skill GitHub

notemd-skills: Agent Skills for the notemd Markdown dialect

A set of Agent Skills that teach Claude and other agents exactly which Markdown note.md renders and how its knowledge graph is derived. Useful if you keep notes in notemd and want an agent to write files it will actually display and link correctly.

skillsmarkdownnotesknowledge-graph
by a-aigner Sep 15, 2026 6/10
skill GitHub

remit: Agentic skills framework for AI governance

Encodes autonomy tiers and blast radius into skills so an agent knows how far it is allowed to go before a human signs off. Ships a diagnostic manual for agent failure modes and maps its controls onto the EU AI Act, NIST AI RMF, ISO 42001, and DORA.

skillsgovernancecompliancesafetyeu-ai-act
by patkusch Sep 15, 2026 7/10
skill GitHub

skills-emerge: Merge Duplicate Agent Skills, Keep the Complementary Ones

A documented process for deduplicating a large agent skill library: merge skills that overlap, keep the ones that genuinely complement each other. Written up from real cleanup work, so it covers the judgment calls rather than just a script. Documentation is in Chinese.

skillsdeduplicationskill-librarymaintenance
by RichardoZhao Sep 15, 2026 6/10
skill GitHub

godmode-lite: Free Four-Layer Skill — Context, Execute, Test, Polish

A free, stripped-down execution-protocol skill for Claude Code that forces work through four layers: gather context, execute, test, then polish. Aimed at stopping the agent from jumping straight to code and declaring victory before anything is verified.

skillprotocolworkflowtesting
by Getgodmode Sep 15, 2026 5/10
skill GitHub

bash-best-practices-skill: One Shape for Shell Utilities, Help as Truth

A standard for writing shell utilities that agents and humans can both predict: every script takes the same shape, the --help output is the authoritative spec, and the target is the bash version macOS actually ships rather than a modern GNU bash. Useful if your agent keeps generating scripts that only run on Linux.

bashshellconventionsmacosskill
by rokokol Sep 15, 2026 6/10
skill GitHub

dekh-bhai: Hinglish Skill That Explains Code Like an Exam-Night Friend

A skill that explains complex code and concepts in Hinglish, in the voice of the friend who crammed the whole syllabus with you the night before an exam. A novelty persona with a real use: the informal register drops the hedging and gets to the point faster than a textbook explanation.

explainhinglishteachingskillpersona
by dewanshparashar Sep 15, 2026 5/10
skill Reddit

Codacy Skills: Run Static Analysis Locally Before the First Commit

Two Codacy skills that move static analysis and SCA earlier than the PR: one teaches the agent to set up and run Codacy analysis locally, the other teaches it to fold that analysis into any code review. Free and no authentication needed, so the agent can fix findings before a commit exists.

static-analysiscode-reviewscacodacyskill
by CodacyOfficial Sep 15, 2026 7/10
skill GitHub

github-agent-skills: GitHub Workflow Skills That Demand Inspected Evidence

GitHub workflow skills for Claude Code and Codex built around one constraint: the agent has to actually inspect and cite evidence rather than assert that a check passed or a diff is clean. Aimed squarely at the failure mode where an agent reports on a PR it never really read.

githubskillsevidencecodexpull-requests
by ryanduguid Sep 15, 2026 6/10
skill Reddit

10 Agent Skills for Coding Agents That Build LLM Applications

Ten plain SKILL.md skills targeting the mistakes coding agents keep making when they write LLM applications: building an agent where a workflow suffices, exposing every API endpoint as its own tool, hand-parsing JSON when structured outputs exist, reaching for multi-agent architectures, stuffing chunks into context without document-level retrieval, and swapping models or RAG pipelines without measuring. Covers architecture, tool calling and design, structured output, prompting, context and memory, RAG, subagents, model selection, and evals, with references loaded on demand.

skillsllm-appsragevalsarchitecture
by Quirky-Location7712 Sep 15, 2026 7/10
skill GitHub

skillguard: Static Checks, Sandbox Tests and Quality Scores for Skills

A QA and testing framework for Agent Skills: static validation, sandboxed test runs, a quality score, and CI integration. Treats skills as code that can regress rather than prose you paste and hope about. Documentation is in Chinese.

skillstestingvalidationciquality
by la2278647-arch Sep 15, 2026 7/10
skill GitHub

remote-workspace: Skill for Working on a Remote Host Over SSH

A Claude Code skill for driving a remote machine over SSH: connecting, probing the environment, editing files, and managing long-running jobs. Gives the agent a consistent procedure for remote work instead of ad-hoc ssh invocations. Useful for anyone whose real work happens on a server rather than the laptop.

sshremotedevopsskill
by c0ffee-milk Sep 15, 2026 7/10
skill GitHub

skill-presentation-build: Structure the Talk Before the Slides

A Claude Code skill that builds a talk's skeleton first — a three-question brief, a section map with written transitions and a time budget, then a full speaker script — before generating the deck in Gamma, .pptx, an HTML artifact, or Canva. Inverts the usual slide-first workflow. Bilingual English/Vietnamese.

presentationslideswritingskill
by vicky-tiq Sep 15, 2026 6/10
skill GitHub

avoid-over-ai-writing-skill: Strip AI Tells From Generated Drafts

An agent skill that reduces the recognizable patterns of AI-generated prose and turns drafts into clear, deliverable Markdown or DOCX documents. Targets the em-dash-and-tricolon register that makes generated writing obvious. Written for Codex but the guidance transfers to Claude Code.

writingeditingdocxskill
by Wattson-Law Sep 15, 2026 6/10
skill GitHub

testcase: QA Skills That End in a Mandatory Subagent Review Pass

A collection of Claude Code skills for QA work where each skill terminates in a required independent-subagent review. The reviewing agent has no stake in the original work, which catches the self-approval failure mode where an agent declares its own output correct. Good pattern to lift even if you do not need the QA skills themselves.

qatestingsubagentsreview
by xtieume Sep 15, 2026 6/10
skill GitHub

sanctifai/skills: Human-in-the-Loop Tasks for AI Agents via MCP

A skill that lets an agent create tasks for humans to review, approve, or complete, exposed over both a REST API and MCP. Gives the agent a first-class way to block on human judgment rather than guessing or asking in chat. Useful for pipelines that must not fully auto-approve.

