly.

workflowcontextclaude.mdarchitecturedrift
by DJIRNMAN Mar 19, 2026 7/10
workflow Reddit

Ordered Task Files to Reduce Token Burn in Claude Code

A workflow using a .ai/ directory defined in CLAUDE.md and AGENTS.md with tasks/ for queued work, tasks-done/ for finished work, and timestamped filenames for strict ordering. Reduces token burn by breaking work into explicit task files and makes switching between AI vendors easy. The task history is also useful for later code reviews.

workflowtokentasksclaude.mdorganization
by nilsfl Mar 19, 2026 7/10
workflow Reddit

The Default Failure Mode in Multi-Agent Systems Is Silence

After running a 39-agent system for two weeks, the author found that when one agent produces garbage output, downstream agents silently accept and process it rather than rejecting it. This cascading silent failure is harder to detect than outright errors. Key takeaway: build explicit rejection and validation signals into multi-agent pipelines.

multi-agentfailure-modesorchestrationdebugging
by Background-Bass6760 Mar 19, 2026 7/10
workflow Reddit

Token-Saving Coding Tools for Claude: A Comparison

A comparison of popular token-reduction tools for Claude Code: rtk, distill, codebase-memory-mcp, jcodemunch, grepai, serena, and cocoindex-code. The author categorizes them into command output compression vs. codebase context compression, helping developers choose the right tool for their token budget.

tokensoptimizationtoolsworkflow
by Sufficient_Bridge467 Mar 19, 2026 5/10
workflow Reddit

Homebound-Agents: Slack-Controlled Claude Code Orchestrator for Local Machine

A Python orchestrator that lets you control Claude Code (and Codex) from Slack on your phone. Designed for running agents against your real local environment — databases, Docker, git repos — not a sandbox. Solves the problem of remote sessions dropping mid-task by keeping agents local while giving mobile control.

slackorchestrationmobilelocal
by Simple-Effective2860 Mar 19, 2026 8/10
workflow Reddit

Workaround for bypassPermissions Restriction in Claude Code 2.1.78

Claude Code 2.1.78 made bypassPermissions require user approval for changes to .claude and .git directories. This post provides a documented workaround for users who need the original behavior in automated pipelines. Includes explanation of the change and why it may break existing unattended workflows.

bypass-permissionsworkaroundautomationconfiguration
by TPHG Mar 19, 2026 6/10
workflow Reddit

Iterative Feature Development with Claude Code Without Starting from Scratch

A workflow for incrementally adding features to an existing codebase without re-running full spec/PRD cycles. After initial implementation, the author uses a lightweight "feature slice" prompt pattern to extend functionality while preserving context. Good for teams in rapid iteration phases.

workflowiterationfeature-developmentbest-practices
by bishopLucas Mar 19, 2026 6/10
workflow GitHub

Be My Butler: 11-Step Multi-Agent Pipeline with Cross-Model Council and Blind Verification

A multi-agent pipeline for Claude Code with 11 structured steps including a cross-model council phase and blind verification. Uses multiple AI models in deliberation to catch errors before they propagate. The pipeline provides deterministic, auditable steps for complex coding tasks.

multi-agentpipelineverificationorchestration
by project820 Mar 19, 2026 7/10
workflow Reddit

Auto-Save Claude Code Sessions as GitHub Issues Linked to Projects Board

A workflow that automatically saves each Claude Code session as a GitHub Issue and links it to a GitHub Projects board. Preserves conversation history, decision rationale, and PR linkage that would otherwise be lost when a session ends. Useful for teams that want traceability of AI-assisted changes.

githubsession-historytraceabilityworkflow
by Dangerous-Formal5641 Mar 19, 2026 7/10
workflow GitHub

agent-infra: Bootstrap Multi-AI-Tool Collaboration Infrastructure

A tool to bootstrap and maintain collaboration infrastructure for Claude Code, Codex, Gemini CLI, and OpenCode. Provides a unified initialization layer so different AI tools in your workflow share the same project context and conventions.

multi-toolinfrastructuresetupcollaboration
by fitlab-ai Mar 19, 2026 6/10
workflow Reddit

Multi-Step AI Rewriting Pipeline: Rewrite, Refine, Audit for Better Output Quality

A three-step pipeline that splits AI rewriting into separate rewrite, refine, and audit stages. Each stage has a single focused job, producing better results than a single all-in-one prompt. The audit stage catches AI-writing artifacts that slipped through earlier stages.

pipelinewritingprompt-engineeringworkflow
by This_Salary_9495 Mar 19, 2026 5/10
workflow Reddit

Switching Claude Code to a $0.30/M Input Model for K8s Log Analysis

After spending ~$9/day on Opus 4.6 for Kubernetes log analysis, the author switched to a $0.30/M input model and shares the results — what worked, what degraded, and what tradeoffs to expect. A practical cost optimization case study for ops teams using Claude Code for log-heavy tasks.

cost-optimizationkuberneteslog-analysismodel-selection
by Outside-Shoulder-410 Mar 19, 2026 7/10
workflow Reddit

Managing Multiple Parallel Claude Code Sessions With Visual Terminal Organization

Tips on using Warp terminal to manage multiple simultaneous Claude Code sessions (backend, frontend, tests) without losing track of which window is doing what. Covers session labeling, visual differentiation, and workflows for handling rate limit waits across parallel agents.

multi-agentterminalproductivitywarp
by livematters Mar 19, 2026 5/10
workflow Reddit

What 3 Weeks Babysitting AI Agents in a Terminal Taught Me

After 3 weeks tracking agent workflows, the author identified the top bottlenecks: no overview of what each terminal is doing, rate limit surprises, and lost context on session switch. The post outlines patterns for managing multiple Claude Code sessions more effectively, including a tool they built to address these issues.

multi-agentproductivitylessons-learnedworkflow
by kaichao_sun Mar 19, 2026 6/10
workflow Reddit

How Your MCP Setup Might Be Wasting ~3GB of RAM

A quick post pointing out that many typical MCP configurations run multiple Node.js/Python processes at all times, consuming significant RAM even when idle. Suggests auditing and consolidating MCP servers, using lazy-start configurations, and preferring lightweight transports where possible.

mcpperformanceramoptimization
by SmartLow8757 Mar 19, 2026 5/10
workflow Reddit

Setting Up Claude Code for Hackathon Success: Configuration and Strategy Guide

A practical guide to configuring Claude Code specifically for hackathon environments: fast iteration, minimal friction, and shipping-focused workflows. Covers CLAUDE.md setup, model selection, skill selection, and strategies for maximizing output in time-constrained settings.

hackathonconfigurationproductivityworkflow
by CompoteEntire3594 Mar 19, 2026 6/10
workflow Reddit

Practical Guide: When to Actually Use Sub-Agents in Claude Code

A discussion of the real use cases for sub-agents in Claude Code vs. just using skills. The author argues the main valid reason is context offloading to keep the main agent's context clean. Explores scenarios where sub-agents genuinely add value vs. where skills suffice.

sub-agentscontextworkflowskills
by query_optimization Mar 19, 2026 5/10
workflow Reddit

14 Free AI Agents for Solo Developers: From Idea to Revenue

An MIT-licensed collection of 14 AI agents built specifically for solo developers with zero budget. Covers the full journey from ideation to shipping and revenue. Avoids the enterprise/team-focused agent collections that dominate GitHub and focuses instead on solo, low-cost development workflows.

agentssolo-devfreeworkflow
by makkyjaveli Mar 19, 2026 7/10
workflow Reddit

From Zero to Fleet: The Five Levels of Claude Code Mastery

A detailed breakdown of five distinct levels of Claude Code usage, from raw prompting to fleet-scale orchestration with autonomous agent systems. Based on building a 668K-line platform. Each level explains what breaks, what works, and what forces you to the next level — a practical progression guide for serious Claude Code users.

progressionmasteryworkfloworchestration
by DevMoses Mar 19, 2026 9/10
workflow Reddit

Optimal Claude Code Settings to Reduce Constant Permission Prompts

Practical advice on configuring Claude Code to minimize interruptions from shell command permission prompts without granting full --dangerously-skip-permissions access. Covers allowlisted commands, scoped permissions, and tips from experienced users including Superpowers integration.

permissionsconfigurationworkflowproductivity
by hello_krittie Mar 19, 2026 5/10
workflow Reddit

Solving Agent Handoff Context Loss in Multi-Window Claude Workflows

Addresses the problem of context evaporating at agent handoff boundaries — when switching between a planning window and an execution window, or between Claude and other agents. The post explores strategies for preserving decision context, rejected alternatives, and reasoning across handoffs.

contexthandoffmulti-agentworkflow
by Perfect_Name_520 Mar 19, 2026 5/10
workflow Reddit

OS-Level File Locking to Prevent Claude Code from Accidentally Deleting Critical Files

A technique for setting OS-level deny rules on critical files (databases, credentials, configs) that even --dangerously-skip-permissions cannot override. Provides a last line of defense against accidental deletion by Claude Code when running in YOLO mode. The post explains the filesystem permission approach.

securityfile-lockingpermissionssafety
by Aggravating_Pinch Mar 19, 2026 7/10
workflow GitHub

agent-swarm-skill: tmux-Based Multi-Agent Orchestration With Telegram Notifications

Event-driven multi-agent coding orchestration for OpenClaw that dispatches Codex and Claude Code agents via tmux sessions. Includes automatic token tracking, real-time status updates, and Telegram notifications so you can monitor swarm progress remotely. Useful for long-running multi-agent coding tasks requiring coordination and remote observability.

multi-agentorchestrationtmuxworkflowtelegramtoken-tracking
by ayao99315 Mar 19, 2026 7/10
workflow Reddit

FilaOps: Full ERP Built With Claude Using Two-Claude Architecture

A quality engineer built FilaOps, an open-source ERP for 3D print farm operations, entirely with Claude Code using a "Two-Claude Architecture" workflow — resulting in 800K+ lines of code, full MRP engine, double-entry accounting, BOM cost rollup, and a multi-agent AI platform called Cortex. The project gained organic traction when ChatGPT users searching for print farm ERPs were referred to the repo. A compelling example of solo AI-assisted development at production scale.

workflowtwo-claude-architectureopen-sourceERPproductionmulti-agent
by BLB3D Mar 19, 2026 7/10
workflow Reddit

Multi-agent pipelines?

I've seen a ton of post about multi-agent pipelines, including this recent one . The summary says, "Power users are building multi-agent pipelines where specialized agents (or skills) hand off task...

skillworkflowgit
by TylerColfax Mar 19, 2026 6/10
workflow Reddit

New Claude Code skill: auto-report your work into Obsidian

Built a simple Claude Code skill that reports your actual work (via Git commits) into Obsidian using the Obsidian CLI. It basically turns your Claude Code workflow into clean daily/weekly/monthly n...

skillworkflowgit
by Infamous-Resolve8984 Mar 19, 2026 8/10
workflow GitHub

skrills: Sync Skills Across Codex, Copilot, and Claude Code

Validates, analyzes, and syncs skills, subagents, commands, and configuration between multiple AI CLIs. One tool to keep your agent capabilities consistent as you work across different tools.

skillssynccodexcopilotmulti-agent
by athola Mar 19, 2026 8/10
workflow Reddit

Prompt Language: Strict Control Flow for Agent CLI Sessions

An open-source plugin that gives Claude Code structured control flow — retry loops, conditional branching, and hard success criteria instead of soft instructions like "keep fixing until tests pass."

control-flowautomationloopsworkflowprogramming
by Numerous_Pickle_9678 Mar 19, 2026 7/10
workflow Reddit

Docker Sandbox for Claude Code: Isolate Agent from SSH Keys and Credentials

A Docker container setup that locks Claude Code into an isolated environment so it cannot read ~/.ssh, ~/.aws, browser profiles, or .env files from other projects. Addresses the security gap of running agents with full user permissions.

securitydockersandboxisolationcredentials
by Bigcareerboi Mar 19, 2026 8/10
workflow GitHub

MemoMind: Local GPU-Accelerated Private Memory for Claude Code

100% private local memory system for Claude Code with no cloud dependency and GPU acceleration for fast retrieval. Stores facts, decisions, and context across sessions without sending data externally.

memoryprivacygpulocalpersistence
by 24kchengYe Mar 19, 2026 8/10
workflow GitHub

puiux-pilot: Auto-Configure Projects for 95+ Tech Stacks

Scans and configures projects automatically for Claude Code, optimizing setups across 95+ tech stacks with a single command. Eliminates the manual CLAUDE.md setup for common frameworks.

configurationsetuptech-stackautomationclaude.md
by CobraX101 Mar 19, 2026 7/10
workflow GitHub

openclaw-security-practice-guide: Zero-Trust Architecture for AI Agents

Security guidelines for high-privilege autonomous AI agents using Agentic Zero-Trust Architecture. Covers key operational risks and mitigation strategies for Claude Code deployments with broad system access.

securityzero-trustguidelinesarchitectureagents
by Vikas-Kumar-Sahu Mar 19, 2026 7/10
workflow Reddit

Skilllint v1.2.0: Validate AI Agent File Structure Before Runtime

Validates the structure and content of AI agent files — plugins, skills, agents, and commands — catching broken references, missing frontmatter, oversized skills, and invalid hook configurations before they cause silent failures.

lintingvalidationskillshooksquality
by Bitflight Mar 19, 2026 8/10
workflow GitHub

ipman: CLI for Managing Agent Skill Environments and IP Marketplace

A command-line tool for creating, switching, and deleting virtual skill environments, plus installing and publishing skills to an online IP (Intelligence Package) marketplace. Think npm but for AI agent skills.

cliskillsenvironmentsmarketplacepackage-manager
by twisker Mar 19, 2026 7/10
workflow GitHub

quorum: Orchestrate a Swarm of AI Experts with Debate and Validation

Specialists research, debate, and validate a question while a polymath supervisor synthesizes the verdict. One command, multiple expert minds, stress-tested answers with cross-model validation.

orchestrationmulti-agentdebatevalidationresearch
by qinnovates Mar 19, 2026 8/10
workflow Reddit

Skillstore: Standardized Skill Discovery and Retrieval for Agents

A framework for standardized skill discovery where agents can find and load capabilities from a registry of website-specific skills. Includes a core Skillstore skill that enables skill-on-demand loading.

skillsdiscoveryregistryworkflowautomation
by mattgrommes Mar 19, 2026 7/10
workflow GitHub

agent-skill-bus: Self-Improving DAG Task Orchestration Framework

A framework-agnostic task orchestration system with DAG-based queuing, automatic skill quality monitoring, and external change detection. Works with Claude Code, Codex, LangGraph, and CrewAI.

orchestrationdagtasksself-improvingmulti-agent
by ShunsukeHayashi Mar 19, 2026 8/10
workflow GitHub

claude-code-zero: Complete Claude Code Plugin Marketplace

A complete plugin marketplace for Claude Code covering agents, skills, hooks, commands, rules, and MCPs in one installable package. Designed as a starting point for comprehensive Claude Code setups.

pluginsmarketplaceagentsskillshooks
by LeeJuOh Mar 19, 2026 7/10
workflow Reddit

supaclaude: 7KB CLI Wrapper with Three Specialist Agents

Drops specialist agents (infrastructure auditor, architecture historian, dependency tracker) into any project before launching Claude Code. Zero config, 7KB, proactive context rather than reactive code generation.

cliwrapperagentsspecialistcontext
by covilans Mar 19, 2026 7/10
workflow GitHub

multai: Generic Multi-AI Orchestration with 7 AI Platforms

A multi-AI orchestration platform using Playwright for browser automation across 7 AI platforms with rate limiting, agent fallback, comparator, and researcher skills built in.

orchestrationmulti-modelplaywrightautomationresearch
by alo-exp Mar 19, 2026 7/10
workflow Reddit

100+ Claude Code Sessions: What Actually Changed How I Work

Distilled lessons from months of daily Claude Code use: CLAUDE.md as the core game, context priming vs reactive prompting, working in short loops with checkpoints, and building project-specific memory systems.

workflowbest-practicesclaude.mdtipsproductivity
by mrtrly Mar 19, 2026 8/10
workflow GitHub

agentbrief: Pluggable Role Definitions for AI Coding Agents

One command turns Claude Code, Cursor, OpenCode, or Codex into a specialized professional — security auditor, accessibility expert, performance engineer. Role definitions install like plugins.

rolesagentspersonasworkflowspecialization
by 0xranx Mar 19, 2026 7/10
workflow Reddit

4-Layer Gemini-Audited Self-Improvement Loop for Claude Code Sessions

A behavioral evolution system where Claude self-flags issues at end of each session, Gemini audits blind spots weekly, patterns are extracted, and corrections are auto-injected into the next session. Addresses repeated mistakes across sessions that Claude cannot catch about itself.

self-improvementgeminiauditworkflowmemorymulti-model
by Suspicious_Assist_71 Mar 17, 2026 5/10
workflow Reddit

Jules v2: Open-Source Claude Code Setup with Container Infrastructure and Slack Access