human-in-the-loopmcpapprovalrest-api
by sanctifai Sep 15, 2026 7/10
skill GitHub

godot-guard: Godot 4 Guardrails for Claude Code, No MCP Needed

Pure-Python guardrails for Godot 4 work: a linter that catches Godot-3-isms the model hallucinates, a scene map giving real node paths, and a version pin. Verified against Godot 4.7.2. Avoids the whole MCP layer, which makes it easy to drop into an existing project.

godotgamedevlintingguardrails
by brocolriri Sep 15, 2026 7/10
skill GitHub

falsifiable-tests: Prove a Test Can Fail Before You Trust It

A Claude Code skill that verifies tests are actually load-bearing: it breaks the subject under test, confirms the test goes red for the right reason, then restores the code. Catches the common agent failure of writing a test that passes no matter what. Small, sharp, and applicable to any test suite.

testingtddverificationskill
by ArnauFerma Sep 15, 2026 8/10
skill GitHub

drama-skills: Open-Source Short-Drama Production Skills

A skill collection for AI short drama and micro-drama creation covering script, character assets, storyboard, image and video prompts, and a review pass. Works with both Claude Code and Codex, MIT licensed. Chinese and English documentation.

videocreativestoryboardskills
by zenstory-ai Sep 15, 2026 5/10
skill GitHub

ai-search-audit: Audit How AI Engines Describe and Cite Your Brand

An open-source GEO/AEO skill that audits how ChatGPT, Perplexity, Gemini, Google AI Overviews, DeepSeek, Doubao, Qwen, and Kimi describe and cite your brand, then writes the fixes. Notably it refuses to fabricate platform answers — you run the prompts, it does the analysis. Honest design for a category full of hallucinated reports.

seogeoaeoauditmarketing
by xwmtzcp Sep 15, 2026 6/10
skill GitHub

clipsy: Long Zoom Recordings In, Captioned LinkedIn Clips Out

A Claude Code skill that turns long Zoom recordings into frame-accurate, captioned clips for LinkedIn. Claude makes the editorial cuts, ffmpeg does the rendering, and a built-in QC pass checks the result. Concrete example of pairing model judgment with a deterministic renderer.

videoffmpegcontentskill
by rajesh-ezio Sep 15, 2026 6/10
skill GitHub

slop-mop: A Writing Skill for Plain, Factual, Unboastful Prose

A writing skill for coding agents that enforces plain factual output with no AI slop and no self-congratulation. Targets the register problem where agents narrate their own work as a triumph. Useful for PR descriptions, commit messages, and docs.

writingdocumentationstyleskill
by pliablepixels Sep 15, 2026 7/10
skill GitHub

pm-skill-pack: Product Manager Skills for Docs, PRDs, and Prototypes

A Claude Code skill pack for product managers covering product documentation, PRD writing, and high-fidelity prototype reproduction. Packages the recurring PM deliverables as skills rather than prompt templates. Chinese-language documentation.

product-managementprddocumentationskills
by skyhahalife-11 Sep 15, 2026 5/10
skill GitHub

313-history-grader: Automated Grading for History Essay Exams

A skill that grades Chinese 313 history exam essays: it independently generates a reference answer and scoring points, OCRs the student's answer, scores point by point, then outputs a Word feedback report. Generating the rubric before reading the answer is the right ordering to avoid anchoring. Narrow domain but a clean pipeline.

gradingeducationocrskill
by 2548-create Sep 15, 2026 5/10
skill Reddit

A Skill File for the Gap Between 'Works Locally' and Production

Vibe coding gets you 90% there; the missing 10% is what takes the app down. This open-source skill file scans and hardens the recurring flaws in AI-generated repos: leaked keys, missing CORS config, client-side tokens, unhandled API rate limits, missing env var validation, unmemoized hooks causing infinite re-renders, and unsanitized input.

securityhardeningproductionskill
by Quiet_Effect_4102 Sep 15, 2026 6/10
skill GitHub

Riffkit Skill: Riff the Formula of a Winning TikTok, Not the Video

The official Riffkit skill for turning a successful short-form video into your own, callable from Claude Code, Cursor, or the browser. It extracts the structural formula rather than copying the clip. Useful reference for creative skills that work from examples.

videotiktokcontentskill
by riffkit Sep 15, 2026 5/10
skill GitHub

anti-aranjiya-skill: Strip English Calques From Arabic Writing

An agent skill for authentic Arabic writing that removes English calques and translated phraseology (العرنجية) from Arabic text, based on Ahmad Al-Ghamdi's treatise on the subject. Works with Claude Code, Codex, Antigravity, and VS Code. A good example of a language-specific style skill grounded in a real source.

arabicwritinglocalizationskill
by specailm5 Sep 15, 2026 6/10
skill GitHub

neo-agent-skills: The Workflow Substrate a Cross-Model Team Runs On

The skills Neo.mjs maintainers load every session, packaged and versioned: ticket intake, PR review gates, lane coordination, and guards. Materialized into your repo rather than copied, so they stay updatable. Useful as a reference for what a real multi-model team's coordination layer contains.

skillsworkflowpr-reviewcoordination
by neomjs Sep 15, 2026 6/10
skill GitHub

ballast: Agent Skills That Encode When NOT to Do Something

Most skills tell an agent how to do things; these encode when to refrain. Works with Claude Code, Codex, Cursor, Gemini CLI, and 40 others, with zero executable surface — nothing to run, so nothing to audit for supply-chain risk. A useful complement to a library of capability skills.

skillsguardrailssafetycross-agent
by Jawahars07 Sep 15, 2026 7/10
skill GitHub

prancheta: Generate Mid-Fi Wireframes as HTML, Export to PNG

A Claude Code skill that produces mid-fidelity wireframes in HTML and exports desktop and mobile PNGs using Bun and Puppeteer. HTML as the wireframe source means the output stays editable and diffable. Portuguese-language README.

wireframedesignpuppeteerskill
by Thumendes Sep 15, 2026 6/10
skill GitHub

wait-skill: Wait on External Jobs Without Burning Tokens Polling

A small agent skill for waiting on external jobs and services without spending model tokens on repeated polling. Every poll cycle otherwise costs a full turn, which adds up fast on long builds and deploys. Simple idea, directly addresses a real cost sink.

tokenspollingskillefficiency
by wenxueru Sep 15, 2026 7/10
skill GitHub

skill-authoring-skill: How a Good Skill Is Written, Plus the Gate

A skill for writing skills, paired with the gate that checks whether the result is any good. The gate is the part most skill-authoring tools skip, leaving you to judge your own output. Worth a look if you are writing skills regularly.