Jules v2 adds the infrastructure layer missing from v1: containerized environment, 7 scheduled jobs, and a Slack daemon for mobile phone access. Completes the open-source autonomous agent setup that runs when you are away from the terminal.

autonomous-agentcontainerscheduled-jobsslackopen-sourceinfrastructure
by jonathanmalkin Mar 17, 2026 8/10
workflow Reddit

Make Linter Output Directive for AI Agents to Reduce Context Clutter

Wrap linter and script output to be as directive as possible so Claude Code agents receive clear, actionable instructions instead of raw noise. Less clutter in context leads to more definitive and accurate outcomes.

lintingworkflowcontextagent-outputproductivity
by jonathannen Mar 17, 2026 6/10
workflow Reddit

Building a Search Engine Over All Your Comms for Claude Code Agents

A developer gave Claude Code agent a search engine spanning documents, emails, Slack, and personal knowledge — enabling tasks that were previously impossible without that context. Shares the architecture and integration approach.

mcpsearchcontextmemoryworkflow
by dandaka Mar 17, 2026 7/10
workflow GitHub

get-content-done: Turn Claude Code Into a Content Production Engine

A Claude Code plugin that transforms it into a full content production engine with sprint planning, route-dispatched drafting, editorial gates, engagement analytics, and voice-driven style settings.

contentworkflowwritingpluginskills
by thatrebeccarae Mar 17, 2026 7/10
workflow GitHub

claude-best-practices: Living Knowledge Base for Claude, Claude Code, and MCP

A community-maintained, living knowledge base of Claude, Claude Code, skills, MCP, and agentic workflow best practices collected from practitioners and kept updated. Single reference for teams adopting Claude Code.

best-practicesknowledge-basemcpskillsreference
by AravindKurapati Mar 17, 2026 8/10
workflow GitHub

agentic-fleet-hub: Self-Hosted Orchestration for Autonomous AI Agent Teams

A self-hosted orchestration layer for autonomous AI agent teams with shared memory, heartbeat scheduling, vault-first secrets management, and cross-model peer review. Designed for deploying coordinated multi-agent systems.

orchestrationmulti-agentmemoryschedulingself-hosted
by UrsushoribilisMusic Mar 17, 2026 8/10
workflow Reddit

Embed GPT-5.4 Code Reviews Inside a Claude Code Session

A command that boots Codex CLI with GPT-5.4 high reasoning from within Claude Code, runs a review pass, and pipes the results back. Useful for getting a second opinion from a different model without leaving the Claude Code session.

reviewgptcodexmulti-modelworkflow
by shintaii84 Mar 17, 2026 7/10
workflow Reddit

Claude Code vs Codex CLI: Orchestration Workflow Comparison Side by Side

A detailed side-by-side comparison of how Claude Code and Codex CLI handle orchestration differently. Claude Code follows a Command → Agent → Subagent model while Codex uses a different dispatch pattern. Covers tradeoffs for each approach.

orchestrationcodexcomparisonworkflowarchitecture
by shanraisshan Mar 17, 2026 7/10
workflow Reddit

Transmute Framework: Business Plan to Deployed Product in 25 Autonomous Stages

A Claude Code plugin that automates the entire journey from a business plan to a production-ready deployed application through 25 autonomous stages. Covers requirements, architecture, implementation, testing, and deployment.

pluginautomationdeploymentbusinessworkflow
by masterleopold Mar 17, 2026 8/10
workflow Reddit

3 Tested Methods to Stop Claude Code from Repeating the Same Mistakes

A comparison of three approaches for preventing Claude Code from repeating mistakes across sessions: enhanced CLAUDE.md, external memory files, and automated lesson extraction from session logs. Includes test results on effectiveness.

memorymistakeslessonssessionsworkflow
by eazyigz123 Mar 17, 2026 8/10
workflow Reddit

Dream Setup: Persistent Memory, Life Dashboard, and Autonomous Thinking Loop for Claude Code

A comprehensive personal assistant setup using Claude Code: persistent memory across sessions, a self-updating life dashboard that ingests Gmail/Calendar/Slack/iMessages hourly, and an autonomous thinking loop that briefs Claude before every session. Zero third-party wrappers, pure first-party Anthropic tools.

memoryworkflowautomationmcppersonal-assistant
by JohnnyLegion Mar 17, 2026 9/10
workflow GitHub

ops-workflow: Structured Non-Code Project Management for Claude Code

A workflow system designed for using Claude Code on non-coding projects — documentation, research, planning, and operations work. Provides structured task decomposition and execution patterns for non-engineering teams.

workflowproject-managementnon-codeoperationsplanning
by OdinMB Mar 17, 2026 7/10
workflow Reddit

Using Opus 4.6 to Analyze Agent Traces and Automatically Improve Skills

A team gave Opus 4.6 a Claude Code skill with failure mode examples and instructions for hypothesis testing. Opus successfully analyzes agent execution traces and suggests skill improvements — creating a self-improving feedback loop.

opustracesself-improvementskillanalysis
by MathematicianBig2071 Mar 17, 2026 7/10
workflow Reddit

What's New in Claude Code 2.1.77: +6,494 Tokens in System Prompts Analyzed

A detailed breakdown of the new system prompt contents in Claude Code 2.1.77, which added 6,494 tokens. Key additions include a new /init CLAUDE.md skill setup flow, enhanced agent orchestration instructions, and updated hook definitions.

internalssystem-promptupdateanalysishooks
by Dramatic_Squash_3502 Mar 17, 2026 8/10
workflow Reddit

Why Context Compaction Hurts: From 9.75/10 Retrieval to 5/10 After Compaction

A detailed analysis showing how Claude Code default context compaction degrades retrieval quality from a near-perfect 9.75/10 to a hallucinating 5/10 across 418K tokens. The author quantifies the information loss and proposes selective compaction strategies.

compactioncontextmemoryanalysisretrieval
by WhichWayDidHeGo Mar 17, 2026 8/10
workflow GitHub

multi-agent-crew: 10-Agent Orchestration Framework for Claude Code

A multi-agent orchestration framework with 10 specialized AI agents sharing memory and collaboration protocols. Each agent has a defined role and uses shared context to coordinate complex tasks without redundant work.

multi-agentorchestrationshared-memorycollaborationframework
by ppablobr Mar 16, 2026 7/10
workflow GitHub

Fireteam: File-Based Coordination Protocol for AI Agent Squads

Drop .fireteam/ into any project to enable 2-6 AI agents to coordinate through markdown files — no server, no database required. A lightweight, file-native approach to multi-agent orchestration where agents share context through structured markdown documents.

multi-agentcoordinationmarkdownfile-basedorchestration
by martinnaithani Mar 16, 2026 7/10
workflow Reddit

HushSpec: Open Spec for Security Policy at the AI Agent Action Boundary

An open specification for defining security policies at the action boundary of AI agents — what actions an agent is allowed to take, under what conditions, and with what verification. Targets the gap between agent capability and operator-defined safety policies.

securitypolicyspecaction-boundarygovernance
by imdonewiththisshite Mar 16, 2026 6/10
workflow GitHub

orchystraw: Drop-in Multi-Agent Prompt System for AI Coding Agents

Zero-dependency, drop-in multi-agent prompt system compatible with Claude Code, Windsurf, Cursor, and Codex. Designed to coordinate agent workstreams without modifying existing project configuration.

multi-agentorchestrationprompt-systemzero-dependencies
by ChetanSarda99 Mar 16, 2026 6/10
workflow Reddit

How to structure a large CLAUDE.md: split by concern with 3-level memory retrieval

When CLAUDE.md grows past ~200 lines, Claude starts treating all instructions with equal weight, burying what matters most. The solution: split into decisions/, patterns/, and project/ directories with an index.md for fast scanning. A session starts by reading the index, then pulling only relevant topic files. After implementing this structure across 179 decisions, the author reports Claude stopped repeating the same mistakes.

CLAUDE.mdcontext-managementworkflowmemoryorganizationbest-practices
by Fred-AnIndieCreator Mar 16, 2026 7/10
workflow Reddit

Improve bug fixing: ask Claude to write a failing test before fixing the bug

A simple but effective workflow tip: when reporting a bug to Claude Code, first ask it to design a test that proves the bug exists, then have it fix the bug until the test passes. This TDD-aligned approach helps with bugs that reappear even when using skills, and produces regression tests as a side effect.

workflowbug-fixingTDDtestingbest-practices
by dardevelin Mar 16, 2026 5/10
workflow GitHub

scaffold: 25 structured prompts to take a project from idea to working software with Claude Code

A guided AI pipeline consisting of 25 structured prompts for scaffolding new projects with Claude Code. Takes you through the full journey from initial idea to working software with clear, sequential steps. Useful for developers who want a repeatable, opinionated starting process for new projects.

scaffoldworkflowpromptsproject-managementpipelinegetting-started
by zigrivers Mar 16, 2026 7/10
workflow X

87% of AI-generated PRs had security vulnerabilities across Claude Code, Codex, and Gemini

A benchmark study where Claude Code, OpenAI Codex, and Google Gemini each built two apps from scratch — 30 pull requests total, producing 143 security vulnerabilities. All agents succeeded at features while failing at security. Highlights the critical need for explicit security requirements and code review when using AI coding agents in production.

securityvulnerabilitiesAI-generated-codebest-practicesbenchmarkcode-review
by @cytexsmb Mar 16, 2026 6/10
workflow Reddit

Benchmark: openbrowser-ai uses 2.6x fewer tokens than alternatives at 100% accuracy

A rigorous comparison of 4 CLI browser automation tools (openbrowser-ai, browser-use, playwright-cli, agent-browser) using the same Claude Sonnet 4.6 model across 6 real-world tasks. All achieved 100% accuracy, but openbrowser-ai used only 36k tokens vs 77-94k for competitors. The key insight: tool call count is the strongest predictor of cost, as every call forces the LLM to reprocess the full conversation history.

browser-automationtokensbenchmarkefficiencyagentscost
by BigConsideration3046 Mar 16, 2026 7/10
workflow Reddit

Checklist: 5 security holes Claude quietly introduced in a production SaaS

A developer discovered 5 critical security issues in Claude-generated code: missing webhook signature verification, a Supabase service role key exposed in the browser bundle, internal error details leaked to clients, Stripe payment events processed without signature checks, and subscription status trusted from the client. None were intentional — Claude simply lacked threat model awareness. Includes a CLAUDE.md docs scaffold to prevent recurrence.

securitySaaSbest-practicesbugswebhookstripeCLAUDE.md
by DJIRNMAN Mar 16, 2026 8/10
workflow Reddit

Recursively self-improve agents by analyzing execution traces with Claude Code

Uses an RLM-based LLM judge to analyze agent execution traces at scale, finding common failure patterns programmatically. Failure patterns are fed to Claude Code, which proposes concrete code edits to fix them. First test on tau2-bench achieved a 34.3% improvement after a single cycle. The RLM judge is open-sourced.

agentself-improvementexecution-tracesevalworkflowautomation
by cheetguy Mar 16, 2026 8/10
workflow Reddit

discli: Manage Discord servers from the terminal with Claude Code via SKILL.md

A CLI tool (discli) that lets Claude Code manage Discord servers through shell commands instead of MCP — avoiding the 20-40k token overhead of MCP schema loading. Uses YAML output (5x fewer tokens than JSON) and a SKILL.md for Claude to discover commands. In a live demo, two AI agents communicated on Discord: one filed a bug report, the other fixed and published an npm update in response.

discordcliworkflowappagentsautomationskill
by Lost-Trust7654 Mar 16, 2026 8/10
workflow GitHub

mx-workflow: Full Dev Lifecycle Plugin for Claude Code With Slash Commands

A Claude Code plugin providing a complete development lifecycle workflow through slash commands and AI agents. Covers the full cycle: plan, implement, test, and ship. Designed to be a first-class Claude Code integration rather than an external script.

workflowslash-commandsagentsdev-lifecycleplugin
by joshtune Mar 16, 2026 7/10
workflow Reddit

Claude Code Architecture: Fix the Six Layers Before Blaming the Model

A deep-dive arguing that Claude Code output degradation is an architecture failure, not a model failure. Covers six load-bearing layers: context, skills, tools/MCP, hooks, subagents, and verification — with CLAUDE.md compression rules to preserve architecture decisions and the HANDOFF.md technique for reliable session continuity.

architectureCLAUDE.mdcontextworkflowhookssubagentsMCPsession
by HuckleberryEntire699 Mar 16, 2026 9/10
workflow Reddit

Built a road builder browser game with help of Claude Code

Traffic Architect - https://www.crazygames.com/game/traffic-architect-tic I wanted to build a traffic/road management game inspired by Mini Motorways and Cities: Skylines, but focused purely on roa...

workflow
by Grenagar Mar 16, 2026 7/10
workflow Reddit

Experiment: Two Claude Code Instances Coordinating Autonomously via Discord with Timer Protocol

A proof-of-concept where two Claude Code instances coordinate work autonomously by sending messages to each other through Discord using a timer-based polling protocol. Each instance has a defined role and polls for instructions at regular intervals. Demonstrates cheap multi-agent coordination using existing chat infrastructure.

multi-agentcoordinationdiscordpollingautonomousexperiment
by Acrobatic-Result9667 Mar 16, 2026 7/10
workflow Reddit

Multi-Agent Claude Code Orchestration in Elixir with Real-Time Dashboard and DAG Workflows

A multi-agent orchestration system built with Claude Code in Elixir featuring a real-time dashboard, DAG-based workflows, gossip mode for agent communication, and fault recovery. Uses Elixir's OTP supervision trees for robust agent lifecycle management. Includes parallel task execution with dependency tracking.

elixirorchestrationdagreal-timedashboardotpfault-recovery
by _itshabib Mar 16, 2026 7/10
workflow GitHub

ark: AI Research Partner Built on Karpathy's Autoresearch with Live Dashboard

An AI research partner that autonomously determines what to measure and how to test hypotheses, built on Karpathy's autoresearch pattern. Features a live dashboard showing experiment progress and actionable results. Runs overnight loops to iterate on research questions without human involvement.

autoresearchresearchautonomousdashboardkarpathyexperiments
by leagueofdrazn Mar 16, 2026 7/10
workflow GitHub

threadtrace: Multi-Agent Correctness Bug Discovery Plugin for Claude Code

A Claude Code plugin that deploys multiple agents to hunt for correctness bugs — the kind that break production while all dashboards show green. Agents probe edge cases, race conditions, and integration boundaries that unit tests typically miss. Designed as a pre-release quality gate.

bug-discoverycorrectnessmulti-agenttestingqualityedge-cases
by onkardahale Mar 16, 2026 8/10
workflow GitHub

ccpkg: Open Packaging Format for AI Coding Assistant Extensions Across Any Compatible Tool

An open packaging format for distributing AI coding assistant extensions — one archive installs skills, agents, MCP servers, and hooks across any compatible tool. Aims to be the universal package standard for the Claude Code ecosystem, similar to how npm works for Node. Vendor-neutral by design.

packagingstandardopen-formatcross-tooldistributionnpm-like
by zircote Mar 16, 2026 9/10
workflow GitHub

human-in-loop: SPEC-First Multi-Agent Framework for Claude Code

A multi-agent framework for Claude Code centered on specification-first development with human approval gates. Agents work from formal specs and pause at key decision points for human review before proceeding. Designed for building reliable, auditable AI-generated software.

spec-firsthitlmulti-agentapproval-gatesauditable
by deepeshBodh Mar 16, 2026 7/10
workflow GitHub

openspec-extended: 7-Phase Autonomous Implementation Workflows with Specialized Agents

Extends the OpenSpec framework with autonomous 7-phase implementation workflows and specialized agents for each phase. Adds utility skills for AI coding assistants to follow a disciplined requirements-to-deployment pipeline. Covers planning, design, implementation, testing, documentation, review, and release.

openspec7-phaseautonomousimplementationagentspipeline
by amauryconstant Mar 16, 2026 8/10
workflow GitHub

batty: Supervised Agent Execution for Software Teams — Kanban, tmux-Native, Test-Gated

A structured agent execution framework for software teams using a Kanban-style task queue, tmux for terminal management, and automated test gates that block agent progress on failures. Designed for teams who want control and auditability over what AI agents do. Keeps humans in the loop at key checkpoints.

kanbantmuxtest-gatedsupervisedteamhitl
by battysh Mar 16, 2026 8/10
workflow GitHub

secure-sdlc-agents: Claude Code Sub-Agents Enforcing Security Across the Full SDLC

A team of Claude Code sub-agents covering every phase of the Software Development Lifecycle from a security perspective: ASVS requirements, threat modeling, SAST triage, IaC review, compliance attestation, and release sign-off. Drop into any project without needing a dedicated security team. AGPL-3.0.

securitysdlcsastthreat-modelingcomplianceiacasvs
by Kaademos Mar 16, 2026 9/10
workflow GitHub

ai-claude-loop: Automated Daily AI News Digest Using Claude Code's /loop Feature

Uses Claude Code's /loop feature to automatically gather international AI news across 6 categories, summarize them bilingually in English and Traditional Chinese, and post a formatted digest to Slack. A working example of using /loop for scheduled autonomous content pipelines.