skillsauthoringquality-gatemeta
by rokokol Sep 15, 2026 7/10
skill GitHub

interactive-diagram-html: Turn Architecture Diagrams Into Single-File HTML

A Claude Code skill that converts architecture diagrams, process flows, and development plans into self-contained interactive HTML files through a guided conversation. You describe the system and the skill walks you through structuring it, then emits one portable file with no build step or external assets. Handy for sharing design docs with people who will not clone your repo.

skilldiagramshtmldocumentation
by XuGuanghaiGoogle Sep 15, 2026 6/10
skill GitHub

arkitect: Editable Draw.io and Excalidraw Diagrams From Your Coding Agent

Lets a coding agent draw cloud architectures, system designs, and data pipelines as real Draw.io and Excalidraw files rather than ASCII art or static images. Because the output is the native editable format, you can open the diagram and keep refining it by hand afterwards. Supports Claude Code, Codex, Cursor, OpenCode, Copilot, Antigravity, and Pi.

diagramsdrawioexcalidrawarchitecture
by mouadja02 Sep 15, 2026 7/10
skill GitHub

claude-skills: Free SKILL.md Collection Mirrored From product.inc/skills

A public mirror of Alex Zapadenko's skill library, published as plain SKILL.md files you can drop straight into a project or global skills directory. Useful mainly as a browsable corpus of how other people structure skill definitions. No install tooling — just copy the files you want.

skillscollectionskill-md
by product-llc Sep 15, 2026 5/10
skill GitHub

korean-writing-qa: Rule-Based Korean Proofreader for AI-Written Business Text

Rewrites AI-generated Korean into prose that passes at work, using 29 decision-rule branches plus a context-reading judgement layer. Notably it does not call a model to perform the fixes, and individual rule branches can be toggled to match an organization's house style. Calibrated against roughly 600 human-written internal reports.

koreanwritingproofreadingskill
by kkhfiles Sep 15, 2026 5/10
skill GitHub

JIRA-Assistant-Skills: Modular Claude Code Skills for JIRA Automation

A set of separate Claude Code skills for JIRA covering issue management, workflow transitions, search, and collaboration. Splitting it per concern rather than shipping one monolithic skill keeps context cost down when you only need issue lookup. Pairs naturally with a ticket-to-PR loop.

jiraskillsautomationissue-tracking
by grandcamel Sep 15, 2026 7/10
skill GitHub

cloud-concept-skills: Huawei Cloud Billing and Provisioning Agent Skills

Community-maintained Agent Skills for Huawei Cloud covering billing, cost estimation, controlled provisioning, and account onboarding. The controlled-provisioning angle matters: it constrains what an agent may spin up rather than handing it an open cloud account. Niche unless you are on Huawei Cloud.

huawei-cloudbillingprovisioningskills
by concept-git Sep 15, 2026 5/10
skill GitHub

inktofilm: Turn a Screenplay Into an AI Film With Every Shot Story-Checked

inktofilm is a skill for Claude Code and Codex that takes a single prompt or a full screenplay and produces a finished AI film. Each generated shot is checked against the story before it is kept, so continuity errors get caught rather than shipped. A rare example of a creative-production pipeline packaged as an agent skill.

skillvideocreativecodex
by yingwang Sep 15, 2026 6/10
skill GitHub

archify-diagram-ps: Interview-Driven Skill for Architecture Diagrams

This Claude skill interviews you about your system — WAF, load balancers, VMs, microservices, ports, integrations — and then renders a complete interactive architecture, sequence, or flow diagram through archify. The interview step is the point: it pulls out details you would forget to mention in a one-line prompt. Good fit for documenting an existing system rather than sketching a new one.

skilldiagramsarchitecturedocumentation
by solankipravin374 Sep 15, 2026 7/10
skill GitHub

fondos-concursables: Claude Skills for Chilean Grant Applications

A set of Claude skills for reviewing applications to Chilean public funding programs — Sercotec, Corfo, FNDR, and Fondart — including backing the proposed budget with real quotes. Narrow by design, but a clean example of encoding a specific bureaucratic review process as skills. Spanish-language.

skillgrantsspanishreview
by icer Sep 15, 2026 5/10
skill GitHub

plain-mode: Skills That Make Claude Code Answer Like a Helpful Human

plain-mode is a small set of skills that reshape Claude Code's output: short answers, no jargon, and one clear next step instead of a wall of options. It targets the failure mode where a simple question returns an essay. Low effort to install, immediate effect on tone.

skilloutput-stylecommunication
by diflowrin Sep 15, 2026 6/10
skill GitHub

claude-code-plugins: Adversarial Review and Workflow Automation Skills

A plugin pack of Claude Code skills covering adversarial code review plus general workflow automation. The adversarial angle means the reviewer is told to attack the change rather than confirm it. A reasonable drop-in if you want a skeptical review pass without writing the prompts yourself.

skillcode-reviewadversarialautomation
by hebstr Sep 15, 2026 6/10
skill GitHub

reqstool-ai: Config-Driven Skills for Requirements Traceability

Brings reqstool requirements traceability under AI assistance through config-driven skills and commands, so an agent can maintain the links between requirements, implementation, and tests. Targets teams already running reqstool in a regulated or audited context. Niche, but a real gap for anyone with traceability obligations.

skillrequirementstraceabilitycompliance
by reqstool Sep 15, 2026 5/10
skill GitHub

exorails-skills: Teach an Agent Postgres, SSH, Kubernetes, Redis and S3

A skill set that teaches an agent how to use the systems an Exorails environment exposes — PostgreSQL, SSH, Kubernetes, Redis, S3 and more — installable with npx skills add. Tied to the Exorails platform, but a useful reference for how to package per-environment infrastructure knowledge as skills. Read it for the pattern even if you do not use Exorails.

skillinfrastructurekubernetesdevops
by thomasdseao Sep 15, 2026 5/10
skill GitHub

yjh-discipline: Rules and Skills That Make Agents Delegate and Search First

Three skills plus a rules file that patch common agent failure modes: drowning in work instead of delegating, building something that already exists instead of searching, and ignoring installed skills that should have fired. Works across 60+ agents, not just Claude Code. The 'make installed skills actually fire' piece addresses a real and underdiscussed problem.