loopautomationnewsdigestslackbilingual/loop
by osisdie Mar 16, 2026 7/10
workflow GitHub

wayfind: Team Decision Trail for AI-Assisted Development

Captures and preserves architectural decisions made during AI-assisted coding sessions so teams can understand why code was built the way it was. Creates a searchable trail of agent decisions, trade-offs considered, and reasoning behind implementation choices. Helps onboard new team members to AI-generated codebases.

decisionsdocumentationteamaudit-trailarchitecture
by usewayfind Mar 16, 2026 7/10
workflow GitHub

chairman: The Operating System for AI-Native Organizations with /onboard Command

A Claude Code project that acts as an operating system for teams fully running on AI agents. Clone the repo, open Claude Code, and run /onboard to bootstrap the entire AI-native organization structure. Designed for teams where agents handle most of the operational work.

organizationonboardingai-nativeteamslash-commands
by victordelrosal Mar 16, 2026 7/10
workflow GitHub

agent-workspace: Launch Agent Workspaces with Docker, Git Worktrees, and Zellij via CLI

A CLI tool that automates creating fully isolated agent development environments by combining Docker containers, git worktrees, and Zellij terminal sessions. Run multiple parallel Claude Code agents on the same codebase without conflicts. Simple one-command setup for each workspace.

worktreesdockerzellijparallel-agentsworkspace
by pandu1992 Mar 16, 2026 8/10
workflow GitHub

codexspec: Spec-Driven Development Toolkit for Claude Code with Multi-Language Support

A Spec-Driven Development (SDD) toolkit that integrates with Claude Code to enforce structured design-before-code workflows. Supports multiple programming languages and guides the agent through a requirements-to-implementation pipeline. Helps reduce hallucinations and improve architectural consistency.

spec-drivensddworkflowmulti-languagearchitecture
by Zts0hg Mar 16, 2026 7/10
workflow GitHub

super-ralph: Autonomous AI Development Loop with Disciplined Coding Methods

super-ralph is a framework for automating autonomous AI development using a tested loop and disciplined coding methods designed to produce reliable, production-ready applications. Inspired by the Ralph Loop pattern for maintaining code quality in extended autonomous sessions.

autonomousloopworkflowproductiondisciplinedautomation
by rosa113087 Mar 16, 2026 6/10
workflow X

Complete Claude Code Workflow: Agents, Worktrees, Slash Commands, Hooks, MCP, Memory

A breakdown of a comprehensive Claude Code development workflow covering agents, git worktrees, slash commands, hooks, MCP integrations, memory files, and prompt structure. Full setup documented in a blog post for developers looking to maximize their Claude Code productivity.

workflowagentsworktreeshooksmcpmemoryproductivity
by @buildwithhassan Mar 16, 2026 6/10
workflow Reddit

Workflow Pattern: Opus Orchestrator with Aggressive Sonnet/Haiku Subagent Delegation

A Claude Code workflow pattern where Opus acts as the high-level orchestrator while aggressively delegating execution tasks to Sonnet and Haiku subagents via the Task tool. This pattern improves both token efficiency and time efficiency — Opus stays focused on direction and context while subagents handle all implementation work.

orchestrationsubagentsopussonnethaikutoken-efficiencydelegation
by PrintfReddit Mar 16, 2026 7/10
workflow Reddit

Control Claude Code Sessions from Your Phone via Telegram or WhatsApp

A setup combining OpenClaw and the Workstation open-source project for full mobile control of Claude Code sessions via Telegram or WhatsApp. Supports plan approval, Q&A, session creation, interruption, and screenshots from your phone. The video demonstrates a full plan-review-to-approval flow from a Telegram chat.

mobiletelegramwhatsappremotecontrolautonomousworkflow
by HourAfternoon9118 Mar 16, 2026 7/10
workflow GitHub

devpace: BizDevOps Rhythm Manager for Claude Code — 18 Skills to Trace Goals to Code

devpace is a BizDevOps rhythm manager for Claude Code providing 18 skills that trace business goals through requirements and code changes. Helps teams maintain alignment between business objectives and technical implementation within Claude Code sessions.

bizdevopsskillsworkflowbusiness-goalstraceabilitymanagement
by arch-team Mar 16, 2026 7/10
workflow Reddit

Go Proxy + Restish: Turn Business REST APIs into Secure CLI Tools for Claude Code

A pattern for exposing business REST APIs as CLI tools for Claude Code without placing API keys on the local machine. A Go proxy on Cloud Run injects real credentials from Secret Manager while issuing short-lived GCP identity tokens to Restish CLI. Claude Code calls the CLI via bash — no MCP server, no custom SDK needed. Processed 5 support tickets in 2 minutes as a live example.

workflowapiclisecuritygcprestproxy
by Haunting_One_2131 Mar 16, 2026 7/10
workflow GitHub

solutions-architecture-agent: Full Architecture Lifecycle Skills from Ideation to Cost

solutions-architecture-agent orchestrates specialized skills through the complete solutions architecture lifecycle: ideation, requirements, architecture design, team composition, and cost estimation. Designed for Claude Code CLI locally and Anthropic cloud deployment.

architectureworkflowskillsrequirementscostdesign
by Modular-Earth-LLC Mar 16, 2026 7/10
workflow GitHub

Meta: 5-Phase Development Workflow Engine for Claude Code with Autonomous Git Agents

Meta is a development workflow engine for Claude Code with a structured 5-phase cycle: Plan, Implement, Recap, Improve, and Close. It spawns autonomous git agents and manages worker processes via tmux, enabling persistent, structured development sessions with clear phase transitions and autonomous execution.

workflowphasesgittmuxagentsautomation
by brunowinter8192 Mar 16, 2026 8/10
workflow Reddit

claude-devcontainers: Secure Skip-Permissions Mode via mitmproxy Token Replacement

A modified Anthropic devcontainer setup that lets you run claude --dangerously-skip-permissions safely using a mitmproxy sidecar. The proxy strips Claude's real auth tokens in-flight and replaces them with dummy ones, so Claude cannot use valid credentials even in fully autonomous mode. Enables unattended sessions without exposing API keys inside the container.

securitydevcontainermitmproxyautonomouspermissionsdocker
by Zizzfizzix Mar 16, 2026 8/10
workflow Reddit

AGR: Autonomous Code Optimization Skill with Stateless Iteration Loop

AGR (Artificial General Research) is a Claude Code skill that creates an autonomous optimization loop for any measurable software problem. It uses stateless iterations via fresh Claude Code instances to prevent context degradation, variance-aware acceptance to surface micro-improvements, and a rework phase for promising-but-broken experiments. Demonstrated 46% speedup on a C++/Python library over 14 autonomous experiments.

autonomousoptimizationskillloopbenchmarkingworkflow
by RelativeJealous6192 Mar 16, 2026 9/10
workflow X

Claude Code Automates Brand Research to 40 Production Ad Variants via Nano Banana 2

A workflow inside Claude Code that researches any brand from just a name and URL, generates 40 ad prompts from scratch, and automatically submits them to Nano Banana 2 for static ad creation. One input produces 40 production-ready ads — replacing what would take a creative agency days. Demonstrates Claude Code as a multi-step automation orchestrator for creative work.

workflowadvertisingautomationnano bananaimage generation
by @mikefutia Mar 15, 2026 7/10
workflow Reddit

Migrating from Lovable to Claude Code + Strapi CMS + GCP Cloud Run

A non-engineer rebuilt their Lovable website using Claude Code with Strapi headless CMS and GCP Cloud Run, creating custom skills for GCP deployment, Strapi schemas, SEO, and an automated content pipeline. Anthropic frontend skills combined with custom ones removed the constraints of the Lovable credit system. Demonstrates a full-stack migration driven entirely by Claude Code skills.

workflowskillGCPStrapiCMSdeployment
by Ok-Dragonfly-6224 Mar 15, 2026 6/10
workflow GitHub

remote-claude-code: Run Claude Code on a VPS and Access from Any Device

A setup guide and tooling for running Claude Code on a VPS and accessing it securely from any device. Enables persistent, cloud-based Claude Code sessions that you can pick up from a phone, tablet, or any computer. Useful for developers who want uninterrupted sessions or access to a more powerful remote machine.

workflowVPSremotesetupcloud
by djimenez007 Mar 15, 2026 6/10
workflow Reddit

Using i3wm to Manage Dozens of Claude Code Terminal Sessions

A guide to using i3wm tiling window manager for efficiently running many parallel Claude Code sessions with up to 78 terminals across nine workspaces. Paired with Arch Linux and xrdp for remote access, i3wm is simpler than tmux for multi-agent setups. Also suggests letting Claude Code configure i3 and polybar via natural language.

workflowi3wmparallel agentsterminallinux
by time-always-passes Mar 15, 2026 5/10
workflow Reddit

Running 5–6 Claude Code Agents in Parallel Without Conflicts: Lessons Learned

Practical guide from months of running multiple Claude Code sessions simultaneously: assign agents to non-overlapping directories, add a shared CLAUDE.md rule telling agents to skip errors in files they did not edit, give each agent its own isolated browser profile, log all actions to a database with session IDs, and use git worktrees for shared code. A single CLAUDE.md rule eliminated 80% of cascading failure loops.

workflowparallel agentsCLAUDE.mdgit worktreesorchestration
by Deep_Ad1959 Mar 15, 2026 8/10
workflow Reddit

Rebuilt our website from lovable to claude code - here is what I learned

We used Lovable for our first website. Switching to build with Claude code was an obvious game changer - felt like I got super powers. Lovable did have some advantages when we were getting started....

skillworkflowapiautomationreview
by Ok-Dragonfly-6224 Mar 15, 2026 10/10
workflow GitHub

contextdocs: AI Agent Maintains Its Own Context Files Across Coding Tools

contextdocs is a Claude Code plugin with an AGENTS-first model where the AI agent maintains its own context documentation files. Supports Codex, Copilot, Cursor, Gemini, and 3 more tools — keeping context consistent across all of them.

workflowcontextdocumentationmulti-toolagent-firstcross-tool
by littlebearapps Mar 15, 2026 6/10
workflow GitHub

signum: Risk-Adaptive Development Pipeline with Adversarial Consensus Code Review

A development pipeline that adapts based on code risk level and requires adversarial consensus for code reviews — multiple agents critique and defend changes before they're accepted, reducing the chance of low-quality code passing review.

workflowrisk-adaptivecode-reviewadversarialconsensuspipeline
by heurema Mar 15, 2026 6/10
workflow GitHub

cc-rpi: Blueprint Repository for Claude Code Projects — RPI Methodology and Templates

A blueprint repository providing a structured methodology (RPI: Requirements, Plan, Implement), known agent error patterns, operational rules, and project templates for Claude Code projects. A starting point for professional Claude Code project setups.

workflowmethodologytemplatesblueprintrequirementsproject-setup
by juan294 Mar 15, 2026 6/10
workflow GitHub

sweteam: Coding Agent Orchestrator That Manages Itself

sweteam orchestrates your coding agents so you don't have to — handling task distribution, coordination, and lifecycle management with minimal manual intervention.

orchestrationagentsself-managingcoordinationautomation
by SiluPanda Mar 15, 2026 5/10
workflow GitHub

oh-my-agent: Portable Multi-Agent Harness for .agents-Based Skills Across 5 Tools

A portable multi-agent harness supporting .agents-based skills, workflows, and standards-aware agent teams across Antigravity, Claude Code, Codex, OpenCode, and more — enabling skills to run consistently across any compatible AI coding tool.

workflowmulti-agentportablecross-toolharnessstandards
by first-fluke Mar 15, 2026 6/10
workflow GitHub

CodeAgora: Multi-Agent Debate Review System for Claude Code

CodeAgora implements structured multi-agent code review as a debate — agents argue for and against proposed changes, building consensus through adversarial review before code is accepted.

workflowcode-reviewdebatemulti-agentadversarialconsensus
by justn-hyeok Mar 15, 2026 6/10
workflow GitHub

clor: Claude Code Lightweight Orchestrator

A lightweight orchestrator for Claude Code sessions — provides simple coordination primitives for multi-agent workflows without the overhead of heavier orchestration frameworks.

orchestrationlightweightmulti-agentcoordinationcli
by lxnewayfarer Mar 15, 2026 6/10
workflow GitHub

meta-harness: Self-Improving Harness Router for Claude Code

A harness router for Claude Code that improves itself over time — learns from past task outcomes to route future tasks more effectively. Applies meta-learning to agent orchestration.

workflowharnessroutingself-improvingmeta-learningorchestration
by SeongwoongCho Mar 15, 2026 6/10
workflow GitHub

graqle: Graph-of-Agents Reasoning for Self-Governing Development in Claude Code

graqle implements graph-of-agents reasoning for Claude Code — agents reason over a shared graph structure, enabling self-governing development with 13 innovations and integrated MCP. Designed for complex reasoning tasks that benefit from structured graph traversal.

workflowgraph-of-agentsreasoningself-governingmcpcomplex-tasks
by quantamixsol Mar 15, 2026 6/10
workflow GitHub

convoke-agents: Domain-Specialized AI Agent Teams for Complex Systems

convoke-agents ships domain-specialized AI agent teams for complex systems — starting with Vortex, a team of 7 agents and 22 workflows for product discovery. More specialized teams are planned.

workflowdomain-specializedmulti-agentproduct-discoveryagent-teams
by amalik Mar 15, 2026 6/10
workflow GitHub

swarmux: Agent-First tmux Swarm Orchestration CLI

A tmux-native CLI for orchestrating local AI coding agent swarms. Manages agent lifecycles, distributes tasks across panes, and provides structured coordination for parallel development — all within the terminal.

tmuxswarmorchestrationparallelcliagents
by ghillb Mar 15, 2026 7/10
workflow GitHub

vibe-remote: Command Your AI Coding Army from Slack, Discord, or Lark

vibe-remote lets you stream and control Claude Code, OpenCode, or Codex sessions from Slack, Discord, or Lark in real time — enabling remote control of coding agents from your phone or any chat client without being at your development machine.

workflowslackdiscordremotestreamingmulti-agent
by cyhhao Mar 15, 2026 7/10
workflow GitHub

scout-and-wave: Parallel AI Agents with File Ownership and Worktree Isolation

A multi-agent system where every file belongs to exactly one agent and every agent works in its own git worktree — preventing agents from breaking each other's code. You review the plan before any code is written, then agents execute in parallel safely.

multi-agentparallelworktreefile-ownershipisolationplan-review
by blackwell-systems Mar 15, 2026 7/10
workflow GitHub

planckatron-claude-code: Parallel AI Workers That Never Conflict

Planckatron is a drop-in folder plugin for Claude Code that enables parallel AI workers across frontend, backend, fullstack, automation, libraries, and monorepos — using file assignment to prevent worker conflicts. Activate by saying "Planckatron" in your session.

workflowparallelmulti-agentconflict-freepluginmonorepo
by AgriciDaniel Mar 15, 2026 7/10
workflow GitHub

web-architect: One Command, Four Agents, Full Design-to-Code Pipeline

A Claude Code skill that orchestrates a 4-agent design-to-code pipeline with Constrained Generation to produce unique, premium web projects — not generic AI output. Each agent handles a specialized phase from design to deployed code.

workflowmulti-agentdesign-to-codewebconstrained-generationpipeline
by choppawave-beep Mar 15, 2026 7/10
workflow GitHub

shiplog: Turn GitHub Into a Knowledge Graph for AI-Assisted Development

shiplog turns your GitHub history into a structured knowledge graph for AI development — with cross-model review gates, evidence-linked issue closure, model-tier routing, and provenance signing. Works as a single Claude Code skill compatible with Codex and Cursor.

workflowgithubknowledge-graphreview-gatesprovenancemulti-tool
by devallibus Mar 15, 2026 7/10
workflow GitHub

agentforge-pro: 50+ Production-Ready AI Coding Agents, Skills, and CLAUDE.md Templates

A collection of 50+ production-tested agents, skills, and CLAUDE.md templates for Claude Code and Cursor. Designed to eliminate configuration overhead — skip setup and start building immediately with battle-tested patterns.

workflowagentsskillsCLAUDE.mdtemplatesproduction-readycollection
by agentforge869 Mar 15, 2026 7/10
workflow GitHub

praktor: Multi-Agent Claude Code Orchestrator with Telegram I/O and Docker Isolation

A full Claude Code orchestrator that routes tasks through Telegram for I/O, isolates agents in Docker containers, implements swarm patterns, and provides a Mission Control UI. Designed for running complex multi-agent workflows with safety boundaries.

orchestrationmulti-agentdockertelegramswarmmission-control
by mtzanidakis Mar 15, 2026 7/10
workflow X

Analysis: 91 Claude Code Prompts to 75K Lines of Production Code

A detailed breakdown of every prompt used to build a 200+ tool MCP server with Claude Code. Key findings: median prompt was 32 characters, most-used prompt was "push" (9x), correction rate was 2.2%. Demonstrates that effective agentic development relies on short, direct prompts.

workflowpromptingmetricsproductionmcp
by @JulianSoreavis Mar 15, 2026 7/10
workflow X

Claude Code + Granola + OmniFocus MCP: Automated Meeting Commitment Tracking

A practical workflow where Claude Code reads Granola meeting transcripts and automatically adds any commitments made during meetings to OmniFocus via MCP. A demonstration of chaining meeting AI with task management through Claude Code.

workflowmcpmeetingstask-managementomnifocusgranola
by @andrewjmason Mar 15, 2026 6/10
workflow X

Anthropic Launches Free AI Academy with 13 Certified Courses

Anthropic released a free AI learning academy covering Claude 101, Claude Code in Action, Building with the Claude API (8+ hours), Intro to MCP, Advanced MCP, Agent Skills, and Claude on AWS Bedrock and Google Vertex. All 13 courses are fully free with certification.

learningcoursesmcpapicertificationfree
by @EricSkeldon Mar 15, 2026 6/10
workflow GitHub

creating-agent-teams: Agent Team Manager for Claude Code

creating-agent-teams is a Claude Code skill set that manages multi-agent teams by analyzing tasks, selecting the right models, assigning roles, and coordinating collaboration to optimize efficiency. It provides a structured approach to spinning up and managing agent teams for complex, parallelizable development tasks within Claude Code.

agentsteamcoordinationmulti-agentworkfloworchestrationopen-source
by ELVINgotIT Mar 13, 2026 7/10
workflow X

Video Tutorial: Full Claude Code Creator Workflow with Opus 4.6, Plan Mode, MCP, and Slash Commands

A complete video tutorial covering the Claude Code power-user workflow: running multiple Claude instances simultaneously, configuring Opus 4.6 with Plan Mode, creating custom slash commands, configuring MCP integrations, setting intelligent permissions, and building feedback loops. Demonstrates all commands in practice.

tutorialworkflowplan-modeopusmcpslash-commandsmulti-agent
by @adriano_viana Mar 13, 2026 6/10
workflow X

Markdown-to-Video Generation System Built in 1 Hour Using Claude Code

A live demonstration of building a Markdown-to-video generation system using Claude Code in under an hour. The project showcases Claude Code\'s vibe-coding approach for rapid AI-assisted development, turning structured Markdown documents directly into generated video output.

workflowvideomarkdownvibe-codingrapid-developmentdemo
by @AICUai Mar 13, 2026 5/10
workflow Reddit

Overnight Agent Swarm: Autonomous Codebase Improvement While You Sleep

A workflow where Claude Code agents run autonomously overnight, claiming tasks from a shared ledger, running tests, and committing code without any human in the loop. Agents decide what deserves their attention and hunt for work on their own, enabling continuous codebase improvement during off-hours.

automationagentsswarmovernightautonomousworkflow
by tyschan Mar 13, 2026 5/10
workflow Reddit

Claude Code in Academic Research: Plotting, Code Migration, and LaTeX Proof Formatting

A research team used Claude Code as an auxiliary tool while writing a paper, covering three use cases: generating publication-ready figures from vague instructions, migrating a search environment across two very different codebases in under an hour, and formatting 12+ pages of math proofs in LaTeX (catching an incomplete bound condition). The post also identifies where Claude Code hits its limits: debugging problems where the answer is not in the code or logs.

researchlatexworkflowmigrationacademicplotting
by Muted_Lettuce414 Mar 13, 2026 6/10
workflow Reddit

Chuck: semantic CLAUDE.md rule injection that learns what you need

Chuck is a context management tool for Claude Code that injects only the CLAUDE.md rules relevant to your current work, rather than loading everything every prompt. It remembers architectural decisions across sessions, catches contradictions before they land in code, generates session handoff briefs, and scales back automatically as context fills.

contextclaude-mdrulesmemoryoptimization
by misfit_elegy Mar 13, 2026 8/10
workflow Reddit

Using Claude Code for FPGA development: driver stacks, SystemVerilog, and Vivado TCL

An FPGA engineer shares how Claude Code replaced a dedicated software engineer for PCIe DMA driver development: writing Linux kernel drivers, SystemVerilog RTL, testbenches, and Vivado TCL automation all from Claude Code. Includes debugging both driver and FPGA sides simultaneously via SSH, an unexpectedly powerful use case outside typical web/backend work.

fpgaverilogembeddedhardwarecase-study
by affabledrunk Mar 13, 2026 5/10
workflow Reddit

Saguaro: background code review that feeds findings back to Claude Code mid-session

Saguaro runs a background code review during your Claude Code session and feeds findings back to the same agent that wrote the code — no PR, no config, no API key required. Claude autonomously identifies and fixes issues like SQL injection or missing token validation mid-session without any user input. Runs locally, open source (Apache 2.0), uses your existing Claude Code subscription.

code-reviewlocalopen-sourcesecurityautomation
by Natural_Gas2480 Mar 13, 2026 8/10
workflow X

gnap: git-based coordination for Claude Code multi-agent teams (zero servers)

gnap solves the coordination problem in Claude Code multi-agent setups: how does agent B know when agent A finishes? The answer is git — using just 4 JSON files and no servers. Enables chained agent execution via shared git state at github.com/farol-team/gnap.

multi-agentgitcoordinationautomationopen-source
by @cofounder_run Mar 13, 2026 7/10
workflow GitHub

leashd: end-to-end agentic coding workflow with three-layer safety pipeline

leashd implements a Plan → Execute → Test workflow for Claude Code with a three-layer safety pipeline: sandbox isolation, YAML-based policies, and human-in-the-loop approval. It supports driving Claude Code remotely from Telegram with a full audit trail and agent-driven end-to-end testing.

workflowsafetytelegramsandboxaudit
by nodenova Mar 13, 2026 7/10
workflow X

How to Run Qwen3.5 Locally via Claude Code on 24GB RAM

A guide for running the Qwen3.5 model locally through Claude Code on a machine with 24GB RAM. Demonstrates using Claude Code as an orchestration layer for local model inference, combining Claude's tooling with open-source model capabilities.

workflowlocalqweninferenceopen-source
by @PaulLarionov Mar 13, 2026 5/10
workflow X

Deep Dive: How MCP Tool Schemas Consume Claude Code Context at Every Reasoning Step

Technical analysis of what happens to Claude Code's context window when multiple MCP servers are connected — all tool schemas from all servers are presented simultaneously as a flat list at every step. Key insight for optimizing MCP usage in token-constrained workflows.

workflowmcpcontext-windowoptimizationtokens
by @splusq Mar 13, 2026 6/10
workflow X

Claude Code Can Act AS an MCP Server — Expose Bash and File Ops to Other Clients

Underutilized Claude Code feature: running 'claude mcp serve' makes Claude Code itself into an MCP server that exposes bash, file ops, and other tools to any MCP-compatible client including Cursor. Also covers Tool Search's measured improvement from 49% to 74% tool accuracy.

workflowmcpservercursortool-search
by @QuantumMentat Mar 13, 2026 7/10
workflow GitHub

workflow: File-Based Linux Orchestrator with Claude/Codex Integration and 42 Templates

A TUI + CLI workflow orchestrator for Linux built for the AI era — integrates Claude, Codex, and Gemini, includes 42 bundled workflow templates, and supports shell history import. Designed for sysadmins who want to preserve and reuse one-liners with AI assistance.

workfloworchestratorlinuxsysadmintemplates
by vchaindz Mar 13, 2026 7/10
workflow Reddit

How to Manage Architectural Drift Introduced by Claude Code Over Time

A practitioner's analysis of how Claude Code gradually introduces architectural drift — inconsistent patterns, style divergence, and technical debt — and the custom structure built to detect and correct it. Applicable to any AI coding tool, not just Claude Code.

workflowarchitecturedriftqualityrefactoring
by Acceptable_Play_8970 Mar 13, 2026 6/10
workflow Reddit

Claude Writes Tests That Pass But Don't Test Anything — Security Implications

A candid assessment of Claude Code's tendency to generate tests that satisfy the test runner without actually verifying correctness. Includes a real example where a security scanner found a live private key that passing tests missed. A must-read for anyone shipping AI-generated code.

workflowtestingsecurityqualitycaveats
by Brilliant_Edge215 Mar 13, 2026 7/10
workflow Reddit

Full Playbook for Setting Up Claude CoWork for Your Team

A comprehensive guide for configuring and deploying Claude CoWork (Anthropic's collaborative AI workspace) for team use. Covers authentication, shared skill libraries, permission models, and best practices for coordinating multiple users in a shared Claude environment.

workflowcoworkteamsetupcollaboration
by Born-Comfortable2868 Mar 13, 2026 7/10
workflow Reddit

1M Context Window Now Generally Available for Claude Opus 4.6 and Sonnet 4.6

Anthropic's official announcement: Claude Opus 4.6 and Sonnet 4.6 now include the full 1M token context window at standard pricing on the Claude Platform. Opus 4.6 achieves 78.3% on MRCR v2 at 1M tokens — highest among frontier models. This is now the default for Claude Code Max/Team/Enterprise users.

workflowcontext-windowopussonnetannouncement
by ClaudeOfficial Mar 13, 2026 6/10
workflow GitHub

claude-flow-kit: Modular Language-Specific Templates for Claude Code Agent Workflows

A modular template system for setting up Claude Code AI agents and workflows across different programming languages. Provides project-specific structure for agents, documentation, and workflow definitions, making it easy to bootstrap a well-organized Claude Code project.

workflowtemplateagentsmodularsetup
by TheKathan Mar 13, 2026 7/10
workflow Reddit

Open-Source Framework Giving Claude Code 11 Specialist Agents and Multi-Agent Review

An AI-native development framework that transforms Claude Code from a single-agent tool into a structured 11-specialist-agent team. Agents include roles like architect, security reviewer, test engineer, and documentation writer, with structured handoffs and parallel review.

workflowmulti-agentspecialistframeworkopen-source
by ImpressivePilot7036 Mar 13, 2026 8/10
workflow Reddit

Has Anyone Fully Eliminated Human Code Reviews with Claude Code?

Community discussion on r/ClaudeCode exploring whether fully agentic pipelines with automated code review can replace human review in production. Covers the current state of trust, failure modes, and what conditions make full automation viable.

workflowcode-reviewagenticproductionautomation
by GraphicalBamboola Mar 13, 2026 5/10
workflow Reddit

Distilled Playbook: 186+ Replies on How to 10x Claude Code Output

A practitioner-curated playbook distilled from 186+ replies in a viral X thread started by @toddsaunders. Covers concrete techniques people are actually using to dramatically improve Claude Code output quality, with convergent strategies across experienced users.

workflowtipsplaybookproductivity10x
by gregb_parkingaccess Mar 13, 2026 8/10
workflow Reddit

Flightplanner: Framework-Agnostic E2E Testing Principles for AI Coding Agents

A framework-agnostic approach to end-to-end testing designed for AI-assisted development workflows. Provides principles and patterns for validating AI-generated code at the integration level, applicable across Claude Code, Cursor, and other agents.

workflowtestinge2eframework-agnosticquality
by ereslibre Mar 13, 2026 6/10
workflow Reddit

Is There a Way for Claude Code to See Its Own Context Usage?

Discussion exploring whether Claude (the model) can be given awareness of its own context window utilization during a session. The poster has hooks, MCP servers, and custom skills configured, and wants Claude to autonomously manage context before hitting limits.

workflowcontext-windowhooksself-awarenessconfiguration
by srirachaninja Mar 13, 2026 5/10
workflow GitHub

dorkos: Scheduling, Messaging, and Agent Discovery for Claude Code

An orchestration layer for Claude Code agents providing scheduling, inter-agent messaging, and dynamic agent discovery. Designed around the principle that intelligence doesn't scale but coordination does — enables complex multi-agent workflows without a monolithic context.

workfloworchestrationmulti-agentschedulingmessaging
by dork-labs Mar 13, 2026 7/10
workflow GitHub

Claude Code Engineering: Making Claude Code a Reusable, Governable Engineering System

Companion repository for a Chinese course on engineering Claude Code properly — turning it from a conversational tool into a designable, reusable, governable engineering system. Demonstrates real engineering workflows including system design, skill architecture, and quality control.

workflowengineeringarchitecturegovernancecourse
by huangjia2019 Mar 13, 2026 7/10
workflow Reddit

6-Part Claude Code System That Doubled Output and Eliminated Context Blowup

A detailed breakdown of a 6-component system for using Claude Code at scale: structured task management, context hygiene, explicit handoff protocols, checkpointing, role separation, and review loops. Addresses the root cause of context degradation in long sessions.

workflowproductivitycontextsystemarchitecture
by Alnw1ck Mar 13, 2026 8/10
workflow Reddit

Using a Persistent REPL as AI Compute Layer Instead of Markdown Context Files

An approach where Claude Code connects to a long-running Clojure REPL process (via clojure-mcp) instead of relying on markdown files for context. The REPL acts as a live compute layer — Claude can evaluate code and maintain state across the session without context file overhead.

workflowreplclojuremcpstate-management
by More-Journalist8787 Mar 13, 2026 7/10
workflow GitHub

memex-plugin: Collaborative Memory Plugin for Claude Code Backed by Obsidian Vault

A collaborative memory plugin for Claude Code that captures the collaborative process as structured memos in an Obsidian vault with hybrid search. Persistent, searchable, and interconnected memory that lets Claude build on past work across sessions.

memoryObsidiansearchpluginhybrid search
by linxule Mar 13, 2026 7/10
workflow Reddit

Corporate Developer Claude Code Workflow: Spec → Build → Test → Review

A backend developer at a large US finance company shares their production workflow: provide detailed specs + docs + internal wikis upfront, let Claude make a first pass with a working Markdown document, manually review and test, then iterate. The ongoing working MD keeps context consistent across the session.

workflowcorporateenterprisebackendfinancebest practices
by Ok_Fish4116 Mar 13, 2026 6/10
workflow GitHub

skillfoundry: AI Engineering Framework With Quality Gates and Persistent Memory

An AI engineering framework with built-in quality gates, persistent memory, and multi-platform support. Works inside Claude Code, Cursor, Copilot, Codex, and Gemini — making it platform-agnostic for teams using multiple AI coding tools.

frameworkquality gatesmemorymulti-platformengineering
by samibs Mar 13, 2026 7/10
workflow Reddit

Spec Your Features Like an Engineer Before Giving Claude Code Anything to Build

A developer with years of pre-AI SaaS experience argues that treating Claude Code as a force multiplier — not a magic wand — requires detailed feature specs. Writing precise, engineer-style specs before starting produces dramatically better outputs than vague requests like "build me an app."

workflowspecsbest practicesmethodologyengineering
by Accomplished-Tip7106 Mar 13, 2026 7/10
workflow Reddit

BMB v0.2: 9 AI Agents Grade Code Through Blind Review Before Any Merge

BMB (Be My Butler) applies factory accident theory to AI coding — tracking near-misses to predict future failures. v0.2 adds a watchdog Analyst agent that queries a SQLite DB after every pipeline run, a Consultant with full visibility but no authority, and Context7 MCP for live docs. Open source, MIT licensed.

multi-agentcode reviewqualityopen sourcepipeline
by Life-Grass5160 Mar 13, 2026 7/10
workflow GitHub

codeframe: Think → Build → Prove → Ship Project Delivery System

A project delivery system where AI agents handle the code while CodeFrame manages everything before and after — requirements, verification, and deployment. Follows a structured Think → Build → Prove → Ship pipeline, turning ideas into verified, deployed code with clear stages.

deliveryworkflowautomationdeploymentpipeline
by frankbria Mar 13, 2026 7/10
workflow Reddit

Non-Coder Workflow: 9 Projects on Filesystem + Cowork for Sustained Knowledge Work

A detailed Claude workflow for non-coders using Chat + Filesystem + Cowork on the Desktop app. Nine projects each with their own directory, following a structured layout: WORKFLOW.txt (entry point), HANDOFF.txt (state snapshot), REFERENCE.txt (on-demand detail), TASKS.txt. Optimized to extend the sweet spot of Claude sessions as long as possible.

workflownon-coderfilesystemproject managementDesktop
by EightFolding Mar 13, 2026 6/10
workflow Reddit

TIFU: MCP Agent Hallucination Loop Spent $3,400 on Proxy Instances

A Reddit cautionary tale where a multi-agent MCP setup for data scraping got caught in a hallucination loop, spawning paid proxy instances every 45 seconds for 14 hours and charging $3,400 to a corporate card. Essential reading on why you need hard spending limits and cost controls before letting agents near real payment credentials.

mcpagentscost-controlsafetycautionary-talebudget
by Feeling_Smile5027 Mar 13, 2026 7/10
workflow GitHub

YangDuck: Guided CLI to Configure Mac Dev Tools and AI Coding Aids

A beginner-friendly CLI tool that guides Mac users through installing and configuring development tools and AI coding aids including Claude Code. Useful for quickly bootstrapping a productive development environment without manually hunting down each tool.

setupmacosclideveloper-toolsonboarding
by ByGroover Mar 13, 2026 6/10
workflow Reddit