skilldelegationrulesdiscipline
by yjhqwer Sep 15, 2026 6/10
skill GitHub

agent-skills: Salesforce API Investigation and Narrated Shell Demos

A portable collection of agent skills and plugins covering Salesforce API investigation, narrated shell demonstrations, and GitHub contribution workflows. The narrated-demo skill is the unusual one — it walks through shell work with explanation rather than just executing. Portable across agents, not Claude-Code-only.

skillsalesforceshellgithub
by j-256 Sep 15, 2026 5/10
skill GitHub

arc-steward: Agent Skill that keeps architecture docs current after every feature

An Agent Skill that maintains a fixed canon of architecture documentation artifacts, refreshing them automatically as features land. It works diff-driven, emits Mermaid-only diagrams, and guards provenance so generated docs stay traceable. Good fit for teams that want architecture docs to stop drifting from the code.

skilldocumentationarchitecturemermaiddiagrams
by robertfoobar Sep 14, 2026 7/10
skill GitHub

consilium: Adversarial Multi-Agent Review Skill With a Mandatory Skeptic

A Claude skill that runs an adversarial multi-agent analysis: several agents examine a problem independently, one is required to play skeptic, and a constraint registry carries findings between rounds. The forced dissent is meant to stop agents converging on a comfortable answer too early. Repo documentation is in Russian.

skillmulti-agentadversarialreview
by Andrey-Batrimenko Sep 14, 2026 6/10
skill GitHub

ctrl-clip: Ctrl+Click to Copy Claude Code Drafts on Linux

A skill and plugin pair for Linux desktops that lets you ctrl+click a block of Claude Code output and get clean text on the clipboard. It strips the box-drawing pipes, quote markers, and surrounding commentary that normally come along with a terminal selection. Small quality-of-life fix for anyone moving drafted text out of the terminal.

skillpluginclipboardlinux
by geanruca Sep 14, 2026 6/10
skill GitHub

agentic-skill-suite: Skills and Subagent Templates for a 5-Phase SDLC

A bundled suite of agentic skills, subagent prompt templates, and SDLC tooling covering a five-phase path from idea to production. An NPX installer sets the whole thing up rather than requiring manual skill placement. Worth a look if you want an opinionated starting structure instead of assembling your own workflow skills.

skillsubagentssdlcworkflowtemplates
by garbsam97 Sep 14, 2026 6/10
skill GitHub

ea-harness: enterprise architecture design and validation for agents

A pip-installable CLI plus skills covering requirements, design, diagram validation, an enforce gate and a workflow gatekeeper. Works across Claude Code, OpenCode, Codex, GitHub Copilot and Cursor, supports multi-project workspaces, and installs through the Claude Code plugin marketplace.

architectureskillsvalidationenterprise
by axisrobo Sep 14, 2026 6/10
skill GitHub

SAP ships coding-agent plugins for its design system and Fiori tokens

An official SAP repository equipping AI coding agents with knowledge and tooling for UI theme designer, the SAP Design System and SAP Fiori design tokens. Notable mostly as a large vendor publishing first-party agent plugins for its own design stack.

sapdesign-systempluginsfiori
by SAP Sep 14, 2026 6/10
skill GitHub

betaflight-claude-skill: FPV drone tuning and log analysis as a skill

A Claude skill covering Betaflight flight controller configuration, PID tuning, blackbox log analysis and troubleshooting. A good example of packaging deep hardware-specific domain knowledge into a skill.

betaflightdronesskillhardware
by SebGalina Sep 14, 2026 5/10
skill GitHub

literature-quick-review-note: academic reading notes as Word files

Produces condensed literature review notes as .docx with real margin comments rather than plain text, so the output drops straight into an academic review workflow. Documentation is in Chinese.

academicdocxresearchskill
by oli66666 Sep 14, 2026 5/10
skill GitHub

suggest-skill: find the agent skills your project is missing

Discovers candidate Agent Skills for the project you are actually in, vets them, and installs the ones you accept. Addresses the practical problem that the skill ecosystem is now far too large to browse by hand.

skillsdiscoveryinstalltooling
by nktznl Sep 14, 2026 7/10
skill GitHub

mini-program-engineering-skill-suite: WeChat mini-program development

An evidence-first skill suite that takes mini-program projects from vague intent through intake, product specification, architecture, implementation, UI and device adaptation, debugging, verification and release readiness.

wechatmini-programskillsengineering
by NocodeMrLi Sep 14, 2026 5/10
skill GitHub

stritar/skills: agent skills for product design and design QA

Covers research, UI, design systems, accessibility, content and design QA — the design-side counterpart to the engineering skill packs that dominate the ecosystem.

designaccessibilitydesign-systemsskills
by stritar Sep 14, 2026 6/10
skill GitHub

concise: a skill for answers that lead with the answer

Pushes Claude Code toward short, direct responses, with the explicit constraint that brevity never comes at the cost of a caveat that actually matters.

output-styleskillbrevityprompting
by RicardoAlbuquerquet Sep 14, 2026 6/10
skill GitHub

Soundingboard: turn your agent into a novel production studio

Casts the agent as an executive writing concierge for long-form fiction, handling the sounding-board and production side of writing a novel rather than generating prose wholesale.

writingfictionskillcreative
by richardelder2 Sep 14, 2026 5/10
skill GitHub

anti-slop-ui: stop Claude generating interfaces that look AI-made

A skill that forces design tokens before code, an 8px grid, deliberate micro-typography, Hick's Law and authored texture — aimed at the generic look that generated UIs converge on. Docs in Portuguese.

uidesigntokensportuguese
by KaueTartari Sep 14, 2026 6/10
skill GitHub

claude-agent-skills: skills published with their design rationale

A skills repository that keeps the requirement records, design reasoning, iteration history and verification evidence alongside each loadable SKILL.md, rather than shipping only the finished file.

skillsdocumentationdesign-rationalechinese
by heweidong-ecco Sep 14, 2026 5/10
skill GitHub

weaveboard: offline project management in one HTML file, as a skill

WBS, CPM critical path, a risk register, ADRs and a kanban board in a single offline HTML file, with Excel and Word export. Ships as an agent skill so Claude can generate and update the board for you.

project-managementofflinehtmlskill
by tohnee Sep 14, 2026 6/10
skill GitHub

ultimate-frontend-skills: Award-Site Corpus, WebGL and three.js Skills for Frontend Work