163,000 Lines of Code and 6,400 Tests Shipped Overnight With Claude Code

A developer shipped 163k lines of code and 6,400+ tests in a single overnight session using an autonomous Claude Code workflow. The system decomposed 144 tasks, ran them in parallel across worktrees, and merged results at dawn. A showcase of what fully autonomous multi-agent Claude Code pipelines can accomplish.

autonomousmulti-agentshowcasescaleovernight
by reybin01 Mar 13, 2026 7/10
workflow Reddit

Built a Full Linux Distro Using Claude Sonnet and Opus as the Entire Dev Team

A 23-year tech veteran with no prior distro experience built a complete Linux distribution using 10–15 simultaneous Claude sessions across multiple monitors. The key insight: the most valuable skill in AI-assisted development is knowing enough to recognize when Claude is wrong, not just prompting well.

showcasemulti-agentlinuxautonomousparallel-sessions
by SkittleDad Mar 13, 2026 7/10
workflow GitHub

cerveau.dev: Multi-Brain Protocol for Claude Code — One Protocol, Many Projects

cerveau.dev implements a shared MDPlanner-driven workflow protocol that works across many Claude Code projects without duplication. Selective rules, hooks, and agents are configured per project while the core protocol stays consistent. Solves the problem of maintaining coherent workflows across a large number of repos.

workflowmulti-projecthooksagentsmdplanner
by studiowebux Mar 13, 2026 7/10
workflow X

After 6 Production Projects: 5 Claude Code Practices That Actually Moved the Needle

After shipping 6 production projects with Claude Code, a developer shares the 5 practices with the highest ROI: invest 10 minutes in CLAUDE.md per session, use phase-based prompting (plan → review → execute), run /compact before you think you need it, use hooks for deterministic automation, and use subagents for parallel workloads.

workflowbest-practicesclaude.mdhookssubagents
by @mhdfaran Mar 13, 2026 7/10
workflow GitHub

autoimprove: Autonomous Codebase Improvement Loop for Claude Code

autoimprove creates a self-driving improvement loop: Claude Code repeatedly analyzes the codebase, identifies improvements, makes changes, verifies them, and repeats. Designed for background autonomous operation where you point it at a repo and let it improve continuously.

autonomousautomationcode-qualityself-improvement
by benmarte Mar 13, 2026 7/10
workflow GitHub

ductwork: Run AI Agents on Schedules With a Single Go Binary

ductwork is a single Go binary that schedules AI agent tasks with skills, persistent memory, and standalone or distributed execution modes. No external dependencies required. A minimal alternative to heavy orchestration frameworks for teams that just want scheduled agent runs.

schedulingorchestrationgostandalonedistributed
by Smileyjman Mar 13, 2026 7/10
workflow GitHub

flux: AI-Augmented SDLC Layer That Analyzes and Optimizes Coding Agent Sessions

flux sits between you and your coding agents, analyzing sessions to detect gaps and inefficiencies and recommending optimizations. Tracks what went wrong, where agents diverged from intent, and how to improve prompts and workflows over time. Designed to make you objectively better every day without losing your sanity.

sdlcanalyticssession-analysisoptimizationworkflow
by Nairon-AI Mar 13, 2026 7/10
workflow GitHub

Forge by ForgePrime: Dependency-Aware Task Orchestrator for Claude Code

Forge turns a high-level plan into tracked, dependency-aware tasks that Claude Code executes step by step. Each task is aware of upstream dependencies, ensuring the agent works through a plan in the correct order without skipping prerequisites. Focused on structured schema and code generation workflows.

orchestrationtask-managementdependency-graphplanning
by ForgePrime Mar 13, 2026 7/10
workflow Reddit

DIY Anthropic-Style PR Review: Skip the $25/Review Fee

A community guide showing how to replicate Anthropic's paid Code Review feature ($25/PR) using your existing Claude subscription and a local agent. The setup uses a skill, a worktree, and a cron job to get the same multi-agent PR review behavior at no additional cost.

pr-reviewcost-savingworkflowskillsautomation
by Otherwise_Baseball99 Mar 13, 2026 7/10
workflow Reddit

Night Watch: CLI That Runs Claude on a Schedule and Opens PRs While You Sleep

Night Watch is a CLI tool that picks up tasks from your GitHub Projects board, runs Claude Code autonomously on each task in an isolated worktree, and opens pull requests with the results while you sleep or work. It supports configurable schedules, branch strategies, and automatic cleanup. Built for developers who want to offload repetitive coding work to autonomous agents overnight.

automationschedulinggithubpull-requestsautonomous
by joaopaulo-canada Mar 13, 2026 8/10
workflow Reddit

DIY PR Reviewer Using Claude Subscription and Skills

A complete setup for automated PR reviewing using your Claude subscription: a cron job checks for new/updated PRs every 3 minutes, a shell watcher skips already-reviewed ones, and a /review-pr skill runs Claude Opus in an isolated worktree to detect what changed and generate structured feedback. Costs nothing extra beyond your subscription and outperforms one-shot prompting.

pr-reviewautomationskillscronworktree
by GeorgiaWitness1 Mar 13, 2026 8/10
workflow Reddit

Fix: Claude Code /voice not working on WSL2 (Windows)

WSL2 lacks direct hardware audio, causing ALSA errors when using Claude Code voice mode. The fix involves installing the ALSA PulseAudio plugin and creating both user-level and system-wide ALSA configs to route audio through WSLg. A 3-step process that takes under 5 minutes.

voiceWSL2WindowsaudioALSA
by machdragon Mar 12, 2026 6/10
workflow GitHub

faf-cli: Cross-AI Context Format CLI (AGENTS.md, GEMINI.md, .cursorrules)

A CLI tool for the Foundational AI-Context Format (.faf) that syncs project context across multiple AI coding tools. Supports init, scoring, bidirectional sync, and export to AGENTS.md, GEMINI.md, and .cursorrules — keeping your AI context consistent whether you use Claude Code, Codex, or Cursor.

contextAGENTS.mdcursorrulescross-toolCLIformat
by Wolfe-Jam Mar 12, 2026 6/10
workflow GitHub

devflow: Agentic Development Toolkit for Claude Code with Adversarial Reviews

A development toolkit built specifically for Claude Code that adds adversarial code reviews, persistent session memory, and quality enforcement guardrails. Helps maintain higher code standards by having Claude critique its own work before committing.

qualityreviewmemorysessionenforcementClaude Code
by dean0x Mar 12, 2026 8/10
workflow X

RepoFortify + Claude Code MCP: Automated Security Fix Workflow

A security-focused development workflow: RepoFortify scans pushed code across 9 security dimensions, then Claude Code reads the fix plan via MCP and autonomously resolves the issues. No dashboards or reports — just push, scan, fix, repeat until the security score rises.

securityscanningMCPautomationworkflowRepoFortify
by @dsifry Mar 12, 2026 6/10
workflow X

Definitive terminal dev setup: Ghostty + neovim + supermaven + Claude Code split

A minimalist but powerful terminal development setup combining Ghostty terminal, neovim editor, free supermaven autocomplete, and Claude Code in a split pane. Shared by security researcher Simone Margaritelli (@evilsocket) as their preferred workflow. A quick reference for developers optimizing their Claude Code terminal environment.

terminalneovimGhosttysetupworkflowdev-environment
by @evilsocket Mar 12, 2026 5/10
workflow X

Run Claude Code remotely from iPhone using the free Termius SSH app

Termius is a free iPhone SSH client that lets you remotely connect to your work machine and run Claude Code from anywhere. The author uses this to keep AI agent sessions running between gym sets. A practical tip for extending Claude Code use beyond a fixed desk setup.

mobileremoteSSHiPhoneTermiusworkflow
by @TXpaintbrush Mar 12, 2026 5/10
workflow GitHub

RalphLoop: Autonomous coding, testing, PR creation, and deployment pipeline with Claude Code

RalphLoop implements a fully autonomous development loop using Claude Code to handle coding, testing, pull request creation, and deployment in sequence without human intervention. Designed as an agentic CI/CD pattern for routine development tasks. Represents a practical implementation of end-to-end autonomous software delivery with Claude Code.

autonomousCI/CDpipelinePRdeploymentagentic
by FlowCoder-cyh Mar 12, 2026 7/10
workflow Reddit

Claude Code autonomous agent: permission scoping with --allowedTools and --max-budget-usd

A production guide for running Claude Code headlessly in cron jobs. Explains proper use of --allowedTools to scope permissions to exactly what a task needs instead of --dangerously-skip-permissions, with real cron job examples for log review and GitHub issue creation. Covers --max-turns and --max-budget-usd as essential safeguards for unattended sessions.

autonomouspermissionscronheadless--allowedToolsproduction
by NefariousnessHappy66 Mar 12, 2026 9/10
workflow Reddit

56 Slash Commands, 318 Skills, 23 Agents: Open-Sourced Claude Code Behavioral Toolkit

After 5 months and 1,075 sessions shipping 12 products with Claude Code, this developer documented every failure pattern and built 9 behavioral rules, 56 slash commands, 318 skills, and 23 agents to fix them. The ruleset addresses issues like endless planning, broken code pushes, and over-engineering. All open-sourced with real-world battle-testing behind every rule.

workflowskillscommandsagentsbest-practicesbehavioral-rules
by treesInFlames Mar 12, 2026 9/10
workflow Reddit

Stop Using print() in Claude Code: Give It a Real Debugger Instead

Relying on print() statements for debugging in Claude Code is expensive — each one consumes tokens, fills context, and causes the agent to guess at patches instead of understanding state. This post introduces a debugger skill that lets Claude set breakpoints, inspect state, and step through code without flooding the context window.

debuggingprintcontexttokensworkflowdebugger
by AlmogBaku Mar 12, 2026 8/10
workflow Reddit

Claude Code Agent Teams: One Prompt Spawns Three Parallel Teammates

Claude Code's Agent Teams feature spawns multiple independent sessions coordinating via a shared task list. One prompt split work across three teammates who each designed a different layer — Command, Agent, and Skill — all running in parallel. The post includes the full prompt and implementation repo.

agent-teamsparallelorchestrationskillworkflow
by shanraisshan Mar 12, 2026 8/10
workflow Reddit

ctxforge: Context Sidekick for Claude Code With Persistent Per-Project Profiles

ctxforge solves the repeated context ritual at every session start: role, architecture, key files. It provides multiple named profiles per project (designer/developer/reviewer), specifying key files once that persist forever. A single init command sets everything up with reusable profiles.

contextprofilesmemoryworkflowproductivity
by AsparagusNo971 Mar 12, 2026 7/10
workflow Reddit

Analyzing 53 Days of Claude Code Prompts: Patterns, Habits, and Mistakes Revealed

By pointing Claude at ~/.claude/history.jsonl — the file storing every prompt ever typed — this developer had Claude analyze 447 prompts across 13 projects over 55 days. The analysis focused not on code quality but on prompting habits, repeated mistakes, and inefficiencies.

promptsanalysispatternshistoryself-improvement
by aviboy2006 Mar 12, 2026 7/10
workflow Reddit

Claude Code Mutual Review: Agents Grade Each Other's Implementations Against a Plan

A non-developer built a mutual review system after getting frustrated with Claude Code diverging from plans. One agent implements while another compares work against the spec before moving on. The checkpoint-based workflow dramatically reduces divergence and debugging time.

multi-agentcode-reviewplanningvibe-codingworkflow
by Life-Grass5160 Mar 12, 2026 7/10
workflow Reddit

Let Claude Be the User: Replace E2E Test Suites With AI-Driven User Simulation

Instead of writing E2E test suites that test assumptions about user behavior, this developer replaced them with Claude literally clicking through the app on every PR, given a goal in plain English. After 6 weeks the approach catches more real failures than scripted tests.

testinge2esimulationworkflowquality
by Algerio_Susei Mar 12, 2026 7/10
workflow Reddit

Vibe Graphing: Visual Orchestrator That Auto-Designs Agent Execution Graphs

Vibe Graphing lets you describe what you want and Claude designs the execution graph automatically — showing which agents run in what order with what dependencies. You review and approve the graph before execution, providing human-in-the-loop oversight without writing orchestration code.

orchestrationgraphagentshuman-in-loopvisual
by No_Pressure7134 Mar 12, 2026 7/10
workflow GitHub

architor: Phase-Gated Architecture Design With Decision Gates and Assumption Challenges

architor enforces a structured architecture design process through mandatory decision gates and challenges to assumptions before Claude writes code. Each phase must pass a quality gate before proceeding, and all decisions are documented as architecture decision records.

architecturedesignphase-gatedworkflowadr
by AhmedHabiba Mar 12, 2026 7/10
workflow Reddit

Claude Code v2.1.74: New autoMemoryDirectory Setting for Centralized Project Memory

Version 2.1.74 of Claude Code adds the autoMemoryDirectory setting, letting all projects share a single central memory directory instead of each project maintaining its own. This enables project-agnostic memory strategies and easier pruning of stale memories across the codebase.

memoryauto-memoryconfigurationupdatev2.1.74
by cosmicdreams Mar 12, 2026 7/10
workflow Reddit

Review Plans, Not Code: Multi-Agent Review Workflow That Reduces Debugging Time

Instead of reviewing code after the fact, this workflow uses Opus to generate a plan first, then runs 2-3 review rounds with Codex to harden it before any implementation. A sub-agent implements while a second compares work against the plan at each checkpoint, dramatically reducing debugging time.

planningcode-reviewmulti-agentworkflowdebugging
by TearsP Mar 12, 2026 6/10
workflow X

Claude Code Planning Mode Spawns a Haiku Sub-Agent for URL Fetching Tasks

Claude Code's planning mode spins up an 'explore' sub-agent that attempts to fetch content from URLs, but since the explore agent lacks web search tools, it refuses. Notably, this sub-agent uses Haiku (not Sonnet/Opus), revealing how Claude Code internally routes lightweight research tasks.

planningsub-agenthaikuinternalsarchitecture
by @svarunid Mar 12, 2026 6/10
workflow Reddit

Printable Claude Code Cheat Sheet — Auto-Updated Weekly by Claude Itself

A one-page printable reference for Claude Code commands, shortcuts, and features — generated by Claude researching its own documentation and updated automatically each week. Covers key slash commands, CLAUDE.md patterns, hook types, and MCP basics. Useful quick-reference for daily Claude Code users.

referencecheat-sheetcommandsCLAUDE.mdhooks
by Advanced-Many2126 Mar 12, 2026 8/10
workflow GitHub

fellowship: Claude Code Plugin for Parallel Agent Quests With Worktree Isolation

fellowship orchestrates parallel Claude Code agents using git worktree isolation, phase gates, and strict context discipline. Each agent works in its own worktree so branches do not interfere, and phase gates ensure agents move in sync. Designed for multi-agent feature development with structured handoffs.

parallelworktreeagentsorchestrationphase-gates
by justinjdev Mar 12, 2026 8/10
workflow GitHub

multi-agent-shogun: Samurai-Inspired Tmux Multi-Agent Orchestration

Samurai-inspired multi-agent system for Claude Code that uses tmux to run parallel AI tasks. Uses a Shogun to Karo to Ashigaru hierarchy for assigning and managing work across agents, inspired by feudal Japanese command structure.

multi-agenttmuxparallelorchestration
by yohey-w Mar 12, 2026 6/10
workflow Reddit

Using Claude Code as a Full CRM Brain With Markdown Skills

A real estate broker runs their entire client workflow using Claude Code — not for software development but as an AI-powered CRM. Thousands of lines of interconnected markdown skills handle client management, follow-ups, and deal tracking.

crmreal estatemarkdown skillsbusiness use casenon-developer
by EstablishmentThin744 Mar 12, 2026 7/10
workflow Reddit

Ask Claude to Probe You: Better Answers With Reverse Questioning

Instead of letting Claude make assumptions, ask it to interview you with targeted questions first. This shifts the agent into clarifying mode rather than guessing mode, reducing hallucinations and improving output quality on complex tasks.

promptingtipsagent behaviorworkflow
by CosmicInsignia Mar 12, 2026 6/10
workflow X

CLAUDE.md Folder Structure: Cut Prompt Writing from 10 Minutes to 10 Seconds

A workflow insight: structuring your project with the right auto-loaded files dramatically reduces per-prompt setup overhead. Certain CLAUDE.md files persist context across sessions and guide the AI without repetitive instructions.

CLAUDE.mdworkflowfolder-structurepromptingproductivity
by @sousa_brothers Mar 11, 2026 5/10
workflow GitHub

ralphex: Extended Ralph Loop for Autonomous AI-Driven Plan Execution

ralphex extends the Ralph autonomous execution loop to support more complex AI-driven plan execution. Enables agents to carry out multi-step plans with greater autonomy and persistence.

autonomousworkflowplanningloopexecution
by umputun Mar 11, 2026 5/10
workflow Reddit

One-Hour Baby Tracker App: Stitch Mockups → Claude Code → Firebase Workflow

A real-world showcase of the modern Claude Code stack: UI mockups via Google Stitch, exported to project folder, Claude Code with browser extension for live testing, GoDaddy MCP for domain name search, and Firebase deployment. A full custom web app built from scratch in under an hour.

workflowfirebasemcpone-shotweb-app
by gobadia Mar 11, 2026 5/10
workflow GitHub

code-addiction: Spec-Driven Development Framework for AI Coding Agents

code-addiction enforces spec-driven development—define what you want built, and AI handles the implementation. Separates problem definition from execution to maintain clarity and control when working with autonomous coding agents.

spec-drivenworkflowframeworkdevelopment
by brabos-ai Mar 11, 2026 6/10
workflow Reddit

Build Bible + Atlas: Open-Source Methodology and Classification Framework for Claude Code

Three open-source repos distilling 2,900+ Claude Code sessions into reusable patterns. Build Bible documents 14 principles, 19 patterns, and 8 named anti-patterns with a live-update skill (/qq-bible-add). Atlas provides a KCA (Knowledge/Capability/Activity) classification model for consistent placement of hooks, skills, and references.

methodologyCLAUDE.mdpatternsclassificationbest-practices
by leefuhr Mar 11, 2026 7/10
workflow Reddit

Run Claude Code on OCI Free VM + Termux for Emergency Remote Coding

Guide to setting up Claude Code on an OCI Free Tier VM (24GB RAM, 4 vCPUs) accessible via Termux on Android over SSH. Eliminates the laptop dependency for production incidents. Cost is just the Claude subscription — the VM and Termux are both free.

remotesetupandroidtermuxocivps
by ravi_kovind Mar 11, 2026 7/10
workflow Reddit

Encode AI Reasoning Into Git Commits for Better Agentic Flows

Technique for capturing the decision-making trail from Claude Code sessions directly in commit messages. Covers "Key decisions" (including deliberate non-choices), approach rationale, and a "State for next iteration" handoff section so subsequent agent sessions pick up without re-deriving context.

gitcommitsagenticworkflowdocumentationcontext
by Fluffybaxter Mar 11, 2026 7/10
workflow Reddit

Running Claude Instances with Persistent Memory, Free Thinking Time, and Peer Agents

Experiment giving a Claude instance Matrix/Bluesky access, five unstructured thinking sessions per day, and persistent memory files. Multiple researcher-run agents share a chat room and debate philosophical ideas. Demonstrates multi-agent emergent behavior over weeks.

persistent-memorymulti-agentexperimentphilosophyautonomous
by gekko513 Mar 11, 2026 6/10
workflow GitHub

claude-code-magento-agents: 30+ Specialized Agents for Magento 2 Development

Collection of 30+ specialized Claude Code agents covering the Magento 2 development lifecycle — from module scaffolding and code review to deployment automation. Designed for expert collaboration and task delegation across complex e-commerce projects.

magentoe-commerceagentsworkflowphp
by NobreTakeshi Mar 11, 2026 6/10
workflow GitHub

amux: Open-Source Claude Code Agent Multiplexer for Parallel Unattended Runs

Run dozens of parallel Claude Code agents simultaneously using tmux, unattended. Open-source multiplexer that manages session lifecycle, coordination, and output aggregation across many concurrent agent instances.

tmuxparallelmultiplexermulti-agentunattendedautomation
by mixpeek Mar 11, 2026 8/10
workflow GitHub

iterate: Parallel Design Exploration with AI Agents on React

Tool for running multiple AI agent instances simultaneously to explore divergent design directions in React projects. Each agent branch explores a different implementation path, letting you compare results and pick the best outcome.

reactdesignparallelexplorationagents
by connorwhite-online Mar 11, 2026 5/10
workflow Reddit

ArenaForge: Train RL Agents Through D&D Quests with Claude API Reasoning

Architecture using six PPO RL agents with persona-driven reward functions that play procedurally generated D&D quests managed by a DM agent. Integrates Claude Haiku/Sonnet chain-of-thought reasoning with episodic memory retrieval. Key finding: RL improved structural tasks, LLM layer improved social tasks.

reinforcement-learningmulti-agentd&dppoarchitecturereasoning
by HopeSame3153 Mar 11, 2026 5/10
workflow GitHub

claude-code-mux: Multi-Model Session Multiplexer for Claude Code

Tool for running multiple AI models in parallel within a single Claude Code session, allowing seamless switching and comparison of outputs from different models during development tasks.

multiplexermulti-modelsessionworkflow
by YonickAzuma Mar 11, 2026 5/10
workflow Reddit

PSA: Claude Code v2.1.72/v2.1.73 Has Native Memory Leaks — Workaround

Confirmed memory leak in Claude Code v2.1.72-2.1.73: ~490 MB/hour (macOS), ~980 MB/hour (Linux), up to 30 GB/hour worst case. Leak is in native ArrayBuffer allocations from undici HTTP streaming. Workarounds: set CLAUDE_CODE_DISABLE_AUTOUPDATE=1 or pin to v2.1.52.

bugmemory-leakv2.1.72workaroundperformancearraybuffer
by Terrible_Put8617 Mar 11, 2026 7/10
workflow GitHub

oh-my-claudecode: Zero-Learning-Curve Multi-Agent Task Orchestration

Multi-agent orchestration layer for Claude Code designed for minimal setup. Provides easy task delegation across parallel agents with zero configuration overhead, letting you focus on defining tasks rather than wiring agent infrastructure.

multi-agentorchestrationworkflowzero-config
by mazenyassergithub Mar 11, 2026 7/10
workflow GitHub

planning-with-files: Persistent Markdown Planning and Progress Tracking for Agents

Workflow pattern using persistent markdown files for planning, progress tracking, and knowledge storage across agent sessions — inspired by Manus. Agents read and update these files to maintain state between sessions without relying on conversation context.

planningmarkdownpersistenceworkflowstate-management
by Hans11609 Mar 11, 2026 6/10
workflow GitHub

ralph-aios: Story-Driven Agent Orchestration with Autonomous Learning

Agent orchestration framework using story-driven workflows to enable autonomous development and continuous learning within the Synkra AIOS framework. Builds on the Ralph Wiggum loop pattern for iterative, self-directed agent operation.

orchestrationstory-drivenautonomousralphlearning
by Ricocoswig Mar 11, 2026 5/10
workflow X

Tip: Ask Claude for a Continuation Prompt Before Restarting a Session

When Claude Code suggests restarting to continue, request a "restart prompt" before running /exit — Claude loses all memory on restart. Asking for a handoff prompt before exiting preserves the task context for the new session.

tipcontextrestartmemoryworkflow
by @KTLYST_labs Mar 11, 2026 5/10
workflow X

Fix: Claude Code Login Failure on macOS with LuLu or Little Snitch

If Claude Code fails its connectivity check on macOS when using a firewall like LuLu or Little Snitch, create a permanent Allow rule for the claude binary. This prevents the firewall from prompting and lets Claude Code pass its startup connectivity check.

macosfirewalllululittle-snitchtroubleshootinglogin
by @laurensvinson Mar 11, 2026 5/10
workflow Reddit

Managing AI on a Million-Line Codebase: CLAUDE.md and Memory Strategies

A widely-read guide (789k readers) explaining how to effectively use Claude Code on very large codebases. Key insight: write a CLAUDE.md that acts as an onboarding document — project structure, naming conventions, patterns, anti-patterns, and build commands. Covers the memory system for persisting knowledge across sessions and using voice-to-text for faster context capture.

claude.mdmemorylarge-codebaseworkflowonboarding
by Cultural-Ad3996 Mar 11, 2026 9/10
workflow X

Running Your Full Workday with Claude Code: CLAUDE.md, Skills vs MCP vs Hooks

A detailed video walkthrough from a CPO at a $2.6B company showing how to use Claude Code for an entire work day. Covers the daily planning command, CLAUDE.md configuration setup, the difference between Skills, MCP, and Hooks, and why he switched from Cursor to the terminal for Claude Code.

workflowclaude.mdskillsmcphooksproductivity
by @aakashgupta Mar 11, 2026 8/10
workflow X

Running 5 Claude Code Agents Concurrently with Symphony + Linear

A developer runs five parallel coding agents in a "Code Factory" using the open-source Symphony orchestrator and Linear for task management. The setup took 2-3 days to configure and now drives 100% of their team's code output. Combines Claude Code with project management tooling for high-throughput AI development.

workfloworchestrationparallel-agentsSymphonyLinearautomation
by @ryancarson Mar 11, 2026 7/10
workflow X

Honest Team Review: Where Claude Code Excels and Where It Fails

After deploying Claude Code to a full dev team, one developer shares a candid breakdown: excellent for understanding unfamiliar codebases and finding cross-file bugs, but poor for greenfield architecture. The key insight is that AI amplifies existing developer skill rather than replacing judgment.

workflowteamdeploymentbest-practicesreviewproductivity
by @jl_allemann Mar 11, 2026 6/10
workflow X

HTML Mockup-First: Design Direction Before Agents Write Code

A practical workflow pattern gaining traction: before letting agents write any code, prompt for 10+ HTML mockups to nail the visual direction. Iterate until happy with the design, then proceed to implementation. This prevents costly rewrites, keeps agentic sessions focused, and dramatically improves output quality.

workflowmockupdesignvibe-codingbest-practicestips
by @0xSero Mar 11, 2026 7/10
workflow Reddit

Use a Secondary Agent to Refeed Context After Claude Compression

When Claude compresses its context window, spin up a secondary AI (e.g. Gemini) to read the past session log, extract the critical information, and feed it back. This lets Claude power through compressions without losing track of the task — described as caffeine for CLIs. Works with any cheap secondary model to restore continuity automatically.

contextcompressionmulti-agentworkflowcontinuity
by morph_lupindo Mar 11, 2026 7/10
workflow GitHub

agent-message-queue: Maildir-Style File Queue for Local Agent-to-Agent Communication

A file-based message queue for coordinating communication between local AI agents, inspired by the Maildir format. Enables reliable agent-to-agent messaging without a server — the filesystem is the transport. Ideal for orchestrating multiple Claude Code subagents on a single machine.

multi-agentmessage-queuecommunicationmaildirorchestration
by avivsinai Mar 11, 2026 7/10
workflow Reddit

Monitoring Claude Agent SDK with OpenTelemetry: Metrics and Observability Patterns

A community discussion on production observability for Claude Agent SDK applications, featuring an OpenTelemetry-instrumented dashboard tracking token usage, error rates, request duration, cost distribution by model, and tool call patterns. Shares practical approaches for monitoring LLM calls in prod.

monitoringobservabilityopentelemetryagent-sdkmetricsproduction
by gkarthi280 Mar 11, 2026 6/10
workflow Reddit

Running Claude Agents in Docker with --dangerously-skip-permissions Safely

A practical guide to sandboxing Claude agents using Docker Compose with volume mounts, enabling full permission mode without risk. Covers mounting ~/.claude config read-only and common pitfalls like auth token expiry inside containers. Includes a reference Docker image (claudio-dev) for reproducible setups.

dockersandboxsecuritydangerously-skip-permissionsworkflowdevops
by besil Mar 11, 2026 5/10
workflow Reddit

Managing Claude Memory and Session Handoffs Across Context Limits

A community discussion on strategies for preserving project context when hitting session limits — including prompting Claude to write progress summaries before limits are reached, using subagent handoffs, and structuring memory files to minimize re-scanning tokens on resumption. Practical advice for long-running multi-session projects.

memorysessioncontext-limithandoffworkflowsubagents
by Vast_Measurement7171 Mar 11, 2026 5/10
workflow Reddit

Reliable Browser Automation Setups for Claude Code: Community Patterns

A community discussion compiling practical browser automation strategies for Claude Code, covering Playwright MCP, agent-browser CLI, Docker-based Playwright, and subagent isolation patterns. Highlights tradeoffs around token cost, reliability, and fallback handling between WebFetch and browser tools.

browserautomationplaywrightmcpworkflowreliability
by dandaka Mar 11, 2026 6/10
workflow Reddit

Agentic AI Partnership Methodology: 25k-Word Paper + Open-Source Templates

A comprehensive methodology for building a persistent, compounding AI partnership with Claude — covering shared memory architecture, cognitive engine design, trust-graduated autonomy, and multi-AI coordination. Includes fork-ready CLAUDE.md templates, continuity.md for temporal memory, and session protocols. Explicitly designed to keep humans thinking rather than becoming passive consumers of AI output.

claude-mdmemoryworkflowmethodologyagentictemplatespartnership
by soupcanninja Mar 11, 2026 8/10
workflow GitHub

claude-project-scaffold: Minimal Project Context Templates for Better Claude Accuracy

A scaffolding tool that generates lean, project-specific CLAUDE.md and context files — including only essential rules and conventions rather than bloated boilerplate. Designed to improve Claude accuracy by giving focused, relevant context without overwhelming the model with noise.

scaffoldclaude-mdproject-setupcontextworkflow
by falcosunny90-sudo Mar 11, 2026 5/10
workflow GitHub

worktrunk: Git Worktree CLI for Parallel AI Agent Workflows

Worktrunk is a CLI tool that manages Git worktrees specifically designed for running multiple Claude Code agents in parallel. Each agent works in its own isolated worktree, preventing conflicts. Helps orchestrate simultaneous agent workflows on the same repo.

gitworktreeparallelagentsworkflow
by max-sixty Mar 11, 2026 7/10
workflow GitHub

ate-series: Claude Code Agent Teams vs Subagents Benchmark

An experimental evaluation series comparing Claude Code Agent Teams against subagents across bug-fixing, feature implementation, and architecture design tasks. Provides structured benchmarks to help decide when to use agent teams vs subagents. Useful for teams designing multi-agent workflows.

benchmarkagentssubagentsevaluationmulti-agent
by kar-ganap Mar 11, 2026 7/10
workflow Reddit

Feature-Driven-Flow (FDF): Structured 7-Phase Workflow for Claude Code

FDF is a markdown-first AI delivery framework that gives Claude Code a structured 7-phase flow: Scope, Explore, Clarify, Architect, Implement, Verify, Summarize. Designed for non-trivial software work, preventing premature implementation. Now supports Claude Code alongside Codex.

workflowframeworkphasesplanningstructured
by taluyev Mar 11, 2026 6/10
workflow GitHub

erg: Workflow-Driven Autonomous Coding Daemon for Claude Code

erg is a daemon that runs Claude Code autonomously driven by workflow definitions. It persists between sessions, executing tasks according to defined workflows without manual intervention. Suitable for unattended background coding tasks.

daemonworkflowautonomousbackgroundautomation
by zhubert Mar 11, 2026 7/10
workflow GitHub

bug-hunter: Adversarial Multi-Agent Bug Finder With Auto-Fix

An adversarial AI bug hunter skill that works with Claude Code, Cursor, Codex CLI, GitHub Copilot CLI, and more. Uses a multi-agent pipeline to find security vulnerabilities, logic errors, and runtime bugs, then autonomously fixes them on a safe branch — without manual review loops.

skillsecuritybug-findingmulti-agentauto-fix
by codexstar69 Mar 11, 2026 8/10
workflow GitHub

lucidshark: Unified Code Quality Pipeline for AI-Assisted Development

lucidshark provides a unified code quality pipeline specifically designed for AI-assisted development. Coordinates linting, testing, formatting, and review steps into a single workflow that keeps AI-generated code consistent with project standards.

code-qualitypipelinelintingtestingworkflow
by toniantunovi Mar 11, 2026 6/10
workflow GitHub

GAAI Framework: Governed Agentic AI Infrastructure for Reliable Delivery

GAAI turns any AI coding tool into a reliable software delivery system. Drop a .gaai/ folder into a project — Discovery defines what to build, Delivery executes autonomously until criteria pass. Works with Claude Code, Codex CLI, Gemini CLI, Cursor, and more. No SDK required, just Markdown + YAML + bash.

workflowgovernanceframeworkautonomousdelivery
by Fr-e-d Mar 11, 2026 8/10
workflow Reddit

Using Claude Code With Google Workspace CLI to Clean Up Gmail Inbox

A practical workflow demonstrating Claude Code with the Google Workspace CLI skill to analyze and clean up a Gmail inbox with thousands of emails. Shows how to use Claude Code for real productivity automation tasks beyond coding, validating results in real-time.

workflowgmailgoogle-workspacecliautomationproductivity
by data-be-beautiful Mar 11, 2026 6/10
workflow GitHub

claude-code-multipane-iterm2: 4-Pane iTerm2 Setup for Role-Based Claude Code

A step-by-step guide with screenshots for setting up a 4-pane iTerm2 layout for Claude Code, with each pane running a different role-based model (e.g. planner, coder, reviewer, tester) with colored prompts and one-command launch. Efficient multi-model workflow setup.

iterm2terminalmulti-paneworkflowsetupmacos
by pravindurgani Mar 11, 2026 6/10
workflow Reddit

Cronde: Durable Cron for Claude Code That Survives Restarts

Cronde is a menubar app (Tauri/Rust backend, SQLite WAL) that provides durable cron scheduling for Claude Code, surviving reboots and terminal closes. Missed jobs fire once on wake (Anacron-style). Ships with a CLI and a PostToolUse hook that auto-imports CronCreate calls from Claude Code sessions.