A skill bundle for Claude Code and Codex that takes a frontend brief through to a shipped page. It includes a corpus of award-winning sites to design against, WebGL gradients, real parallax, procedural and Blender-modelled three.js exploded views, plus CC0 PBR materials and HDRI lighting. An audit step flags the usual tells of AI-generated pages.

skillfrontendwebglthreejsdesigncodex
by ridelink0 Sep 14, 2026 8/10
skill GitHub

sargam-psr-sx: Printable Song Sheets and Registration Guides for Yamaha PSR-SX

A Claude skill for arranger-keyboard musicians that generates printable song sheets, arrangements and registration guides for Yamaha PSR-SX keyboards. Every preset name it emits is verified against the factory Data List, so the registrations it suggests actually exist on the instrument.

skillmusicyamahapsr-sxdocument-generation
by HelloIamChetan Sep 14, 2026 5/10
skill GitHub

opencode-skills-en: 12 Domain-Expertise Skills for AI Coding Agents

A bundle of twelve agent skills spanning aesthetics, psychology, code, systems, wealth, and philosophy. Each uses a layered SKILL.md plus reference/ structure so the agent loads detail only when it needs it. Useful as a template for writing progressive-disclosure skills of your own.

skillsagent-skillsbundlereference
by mike22890 Sep 14, 2026 5/10
skill GitHub

compliance-skills: Mechanical Checks for Bidding and Ad Compliance

Agent skills that run reproducible, zero-dependency compliance checks over tender and bidding documents and advertising copy. The design is deliberately mechanical, favouring rule lookups over model judgement so results repeat exactly. Chinese-first; this repo is the free tier of the source.

skillscompliancelegalchinese
by chenqg618 Sep 14, 2026 5/10
skill GitHub

product-mode: A CLAUDE.md for PM and Engineering Teams

A CLAUDE.md built around seven principles covering problem framing, scope, tradeoffs, and outcome measurement. The premise is that the most expensive bug in AI-assisted building is shipping the wrong thing well, so the config pushes the agent to interrogate the problem before it writes code. Draws on Karpathy's observations.

claude-mdproduct-managementplanningconfiguration
by sohaibt Sep 14, 2026 7/10
skill GitHub

kunpeng-skill: Distill Sites, Repos, and Videos Into Agent Specs

A skill that turns websites, repositories, videos, and images into structured output: actionable methodologies, tech-stack breakdowns, UI insights, and product specs. Meant to feed agents and personal knowledge bases digested material instead of raw links.

skillresearchknowledge-basedistillation
by adigb6170 Sep 14, 2026 6/10
skill GitHub

gap-trap: Turn Repo Rules Into Gates an Agent Cannot Skip

A setup skill that converts a repository's conventions into enforceable gates: contracts, proven-red tests, and ratchets that only ever tighten. The goal is agent-written code that still holds up when nobody reads the diffs. Language-agnostic.

skilltestingquality-gatesci
by pliablepixels Sep 14, 2026 7/10
skill GitHub

sales-skills: Agent Skills for Running a Sales Organization

A skill set covering the full sales motion: market sizing, ICP definition, quota and comp design, cold outbound, discovery, MEDDPICC qualification, negotiation, deal strategy, and post-sale handoff. For operators who want an agent that already knows the standard playbooks.

skillssalesgtmbusiness
by mbfinotti Sep 14, 2026 5/10
skill GitHub

revops-skills: Agent Skills for Revenue Operations

Skills for the RevOps function: CRM data governance, pipeline and funnel management, lead routing and scoring, deal desk, forecasting, KPIs, and the sales-to-CS handoff. Companion to the same author's sales and partnerships skill sets.

skillsrevopscrmbusiness
by mbfinotti Sep 14, 2026 5/10
skill GitHub

partnerships-skills: Agent Skills for Partner Ecosystem Operations

Skills covering affiliate programs, influencer partnerships, channel alliances, joint go-to-market, partner enablement, and ecosystem measurement. Third in a set alongside the same author's sales and RevOps skills.

skillspartnershipsgtmbusiness
by mbfinotti Sep 14, 2026 5/10
skill GitHub

ways-of-working: Quality Process Skills for Cheaper Coding Models

Skills, rules, and playbooks meant to pull near-frontier output from cheaper coding agents by imposing process discipline. Ships ports for Claude Code, Cursor, Gemini CLI, Antigravity, AGENTS.md tools, and MCP, so one rule set travels across harnesses.

skillsprocessqualityportability
by franciszver Sep 14, 2026 6/10
skill GitHub

newsletter-ai-skill: Curate and Publish a Weekly AI Newsletter

A Claude Code skill that assembles a weekly agentic-AI and LLM newsletter, checks its own draft, then publishes it to a Hugo site. Triggered by a launchd agent so the whole loop runs unattended.

skillautomationnewsletterhugo
by ChrisAdkin8 Sep 14, 2026 6/10
skill GitHub

pstack: Rigorous Engineering Workflow Skills, Nativized for Claude Code

A port of Lauren Tan's poteto-mode playbooks, 23 engineering principles plus review and investigation skills, moved from Cursor plugins to native skills for Claude Code, Cowork, Codex, and ChatGPT. Opinionated process rather than tooling.

skillsworkflowcode-reviewport
by ahmedbenaw Sep 14, 2026 6/10
skill GitHub

typescript-skills: 22 GoF Design Patterns as an Agent Skill

Modern TypeScript implementations of all 22 Gang of Four design patterns, packaged both as an Agent Skill for coding assistants and as a developer playbook. Gives the agent concrete reference implementations rather than half-remembered ones.

skilltypescriptdesign-patternsreference
by fugisakimatheus Sep 14, 2026 6/10
skill GitHub

yautja: Sci-Fi Thermal-Style Image Segmentation and Annotation Skill

A skill that segments an image, re-skins it in a thermal-imaging aesthetic, and annotates the result. Colors are generated algorithmically with some randomness rather than derived from real temperatures, so it is for entertainment rather than measurement.

skillimage-processingsegmentationcreative
by petehottelet Sep 14, 2026 5/10
skill GitHub

multi-tenant-fullstack-crud-skill: Production Multi-Tenant CRUD Apps

A full-stack Agent Skill for building multi-tenant web apps with role-based access and audit trails, on Express, Sequelize, vanilla JS, MySQL, and Docker, with shared rules and end-to-end tests. Deliberately opinionated so the agent produces one consistent architecture rather than improvising per feature.