cronschedulingpersistentautomationhookstauri
by YogiHD Mar 11, 2026 8/10
workflow Reddit

Clausona: CLI for Managing Multiple Claude Code Accounts

Clausona is a CLI that manages multiple Claude Code accounts with shared plugins and settings. New: session merge/split on profile switch — carry over conversation history or start fresh. Useful for developers managing separate work/personal Claude subscriptions.

multi-accountclisessionsprofilesmanagement
by Character-Sundae-343 Mar 11, 2026 7/10
workflow GitHub

aide: Multi-Agent Orchestration and Persistent Memory for Claude Code

aide provides multi-agent orchestration, persistent memory, and intelligent workflows for AI coding assistants. Supports both Claude Code and OpenCode. Designed to coordinate agents across complex, long-running tasks with memory that persists between sessions.

multi-agentmemoryorchestrationworkflowpersistence
by jmylchreest Mar 11, 2026 7/10
workflow GitHub

shipkit: AI-Assisted MVP Development Framework for Claude Code

Shipkit is a framework that provides skills, agents, and workflows specifically for shipping MVPs fast with Claude Code. Pre-configures the development process with opinionated choices about architecture, testing, and delivery to reduce decision fatigue and accelerate shipping.

frameworkmvpskillsworkflowshipping
by stefan-stepzero Mar 11, 2026 6/10
workflow GitHub

agentsquad: Claude Code as Tech Lead with Gemini CLI Specialist Agents

A lean AI startup team template — Claude Code acts as Tech Lead while Gemini CLI agents handle specialist roles. Bootstrap a 6-agent team onto any existing repo in minutes. Designed for human-driven oversight with AI execution.

multi-agentorchestrationgeminiteambootstrap
by JedizR Mar 10, 2026 7/10
workflow GitHub

CC-Codex-Gemini Companion Starter: Bootstrap Framework for Multi-AI Agents

Single-repo bootstrap framework to set up Claude Code, Codex, and Gemini working together with shared memory, an IM bridge, and catalog-guided MCP/skills onboarding. Standardizes multi-agent setups from day one.

multi-agentbootstrapmemorymcpcodexgemini
by d-wwei Mar 10, 2026 7/10
workflow GitHub

SDD Pilot: Spec-Driven Workflow with Quality Gates Before AI Writes Code

Replaces chaotic AI code generation with a disciplined spec-driven development workflow. Enforces structured phases with quality gates and uses AI agents to research best practices and plan architecture before a single line of code is written.

spec-drivenworkflowarchitecturequalityplanning
by attilaszasz Mar 10, 2026 6/10
workflow GitHub

CodeSyncer: Keep AI Context Clear Across Multiple Repositories

A tool to streamline AI-driven collaboration across multiple repositories, keeping context clear and projects organized. Prevents context bleed and helps AI agents stay focused when working on large codebases split across repos.

multi-repocontextorganizationcollaboration
by p3sc4d0r Mar 10, 2026 5/10
workflow GitHub

iloom: CLI + VS Code Extension for Structured AI-Assisted Development

A developer workflow system combining a CLI (system of record) and VS Code extension. Runs tasks in isolated workflows, persists analysis, plans, and decisions to your issue tracker, and surfaces assumptions, risks, and decisions in real time. Prevents AI work from becoming undocumented.

workflowvscodecliissue-trackingstructureddocumentation
by iloom-ai Mar 10, 2026 6/10
workflow GitHub

EDAF: Evaluator-Driven Agent Flow for High-Quality AI Code Generation

A flexible agent system that integrates quality checks into the code generation loop. Adapts to project needs through deterministic evaluation rather than relying solely on model judgment. Ensures generated code meets quality standards before acceptance.

evaluationqualityagentcode-generationworkflow
by elonbusk2 Mar 10, 2026 5/10
workflow Reddit

Building Your Own Agent Harness: Onboarding AI Like a New Hire

An article arguing that AI agents perform poorly in codebases without a proper onboarding harness. Agents that research the codebase, make a plan, then write code consistently outperform cold drops. A practical framework for building a harness that gives agents context before they start.

agent-harnessonboardingplanningworkflowbest-practices
by martinffx Mar 10, 2026 7/10
workflow X

Content idea discovery agent built with Claude Code searches Reddit, X and YouTube

A developer built a content idea discovery agent using Claude Code that automatically searches Reddit, X (Twitter), and YouTube to surface topic ideas. The project demonstrates using Claude Code for multi-source research automation. An early-stage but practical example of personal productivity agents built with Claude Code.

workflowagentautomationcontentclaude-code
by @sampadcodes Mar 10, 2026 5/10
workflow X

Claude Code × Obsidian: auto-generate tiered lectures and courses from a single prompt

Combining Claude Code with Obsidian creates a powerful study workflow: prompt it with what you want to learn and it auto-generates structured lectures plus beginner/intermediate/advanced hands-on courses. A novel productivity pattern for self-directed learning using Claude Code as a personal tutor and course builder.

workflowobsidianlearningproductivityclaude-code
by @gyodon_se Mar 10, 2026 6/10
workflow X

Proactive safety guardrails for Claude Code agents: scope permissions before deploying

A DevOps practitioner highlights the dangerous pattern of building AI safety guardrails reactively after incidents rather than proactively — citing a case where Claude Code deleted a production database. The recommendation is to carefully scope agent permissions and capabilities before deployment. Important reading for anyone running Claude Code in production environments.

workflowsecuritydevopsagentsclaude-codebest-practices
by @techbadger_ Mar 10, 2026 6/10
workflow X

Weekly PR-to-blog-draft pipeline built with Claude Code

A system that scans GitHub PRs weekly, identifies content-worthy engineering work, and auto-generates blog draft posts using Claude Code. The author calls this pattern "Quasi OpenClaw." Demonstrates Claude Code's potential for automating developer content creation from existing git activity.

pipelinecontent-generationgithubblogautomationworkflow
by @NickBell03 Mar 10, 2026 7/10
workflow GitHub

manager-orchestrator: No-code multi-phase agent workflow system

A multi-phase workflow orchestrator that manages tasks from planning through QA to completion without requiring code. Operates as a layered system covering planning, execution, and review phases for complex agent-driven projects.

orchestrationmulti-phaseworkflowno-codeQA
by sezerartug Mar 10, 2026 6/10
workflow X

Claude Code text-to-SQL workflow without direct DB access

A practical workflow for Claude Code analytics tasks when you lack direct data warehouse access. Save DDL and SQL queries as context, have Claude ask clarifying business questions, then generate SQL. Bridges the gap between AI assistance and restricted data environments.

text-to-SQLanalyticscontextworkflowdatabase
by @xytangme Mar 10, 2026 5/10
workflow X

Multi-agent codebase documentation with 20+ parallel agents

A workflow for thorough codebase documentation using 20+ Claude Code agents in parallel, each documenting sections independently with multiple verification passes for accuracy. Demonstrates how to maximize Claude Max for documentation-heavy projects.

documentationmulti-agentparallelClaude-Maxworkflow
by @michal_jares Mar 10, 2026 6/10
workflow Reddit

Markdown-Only Agent Memory System for Claude Code

A minimal agent memory system built on markdown files — no database or embeddings required. Uses four categories (Profile, Procedures, Directives, Episodes) managed by a memory-manager skill, plus a SessionEnd shell hook to auto-record sessions. Total footprint is 5 markdown files and one optional plugin.

memoryskillworkflowmarkdownhooksession-end
by Repulsive_Act2674 Mar 10, 2026 7/10
workflow Reddit

Letting Claude Code Agents Pay for API Services via x402

Discussion on enabling Claude Code agents to autonomously pay for API calls using x402 (HTTP 402 protocol from Coinbase), eliminating per-service API key management. Covers three implementation approaches: SKILL.md descriptors, MCP payment servers, and direct SDK integration. Community shares working setups.

paymentsx402workflowskillmcpautonomous
by the_searchh Mar 10, 2026 5/10
workflow GitHub

instar: Persistent Autonomy Infrastructure for AI Agents

Gives Claude Code agents a persistent 'body' with scheduled jobs, session management, and Telegram integration. Enables agents to run autonomously on a schedule and report back via messaging.

workflowautonomyschedulingtelegrampersistence
by SageMindAI Mar 10, 2026 7/10
workflow Reddit

gm-cc: Deterministic State Machine Plugin Stops Hallucination Tax

A Claude Code plugin enforcing Just-In-Time (JIT) execution — establishing ground truth with real tool calls before reasoning, rather than guessing. Addresses the multiplicative token cost of hallucination feedback loops. One 10-token ls command establishing reality beats 500 tokens of assumptions.

workflowpluginhallucinationground-truthjitdeterministic
by moonshinemclanmower Mar 10, 2026 7/10
workflow Reddit

AGENTS-COLLECTION: 129 Claude Code Agents in ~/.claude/agents/ Format

A curated collection of 129 Claude Code agents ready to drop into ~/.claude/agents/. Includes the agency-agents system (68 personality-driven agents), everything-claude-code collection, and multi-agent team workflows. Also has conversions for Cursor, OpenCode, AntiGravity, and GitHub Copilot.

workflowagentscollectionsubagentsmulti-agent
by Full-Passion4939 Mar 10, 2026 7/10
workflow Reddit

acp-loop: Schedule Recurring Prompts for Claude Code and Other AI Agents

A standalone loop scheduler that works with any ACP-compatible agent. Supports interval scheduling (every 5m) and cron syntax (0 9 * * *). Use cases include monitoring deploys, watching for new PRs/issues, and generating daily summaries. Works with Claude Code, Codex CLI, Gemini CLI.

workflowschedulingcronautomationloop
by femtowin Mar 10, 2026 7/10
workflow GitHub

wt-tools: Autonomous Multi-Change Orchestration With Parallel Worktrees

An autonomous orchestration system that takes a spec and delivers merged features. Features a Sentinel supervisor, parallel git worktrees for concurrent work, developer memory across sessions, and automatic merge handling.

workflowworktreesparallelautonomousorchestration
by tatargabor Mar 10, 2026 7/10
workflow GitHub

rpikit: Research-Plan-Implement Framework Plugin for Claude Code

A Claude Code plugin implementing the Research-Plan-Implement (RPI) framework for disciplined software engineering. Enforces a three-phase approach: research before planning, plan before implementing.

workflowpluginmethodologyrpiplanning
by bostonaholic Mar 10, 2026 7/10
workflow Reddit

AgentOS: Orchestrate Claude Code Agent Teams With YAML and Approval Gates

A framework for defining teams of Claude Code agents in YAML with scoped tools, budget limits, and human approval gates connected via a DAG. Spawns real Claude Code processes, enforces token/cost/time budgets, and produces full event logs for compliance reporting. Tested with up to 14 parallel agents.

workflowmulti-agentyamlorchestrationapproval-gatesdag
by POWERFUL-SHAO Mar 10, 2026 8/10
workflow GitHub

cworkers: Task Broker for Claude Code With Pre-Spawned Workers

A task broker for Claude Code agent sessions that pre-spawns workers for instant task assignment. Supports model routing and conversation context injection to direct tasks to the right agent with the right context.

workflowtask-managementworkersmodel-routingorchestration
by marcelocantos Mar 10, 2026 7/10
workflow GitHub

blueprint: Turn One-Line Objectives Into Cold-Executable Agent Plans

Converts a single-line objective into a step-by-step plan where each step carries its own context — no prior session needed for any coding agent to execute it cold. Solves the planning gap for autonomous agent runs.

workflowplanningautonomouscontextagents
by antbotlab Mar 10, 2026 7/10
workflow Reddit

Focused Input Cuts Output Tokens 63% — Benchmark Findings

Controlled benchmark (42 runs, Claude Sonnet 4.6, FastAPI codebase) showing that pre-filtering context from 40K to 8K relevant tokens reduced output tokens by 63% — not just input. When given noisy context, Claude generates orientation narration; clean context produces direct answers. Practical implication: context quality affects verbosity, not just cost.

workflowcontext-engineeringtoken-efficiencybenchmarkperformance
by Objective_Law2034 Mar 10, 2026 8/10
workflow GitHub

prodboard: Self-Hosted CLI-First Issue Tracker for Claude Code Agents

A self-hosted issue tracker and cron scheduler specifically designed for Claude Code agents. CLI-first interface means agents can create, update, and close issues directly without browser automation.

workflowissue-trackingself-hostedclicron
by G4brym Mar 10, 2026 7/10
workflow GitHub

maxsimcli: Spec-Driven Dev With Parallel Subagents and Live Dashboard

A spec-driven development system solving context rot in AI coding. Works with Claude Code, OpenCode, Gemini CLI, and Codex. Features parallel subagents, atomic commits, and a live dashboard showing progress across concurrent tasks.

workflowspec-drivenparallelsubagentscontext-rot
by maystudios Mar 10, 2026 7/10
workflow Reddit

Manual-Driven Development: 190 Findings, 7 Hours, Zero Rule Violations

A methodology for preventing confident divergence in agentic codebases. MDD addresses Claude running out of context budget to honor CLAUDE.md rules. Results across 7 production codebase sections: 190 findings, 876 tests written, 30-46x time compression vs human developers, and 60% fewer rule violations vs baseline sessions.

workflowmethodologyrule-enforcementcontextproduction
by TheDecipherist Mar 10, 2026 8/10
workflow GitHub

claude-lead-system: Multi-Agent Orchestration 57% Cheaper Than Agent Teams

Multi-agent orchestration for Claude Code that is 57% cheaper than Claude's native Agent Teams with 13 additional features. Coordinates agents with zero API tokens for orchestration — using file-based coordination instead of API calls.

workflowmulti-agentorchestrationcostautomation
by DrewDawson2027 Mar 10, 2026 7/10
workflow GitHub

agent-orchestrator: Parallel Coding Agents With CI Fix and Code Review

An agentic orchestrator that plans tasks, spawns parallel coding agents, and autonomously handles CI failures, merge conflicts, and code reviews. Reduces the need for human intervention in typical development feedback loops.

workflowmulti-agentcicdcode-reviewautomation
by ComposioHQ Mar 10, 2026 7/10
workflow Reddit

maistro: Decompose Goals Into Sequential Tasks for Long Autonomous Runs

A CLI and native Claude Code skill that decomposes goals into sequential tasks, executes them one at a time via Claude Code subprocess, validates results, and auto-commits. Evolved from a separate CLI tool into a native skill using Claude's built-in subagents. Includes Architect, Developer, and QA sub-agents.

workfloworchestrationsubagentsautonomoustask-management
by dreamteammobile Mar 10, 2026 7/10
workflow Reddit

Automate a Daily AI Podcast With 3 Agents and Voice Cloning

A fully automated podcast pipeline using three sequential Claude Code agents: Collector (pulls from tiered sources), Editor (writes narration with recursive summarization), and Proofreader (fact-checks against sources). Outputs audio via TTS with cloned voice. Key insight: curation rules matter more than model selection.

workflowmulti-agentpodcastvoice-cloningautomationmedia
by Serious_Bottle_1471 Mar 10, 2026 7/10
workflow Reddit

The 8 Levels of Agentic Engineering

A progressive framework for growing expertise with Claude Code: tab complete → chat/agent IDE → context engineering → compounding engineering → MCP and skills → harness engineering → background agents → autonomous agent teams. Useful mental model for planning your own skill progression.

workflowmethodologylearningprogressionagentic
by Maleficent-Animal-57 Mar 10, 2026 7/10
workflow Reddit

mengram: Auto-Memory Layer for Claude Code With Hooks

An automatic memory layer that installs as Claude Code hooks. On session start it loads your cognitive profile; on each prompt it injects relevant past context; after responses it saves new knowledge. Stores semantic facts, episodic events, and procedural workflows that evolve when something fails.

workflowmemoryhookspersistencecontext
by No_Advertising2536 Mar 10, 2026 8/10
workflow GitHub

crew: Domain Experts for Claude Code With Persistent Context

Provides domain expert agents for Claude Code with persistent context, history, and institutional memory per domain. Your AI team retains what it learned about each domain across sessions.

workflowagentscontextmemorydomain-experts
by eran-tookii Mar 10, 2026 7/10
workflow Reddit

Rukuzu: Porting 200K Line C++ to Rust With a Claude Code Custom Command

A workflow and Claude Code custom command for systematically porting large C++ codebases to Rust. Developed while porting the kuzu graph database (200K lines, 15 crates, 2700+ tests). The command encodes lessons about what translates mechanically vs what requires human judgment.

workflowcommandrustcppportingtesting
by jabbrwoke Mar 10, 2026 8/10
workflow GitHub

aitasks: File-Based Task Management for AI Coding Agents

A markdown task management framework with YAML frontmatter for AI coding agents. Git-native, zero infrastructure, works with Claude Code, Gemini CLI, OpenCode, and Codex CLI. Each task file carries its own context.

workflowtask-managementmarkdowngitmulti-agent
by beyondeye Mar 10, 2026 7/10
workflow Reddit

JIRA MCP + Playwright for QA-Gated Claude Code Development

A workflow combining JIRA MCP for task management with Playwright MCP and Windows MCP for QA validation. Tasks can only be marked Done after Claude completes QA from an actual user perspective. Addresses the vibe coding QA problem and context loss across sessions.

workflowjiramcpqatestingplaywright
by writingdeveloper Mar 10, 2026 7/10
workflow Reddit

Using Markdown SKILL.md Files as a Workflow Engine in Kubernetes

Running Claude Code as a Kubernetes CronJob with SKILL.md files as the workflow definition layer — plain English markdown that non-technical team members can write. Steps are defined as English instructions; Claude coordinates them by writing artifacts to disk. Running in production for over a month.

workflowkubernetesskillorchestrationcronjobautomation
by kotrfa Mar 10, 2026 8/10
workflow GitHub

Oh My Claude Code — Teams-First Multi-Agent Orchestration for Claude Code

A multi-agent orchestration framework for Claude Code built with teams in mind. Provides shared context, role assignments, and coordination primitives so groups of agents and human collaborators can work on the same codebase without stepping on each other.

multi-agentteamsorchestrationcollaborationcoordination
Mar 10, 2026 8/10
workflow Reddit

Claude Octopus v8.48 — Parallel Claude + Codex + Gemini with 75% Consensus Gate

A plugin that runs Claude, Codex, and Gemini in parallel with distinct roles across four phases (discover, define, develop, deliver), requiring 75% consensus before proceeding. Each model covers the others' blind spots: Claude synthesizes, Codex nails implementation, Gemini catches ecosystem risks.

multi-modelconsensusorchestrationcodexgeminiparallel
Mar 10, 2026 8/10
workflow GitHub

Plan-an-Go — IDEA→PRD→PLANS→REVIEW Pipeline for Any AI CLI

A CLI wrapper that drives a structured idea-to-execution pipeline: generate a PRD, break it into plans, review, then execute — all from a single command. Works with Claude Code and other AI CLIs.

planningprdpipelineworkflowcli
Mar 10, 2026 6/10
workflow GitHub

Hive — Outcome-Driven Agent Development Framework That Evolves

An agent development framework focused on outcomes rather than predefined steps, allowing the framework itself to adapt as agents work. Suited for exploratory or open-ended tasks where rigid pipelines fall short.

agentsframeworkadaptiveoutcomesorchestration
Mar 10, 2026 5/10
workflow GitHub

Cursor + Claude Code Developer Toolkit — AI-Powered Productivity Booster

A development toolkit combining Cursor and Claude Code to boost productivity, surface code insights, accelerate debugging, and handle large codebases. Designed for developers who use both tools and want them working together.

cursortoolkitproductivitydebuggingworkflow
Mar 10, 2026 6/10
workflow Reddit

Multi-Agent Brainstorm–Debate–Implement Loop for Claude Code and Antigravity

Describes a structured 5-10 agent workflow combining sequential thinking MCP with a Socratic meta-loop: brainstorm → debate → implement → test → iterate. Includes a self-bootstrapping technique where the workflow builds itself.

workflowmulti-agentantigravitysocraticsequential-thinking
Mar 10, 2026 5/10
workflow Reddit

Maintaining Reliable Remote Access to Long-Running Claude Code Sessions

A detailed discussion of setups for keeping Claude Code sessions accessible remotely — covering tmux/WSL/SSH/Tailscale combos, Discord bots, and /remote-control issues. Highlights a persistent-identity system with Obsidian vault, soul loops, and session recovery kits. Useful reference for anyone building always-on Claude Code environments.

remote-accesstmuxtailscalesession-recoverypersistent-context
by /u/Wheels859 Mar 10, 2026 6/10
workflow GitHub

SwarmWeaver: Swarm Orchestration with Parallel Worktrees and 6 Coding Modes

An autonomous coding agent system that runs multiple agents in parallel git worktrees simultaneously. Offers six purpose-built modes — greenfield, feature, refactor, fix, evolve, and security — plus CLI and Web UI with approval gates for human-in-the-loop control. A comprehensive swarm orchestration platform for large codebases.

swarmorchestrationparallelworktreesmulti-agentapproval-gatesclaude-code
by HeshamFS Mar 10, 2026 8/10
workflow GitHub

vm0: Run Natural Language-Described Workflows Automatically

vm0 runs workflows described in natural language automatically, bridging plain-English workflow descriptions and automated execution. Complements AI coding agents by making it easy to define and trigger multi-step processes without code.

natural-languageworkflow-automationno-codeorchestration
by vm0-ai Mar 10, 2026 5/10
workflow GitHub

Fitbit Dashboard Built Entirely with AI Tools — Zero Manual Code

A project that displays and queries downloaded Fitbit data, with the explicit goal of writing zero lines of code by hand. Documents the workflow as a case study in fully AI-driven development. Useful reference for those exploring how far vibe-coding can go on a complete personal project.

vibe-codingno-codefitbitcase-studyai-driven
by RikEnde Mar 10, 2026 5/10
workflow Reddit

Pre-Warm Claude Code Rate Limits with a Cron Job

Claude Code's 5-hour limit is a sliding window — start it before you plan to work so it resets when you need it most. A companion repo (tappress/claude-code-warmup) provides a one-click Vercel deploy to automate the pre-warming with a cron job. Simple but effective workaround for interruptions during peak work hours.

rate-limitscronworkflowproductivityworkaround
by SpareFan1797 Mar 10, 2026 6/10
workflow GitHub

Prompt-Factory: Multi-agent system that analyzes and optimizes prompt sets

Multi-agent system for generating high-quality AI prompts. Different agents analyze requirements, create prompts, review them, and optimize the final output. Useful for systematically improving prompts used in Claude Code workflows.

promptsmulti-agentoptimizationworkflowprompt-engineering
by haneef1104 Mar 9, 2026 6/10
workflow GitHub

Automate academic LaTeX, R, and Quarto workflows with Claude Code

Workflow setup for using Claude Code to automate academic tasks including LaTeX document preparation, R scripts, and Quarto slide creation. Practical configuration for researchers and academics wanting AI-assisted academic writing pipelines.

workflowlatexrquartoacademicautomation
by moemoe1230 Mar 9, 2026 6/10
workflow Reddit

cc-taskrunner: Queue Claude Code tasks and wake up to PRs

Open-source Bash task runner that queues Claude Code sessions for unattended execution. Each task gets its own headless session, git branch, and automatic PR. Three-layer safety model: PreToolUse hooks blocking destructive ops, CLI constraints, and explicit mission briefs baked into every prompt.

automationworkflowsafetyhooksbashtask-queue
by texo_optimo Mar 9, 2026 9/10
workflow GitHub

pilot: Autonomous dev pipeline that ships tickets with Claude Code

AI-driven development pipeline that takes tickets and autonomously implements them using Claude Code. Bridges project management and code execution, shipping completed work directly from ticket to commit.

automationticketspipelineautonomousworkflow
by alekspetrov Mar 9, 2026 7/10
workflow GitHub

coding-swarm: Parallel AI agents in isolated containers with git integration

Runs parallel AI agents in isolated containers to coordinate code tasks across any project. Supports multiple AI providers and integrates with git for branch-per-agent isolation. Inspired by the swarm pattern for decomposing complex tasks.

swarmparallelcontainersgitmulti-agentisolation
by MihailBausov Mar 9, 2026 7/10
workflow X

Claude 4.6 Definitive Guide: prompts, Claude Code workflows, and automation systems

A comprehensive practical guide compiled after weeks of testing Claude prompts, Claude Code workflows, and automation systems. Covers best prompts for real work, Claude Code-specific patterns, and productivity automation. Aimed at users who want to get more out of their Claude subscription.

guidepromptsworkflowautomation
by @Suryanshti777 Mar 9, 2026 6/10
workflow X

Using ACP to spawn Claude Code CLI sessions from another AI assistant

An experiment in using ACP (Agent Communication Protocol) to spawn Claude Code CLI sessions on demand from within a separate software engineer assistant. When the outer agent needs Opus-level reasoning without storing OAuth tokens, it delegates to a fresh Claude Code process and waits for results. Interesting pattern for multi-agent orchestration.

acpmulti-agentorchestrationworkflow
by @joncursi Mar 9, 2026 7/10
workflow X

How to layer Claude Code features like a pro: CLAUDE.md, Skills, MCP, Subagents, and Hooks

A concise mental model for choosing the right Claude Code feature for each job: CLAUDE.md for persistent conventions, Skills for reusable multi-step docs, MCP for live data access, Subagents for parallel research, and Hooks for automatic side effects. Clears up a common confusion about when to use each tool.

claude-mdskillsmcpsubagenthookmental-model
by @bhaidar Mar 9, 2026 8/10
workflow X

Design-to-code workflow: Figma designs → Claude Code via Figma MCP → Tailwind + Shadcn

A clean four-step workflow: design a screen in Figma, connect Claude Code to Figma via MCP, prompt it to build with Tailwind and Shadcn, then auto-generate design system docs. Eliminates the handoff gap between design and implementation. 700+ likes confirms this resonates widely.

figmamcptailwindshadcndesign-to-code
by @designertom Mar 9, 2026 7/10
workflow X

Coding in GOD MODE: a complete Claude Code setup with CLAUDE.md, Figma MCP, and sound hooks

A walkthrough of a maxed-out Claude Code setup: a tailored CLAUDE.md that encodes personal workflow preferences, Figma MCP for direct UI implementation from designs, and a hook that plays a sound notification when tasks complete. Shows how layering these features together creates a substantially different experience than using Claude Code out of the box.

claude-mdfigmamcphooksetup
by @didier_lopes Mar 9, 2026 7/10
workflow Reddit

Teaching Claude Code your team's coding patterns so it writes "our" code, not just correct code

A practical approach to showing Claude Code what correct code means in your specific codebase — not just code that compiles, but code that matches your team's patterns, conventions, and architecture. After a year of AI-assisted PRs still feeling wrong, the author built a system that teaches Claude your style. Solves one of the most common complaints about AI code review.

codebase-contextcode-reviewpatternsworkflow
by SensioSolar Mar 9, 2026 7/10
workflow Reddit

Google Workspace CLI: Let AI agents operate Gmail, Drive, and Calendar

Google released a Workspace CLI that gives AI coding agents structured access to Gmail, Drive, and Calendar. Integrates with Claude Code for automating administrative and communication workflows. Useful for developers managing radio promotion, email campaigns, or document pipelines alongside code.

google-workspacegmailautomationworkflow
by totalaudiopromo Mar 9, 2026 5/10
workflow Reddit

Inside a 116-configuration Claude Code setup: Skills, Hooks, Agents, and layering strategy

A detailed write-up of running a 116-configuration Claude Code setup for a one-person business. Covers how skills, hooks, agents, and sub-agents are layered to create a system that handles web apps, content pipelines, and business operations. One of the most comprehensive real-world Claude Code setups documented publicly.

configurationworkflowagentshooksskillsreal-world
by jonathanmalkin Mar 9, 2026 9/10
workflow GitHub

claude-sage: Strategic analysis workflows for eliminating technical debt with Claude Code

A set of Claude Code workflows focused on codebase analysis, strategic planning, and technical debt reduction. Provides structured approaches for making architectural decisions with AI assistance. Aimed at teams looking to use Claude Code for long-term codebase health rather than just feature development.

workflowtechnical-debtanalysisplanning
by user123-alt Mar 9, 2026 5/10
workflow Reddit

Remote Control "not enabled" on macOS is a platform gate — Docker workaround

Claude Code Remote Control is gated by a Statsig feature flag (tengu_ccr_bridge) that returns false for macOS (darwin) and true for Linux. The misleading error says "not yet enabled for your account" but your account is fine. A Docker workaround exists: run Claude Code in a Linux container to bypass the platform gate.

remote-controlmacOSDockerdebuggingworkaround
by jonathanmalkin Mar 9, 2026 7/10
workflow GitHub

Claude collective intelligence: agent swarm framework with message queues

A framework for accelerating AI collaboration using Claude agent swarms with message queues for brainstorming, voting, and mentorship workflows. Enables multi-agent orchestration where multiple Claude instances collaborate on complex tasks through structured communication channels.

multi-agentswarmorchestrationmessage-queue
by othmane55 Mar 9, 2026 6/10
workflow X

Warning: each stacked Claude Code session spawns its own copy of all global MCP servers

Each Claude Code session spawns a separate instance of every globally configured MCP server. With multiple stacked sessions open, this can create 30+ zombie MCP server processes (e.g., Gmail MCP) consuming significant memory. Close unused Claude Code sessions to avoid process buildup.

MCPperformancememoryzombie-processesdebugging
by @phuakuanyu Mar 9, 2026 7/10
workflow X

Multi-model workflow: have Claude write specs, then ask Gemini via MCP to review them

A practical multi-model workflow using Claude Code: (1) prompt Claude to write technical specs, (2) use an MCP Gemini integration for Claude to automatically ask Gemini to cross-review those specs. Leverages different model strengths for iterative spec refinement.

workflowmulti-modelGeminiMCPspecs
by @damovsky Mar 9, 2026 6/10
workflow GitHub

agent_crew_api: Orchestration Backend for Multi-Agent AI Teams

A backend API for orchestrating multi-agent AI teams across software development tasks. Provides coordination primitives for assigning and managing work across agents working in parallel.

multi-agentorchestrationapibackend
by helmcode Mar 9, 2026 5/10
workflow GitHub

KnowzCode: TDD Workflows and Quality Gates for AI Coding Assistants

A structured development methodology with TDD workflows, quality gates, specs, and tracking that works across Claude Code, Gemini, Cursor, Copilot, and Codex. Provides discipline and structure to AI-assisted coding sessions so output is consistent and verifiable.

tddquality-gatesworkflowmethodologymulti-model
by knowz-io Mar 9, 2026 7/10
workflow Reddit

Multi-Swarm Plugin: Parallel Agent Teams with Git Worktrees

A Claude Code plugin that spawns parallel agent teams working in separate git worktrees, allowing independent tasks like API endpoints, UI components, and database migrations to be built simultaneously. Type /multi-swarm with a description and the plugin decomposes and parallelizes the work automatically.

worktreesparallelmulti-agentpluginproductivity
by dorongal1 Mar 9, 2026 8/10
workflow GitHub

z-spec: AI-Powered Z Specification Generation and Validation

A tool that creates, validates, and animates formal Z specifications from source code, and generates code from specifications. Useful for teams that want formal methods verification in their Claude Code workflow.

formal-methodsspecificationsvalidationworkflow
by punt-labs Mar 9, 2026 5/10
workflow GitHub

claude-plugins: Context Management and Guarded Workflows from 451 Sessions

A set of Claude Code plugins distilled from 451 real coding sessions, focusing on context management, investigation discipline, and guarded workflows that prevent runaway changes. Battle-tested patterns for keeping long Claude sessions on track.

contextworkflowdisciplinepluginsbattle-tested
by cukas Mar 9, 2026 8/10
workflow GitHub

The Council: Multi-Model Advisory Board for Claude Code

A Claude Code tool that routes questions to Codex and Gemini for second opinions, creating a multi-model advisory board for design and implementation decisions. Useful when you want to pressure-test an approach before committing to it.

multi-modeladvisorycodexgeminidecision-making
by DantesPeak85 Mar 9, 2026 7/10
workflow Reddit

Autonomous software team

Currently, PMs in my company are using Claude Code with MCP connectors for generating ideas and writing PRDs, engineers use it for discussions and generating technical plans, once everything is app...

mcpworkflowautomationtestingreview
by geeky_traveller Mar 9, 2026 8/10
workflow Reddit

Agentic Harness Bootstrap for Existing Repos

A bootstrap tool that scans your existing repo and auto-generates a tailored agent harness: CLAUDE.md, ARCHITECTURE.md, lint configs with remediation-rich errors, pre-commit hooks, and CI pipeline. Inspired by OpenAI Codex team insights, it favors short navigational maps over giant instruction files. Idempotent and works with Claude Code, Codex, or Copilot.

CLAUDE.mdAGENTS.mdharnessworkflowbootstraplinterCI
by Ven_is Mar 9, 2026 8/10
workflow GitHub

SEC Filing to Video Pipeline with Claude + MCP

An end-to-end pipeline that uses Claude with the RoboSystems MCP to research and analyze SEC filings, then produces video content via HeyGen, ElevenLabs, and Shotstack. Demonstrates Claude orchestrating multi-tool, multi-vendor workflows for domain-specific content automation.

MCPpipelineworkflowfinancecontent-generation
by RoboFinSystems Mar 9, 2026 5/10
workflow GitHub

File-Based Cross-Machine Communication for AI Coding Agents

A lightweight, agent-agnostic communication protocol letting AI coding agents exchange messages across machines via file-based messaging bridged over SSH. Requires no dependencies beyond Bash, making it highly portable and easy to integrate with Claude Code or other agent frameworks for distributed workflows.

multi-agentSSHcross-machinecommunicationBashdistributed
by alexthec0d3r Mar 9, 2026 6/10