skillfullstackmulti-tenantexpress
by DevN-gr Sep 14, 2026 6/10
skill GitHub

trade-review-skills: Five Skills for Reviewing Trading Decisions

Five independent skills plus a combined entrypoint that check a trading decision against your own rules, plan, citations, and execution record. Reviews material you supply rather than giving advice, which keeps it a verification tool. Chinese-first.

skillstradingreviewchinese
by catgrandfa Sep 14, 2026 5/10
skill GitHub

BA-AI-Skills: Reusable Skills for Business Analysis and Product Ownership

Skills for anyone wearing the BA or PO hat: requirements discovery, workshop analysis, user stories, Gherkin scenarios, API and integration analysis, source-to-target mapping, process modelling, backlog quality, and specification workflows. Aimed at developers and architects doing this work as much as at dedicated BAs.

skillsbusiness-analysisrequirementsgherkin
by NeetuAggarwal-AI Sep 14, 2026 5/10
skill GitHub

mac-app-skills: Build and Ship macOS Apps With SwiftPM From Claude Code

Claude Code skills covering the awkward parts of shipping a Mac app with SwiftPM: stable local signing, app bundling, terminal-driven UI checks, GitHub releases, executable tests, and Dictionary Services. The signing and bundling steps are where agents usually get stuck, so encoding them as skills is the useful move.

skillsmacosswiftpackaging
by tilakp Sep 14, 2026 6/10
skill GitHub

jee-forge: eight SKILL.md agent skills for Java/Spring development

A single repo packaging eight agent skills that cover the Java/Spring development loop: process, code style, comments, SQL, builds, tests, onboarding legacy code, and a final consistency check. Install once and the whole family is available across projects. Docs are bilingual Chinese/English.

javaspringskillsagent-skillscode-review
by soft6096 Sep 13, 2026 6/10
skill GitHub

decklet: turn any content into a one-file, hand-editable HTML deck

A Claude Code and Codex skill plus CLI that generates a self-contained HTML slide deck from any content, with no dependencies and no build step. The output stays hand-editable via drag-and-retype, with brand-consistent type roles, in-file PDF export, and verified layout. Pitched as an open alternative to PowerPoint, Gamma, and Slidev.

slidespresentationshtmlskillcodex
by grunion-ai Sep 13, 2026 7/10
skill GitHub

kurashi-skill: agent skills for daily life in Japan, no login needed

A skill collection that lets an agent answer everyday questions about living in Japan using official open data: JMA weather, Cabinet Office disaster information, and the Calil library API. No accounts or API keys required. Japanese-language.

japanopen-dataagent-skillsweatherjapanese
by tahodev Sep 13, 2026 5/10
skill GitHub

yyc.skill: three Chinese copywriting skills for Claude Code

A trio of Claude Code skills for Chinese writing: viral article structure, advertising copy, and personal-brand voice. Each is distilled from a corpus study rather than hand-written rules, drawing on 9,268 articles, the CA$HVERTISING method, and 153 Dan Koe videos.

writingcopywritingchineseskillmarketing
by laoyang687 Sep 13, 2026 5/10
skill GitHub

grant-thinking-skill: test whether a project is actually fundable

An agent skill that walks a proposal through grant-reviewer logic: where the innovation actually sits, whether the plan is feasible, and which weaknesses tend to draw rejections. Aimed at tightening a grant narrative before submission.

grantsresearchagent-skillsevaluation
by Ikramahmadmemon13 Sep 13, 2026 5/10
skill GitHub

Wenzhi: a strategy-first presentation skill with a renderer pipeline

An agent skill that separates presentation strategy from rendering: it produces a strategy, then a presentation intermediate representation, then renders. The result is a runnable presentation app you can branch into deeper detail or adjust live. Works with Claude Code, Codex, OpenCode, and Kimi Code. Chinese-language.

presentationsskillchinesecodexrendering
by mizzlelover Sep 13, 2026 5/10
skill GitHub

ai-drama-producer: a short-drama production crew as agent skills

Skills covering the full short-form drama pipeline: script, hook design, character consistency, storyboards, seven-part prompt templates, voiceover, and an edit list. Ships with compliance gates, four QC layers, an 18-item failure-mode library, and two worked examples. MIT, Chinese-language.

videoshort-dramaskillchineseproduction
by jiduge9-coder Sep 13, 2026 5/10
skill GitHub

Reasoning-Skill-Claude: force context and assumptions before answering

A structured reasoning skill that makes Claude work through a fixed sequence before responding: establish context, name the actual goal, audit assumptions, then navigate around known walls. Intended to cut down on confident answers to the wrong question.

reasoningskillpromptingplanning
by Firekid-is-him Sep 13, 2026 6/10
skill GitHub

skills-docs: pptx, docx, and PDF generation skills with QA contracts

Document-generation skills for Claude Code, Codex, and Cursor covering PowerPoint decks, Word reports and proposals, and PDF production with print-versus-screen route selection, font embedding, and a QA pass. Knowledge-first rather than script-driven: storylines, structure rules, chart-by-question, and verification contracts. MIT.

documentspptxdocxpdfskill
by meshcode-ai Sep 13, 2026 7/10
skill GitHub

skills-video: Shorts, Reels, and TikTok skills for coding agents

Video skills for Claude Code, Codex, and Cursor: cutting clips from long-form video, 9:16 reframing with captions, script structure with retention checkpoints and hook formulas, and thumbnail/title packaging with CTR diagnosis. Encodes judgment criteria and output contracts instead of shipping scripts. MIT.

videoshortsskillyoutubecodex
by meshcode-ai Sep 13, 2026 6/10
skill GitHub

skills-design: landing page, UI audit, and design-token skills

Design skills for Claude Code, Codex, and Cursor: homepage and landing page design, a UI audit that grades A-F, and design tokens and systems across primitive, semantic, and component layers including dark mode and migration. Includes a list of AI-template tells to avoid. MIT.

designuidesign-tokensauditskill
by meshcode-ai Sep 13, 2026 7/10
skill GitHub

humanist-frontend: frontend rules distilled from Anthropic and Kimi

A frontend specification and agent skill built by extracting principles from Anthropic's and Kimi's published design guidance, case studies, and interviews. Gives an agent a concrete house style for interface work instead of generic advice. Chinese-language.

frontenddesignskilluichinese
by Hai-qq Sep 13, 2026 6/10
skill GitHub

rootnode-skills: 27 skills for diagnosing and tuning your Claude setup

A set of 27 skills aimed at the Claude environment itself rather than your code: diagnosing what is misconfigured, building the missing pieces, and optimizing each architectural layer. Useful once your CLAUDE.md, hooks, and skills have grown past the point you can audit by hand.

skillsconfigurationdiagnosticsclaude-codetooling
by drayline Sep 13, 2026 7/10
skill GitHub

awesome-academic-research-skills: a daily ranking of research skills

An automatically updated leaderboard of GitHub repos offering academic and research skills for Claude Code, Codex, and OpenCode. It searches, filters, and ranks daily, aimed at Chinese-speaking researchers looking for what is actually maintained.

researchskillsleaderboardchinesediscovery
by kael-odin Sep 13, 2026 5/10
skill GitHub

ai-crew-rules: coding discipline as a skill, with an open-source-first gate

A Claude Code skill encoding development rules: a layered architecture scaffold, a startup gate that requires checking for an existing open-source solution before building, and rules for which AI to dispatch a given task to.

rulesarchitectureskilldisciplinemulti-model
by kxc7558 Sep 13, 2026 5/10
skill GitHub

humanizer-hu: Hungarian writing skill that stops output sounding like AI

A Hungarian style skill that applies rules while text is being written rather than rewriting finished output, and only asserts what the source actually supports. Ships 26 patterns, document-level decisions, and a lint that runs without an LLM. Works with Claude Code, Codex, Cursor, Copilot, Gemini CLI, and 74 other agents.

writinghungarianhumanizerlintskill
by Dexxter182 Sep 13, 2026 5/10
skill GitHub

A Claude skill for building motion graphics as Remotion code

An agent skill for kinetic typography, logo animations, and brand promos written as React components in Remotion, then rendered to MP4. One codebase produces both 9:16 and 16:9 output.

remotionmotion-graphicsreactvideoskill
by Boriwatopal Sep 13, 2026 6/10
skill GitHub

repo-runner: get an unknown GitHub repo running behind a security gate

An agent skill that detects a repo's stack, runs a supply-chain security check before touching install scripts, then installs, starts, and health-checks it. Aimed at the common case of cloning something you found and letting an agent bring it up without blindly executing whatever is in the postinstall hook. Works with Claude Code, Codex, and Cursor.

skillsecuritysupply-chainonboardinggithub
by Jia-ben00 Sep 13, 2026 7/10
skill GitHub

readme-skills: evidence-first auditing and rewriting of repo READMEs

An agent skill for creating, auditing, restructuring, translating, and validating README files, built so claims are grounded in what the repo actually contains rather than what the agent assumes.

readmedocumentationauditskilltranslation
by Shiaoming123 Sep 13, 2026 6/10
skill GitHub

RouterGrowth skills: open-source go-to-market workflows for agents

Agent skills covering GTM work: building lead lists, cold email, LinkedIn, AI visibility checks, Reddit and brand monitoring, and ad creative. The skills are open source; execution runs on RouterGrowth on a pay-per-call basis.

gtmmarketingskillssalesautomation
by RouterGrowth Sep 13, 2026 5/10
skill GitHub

liya-subtraction-skill: a method for pruning an overgrown skill library

A skill about maintaining skills: detecting redundancy, thinning bloated entries, merging overlaps, and deciding what to archive. Applies to any SKILL.md-based agent setup, not just Claude Code. Chinese-language.

skillsmaintenancerefactoringchinesemeta
by feverZHONG Sep 13, 2026 6/10
skill GitHub

ux-crux: UX review skills graded by evidence and severity, not a score

Review skills for Claude Code and Codex covering usability, psychology, accessibility, product, and trust. Each finding carries how well it is supported and how severe it is, instead of collapsing into one opaque UX number you cannot act on.

uxaccessibilityreviewskillcodex
by DrSmile444 Sep 13, 2026 7/10
skill GitHub

arch-lens: write the architecture analysis, compile the diagrams from it

A Claude Code plugin that turns a codebase or design doc into an analysis where every claim carries its evidence, then compiles interactive diagrams from that analysis. The diagrams cannot drift from the text because they are generated from it and validated.

architecturediagramspluginanalysisdocumentation
by cognitive-fab Sep 13, 2026 7/10
skill GitHub

pptx-korean-formatting: Korean PowerPoint formatting rules for agents

Encodes the details that break Korean-language PowerPoint output — lang=ko-KR tagging, and how paragraph and master-level formatting inherit — as rules for Claude Code, Codex, Antigravity, Cursor, and others.

pptxkoreanformattingskilldocuments
by sshin90 Sep 13, 2026 5/10
skill GitHub

frank: stop your agent saying "You're absolutely right!" and calling it done

Rules that push a coding agent toward honesty: no reflexive agreement, no caving when you push back on code that was actually correct, and no claiming 'done' without a command whose output proves it. Works across 20 agents.

honestyrulesverificationpromptingskill
by HimanshuJ16 Sep 13, 2026 7/10
skill GitHub

property-testing-skill: fast-check and Hypothesis done properly

A skill for Claude Code and OpenCode covering the parts agents usually get wrong about property-based testing: picking the strongest property rather than one that is trivially true, writing generators that do not quietly exclude interesting inputs, order-of-arrival properties, and triaging a shrunk failure.

testingproperty-basedfast-checkhypothesisskill
by nyxandro Sep 13, 2026 7/10
skill GitHub

skill-memory-bank: cross-session project memory for eight coding agents

A long-term project memory layer that works across Claude Code, Cursor, Windsurf, Cline, and four others. Bundles TDD rules, a code graph, spec-driven development conventions, and cross-session recall.

memorytddcode-graphcross-agentspec-driven
by fockus Sep 13, 2026 6/10
skill GitHub

honest-arch-diagrams: separate the verified request path from guesses

An agent skill for service-topology and request-path diagrams that marks which components were actually verified in the code versus inferred companions, so the diagram never quietly invents a queue or cache that is not there.

diagramsarchitecturehonestyskillverification
by albegosu Sep 13, 2026 7/10
skill GitHub

claude-cognition-skills: the failure modes of long-horizon collaboration

Targets the ways long agent collaborations go wrong rather than any single coding task: keeping continuity across sessions, preserving judgment instead of drifting toward agreement, detecting traps, and translating faithfully.

cognitionlong-horizoncontinuityskilljudgment
by hegu-1 Sep 13, 2026 6/10
skill GitHub

pua: push an agent to exhaust every option before it gives up

A productivity skill that borrows the pressuring language of Chinese and Western big-tech management to keep an agent from settling for its first answer. Supports Claude Code, Trae, Cursor, and ten-plus other agents. Fork of tanweai/pua. Chinese-language.

promptingpersistencechineseskillfork
by Kirky-X Sep 13, 2026 5/10
skill GitHub

qualcomm-claude-skills: ONNX to Hexagon HTP deployment as skills

Skills for Qualcomm QAIRT/QNN model deployment: converting ONNX models to run on the Hexagon HTP, AIMET quantization, and eSDK cross-compilation. Narrow, but this is exactly the kind of toolchain where an agent that already knows the flags saves hours.

qualcommonnxquantizationedge-aiskill
by dev-ansh-r Sep 13, 2026 6/10
skill Reddit

Eight CLAUDE.md rules that cut Opus 5's verbosity and invented jargon

A Max 5x user's rules for taming explanation style: open with one paragraph on what the thing is before any finding about it, and name things in the user's world — real-world entities and user-facing behavior — rather than in the code's vocabulary, among six others. Found by accident while pairing Opus 5 with Fable for planning.

claude-mdopusverbosityrulesprompting
by tetro_ow Sep 13, 2026 7/10
skill GitHub

brain-kit: a BRAIN.md read before every session and written after

A file-based memory discipline for coding agents: a BRAIN.md the agent reads at session start and updates at the end, a CLAUDE.md generator that keeps many repos consistent, and hooks that enforce the ritual instead of hoping the agent remembers.

memoryclaude-mdhooksdisciplinecross-repo
by intotheveil Sep 13, 2026 7/10
skill GitHub

legwork-skill: research where every claim states how well it is supported

A decision-research skill for Claude Code and Codex built around honest evidence grading: each claim carries its support level, and the skill says outright when the evidence cannot settle the question instead of picking a side. Free, from DBHQ.

researchevidencedecision-makingskillcodex
by dbhq-uk Sep 13, 2026 6/10
skill GitHub

analytical-figures-skill: chemistry figures behind gated analysis

A Claude Code skill for analytical chemistry — FTIR/ATR, PXRD, calibration curves, chemometrics, CIF and crystal structures, and cocrystal identification — producing publication-grade figures behind gates that stop the analysis when the data does not support it.

chemistryfiguresscienceskillanalysis
by TheDop Sep 13, 2026 5/10
skill GitHub

macos-golden-gate-design: an agent skill for native macOS 27 UI

Design rules for building genuinely native-feeling macOS 27 interfaces: restrained use of Liquid Glass, integrated panes, real SwiftUI and AppKit, and cutting the unnecessary boxes agents tend to nest.

macosswiftuidesignskillui
by gambadio Sep 13, 2026 6/10
skill GitHub

vibes-plug: a multi-agent swarm plugin for Antigravity, Claude and Cursor

A plugin bundling specialized skills for a 2026 fullstack stack — React 19, Tailwind v4, Bun, Next.js 15, MCP v1.9, Rust, Python 3.14 — and running them as a multi-agent swarm across Antigravity, Claude Code, and Cursor.

pluginmulti-agentfullstackreactcursor
by roedyrustam Sep 13, 2026 5/10
skill GitHub

marketing-workspace: a Claude Code workspace for day-to-day marketing

Sets up a Claude Code environment for marketing work: configures the workspace, organizes recurring processes, and helps build custom skills for your own business. Portuguese-language.

marketingworkspaceskillsportugueseconfiguration
by lucasenatm Sep 13, 2026 5/10
skill GitHub

eval-genius: agent skill for deciding when and how to build evals

A tool-agnostic skill that gives an agent judgment about evaluation: whether a task actually needs an eval or benchmark, how to construct one that holds up, and how to interpret the results. Takes a deterministic-first stance rather than defaulting to LLM judges. Written in plain language rather than as a framework.

evalsbenchmarkingtestingskill
by alexgreensh Sep 13, 2026 6/10
skill GitHub

requirements-review: ISO 29148 requirements linter plus agent skill

Pairs a deterministic linter with an agent skill to review requirements documents against ISO 29148 and INCOSE quality criteria. The linter catches the mechanical defects reproducibly while the agent handles judgment calls. Supports Italian and English.

requirementslinteriso-29148review
by EnzinoBB Sep 13, 2026 6/10
skill GitHub

affordable-housing-skills: agent skills for US nonprofit housing

A free MIT-licensed set of agent skills covering the full US affordable housing continuum, from homelessness services through to homeownership. Encodes domain knowledge that nonprofit staff would otherwise have to explain to the model every session. A good example of skills written for a specific professional domain rather than for coding.

skillsnonprofithousingdomain-specific
by brendon-connelly Sep 13, 2026 5/10
skill GitHub

second-brain-skill: make a markdown vault memory Claude Code uses

Turns an existing folder of markdown notes into memory that Claude Code actually reaches for, rather than a vault it ignores. Ships vault helper commands, session hooks that load and write context automatically, and two MCP servers. Good fit if you already keep an Obsidian-style vault.

memorymarkdownhooksmcpobsidian
by Dressi123 Sep 13, 2026 7/10
skill GitHub

safe-emr-builder-plus: Claude Code skill for EMR apps with FHIR

A skill for building electronic medical and health record applications with the safety scaffolding those systems require: HL7 FHIR links, controlled data sharing and audit logging. Built on the ECC skill collection. Narrow domain, but the audit and sharing patterns are the parts most likely to be got wrong by default.

healthcarefhiremrauditskill
by agenticluke Sep 13, 2026 5/10
skill GitHub

issue-register-skill: keep one register of open problems honest

A skill for Claude Code and OpenCode that revises a project register of open problems against the current code, closing out what has actually been fixed and reporting what changed. Keeps everything in a single file rather than spreading stale TODOs through the repo.

issuestrackingmaintenanceskill
by nyxandro Sep 13, 2026 6/10
skill GitHub

goal-contract: define what done means before an agent writes code

A pattern for writing down what done means, how you will know it has been reached and who verifies it, all before an agent starts work. Ships as a documented pattern with a JSON schema, a worked example and a Claude Code skill. Apache-2.0 licensed.

planningacceptance-criteriaskillverification
by FortunaTerra-Group Sep 13, 2026 6/10
skill GitHub

engineering-flow-skills: Evidence-Driven Workflow Skills for Claude Code

A compact set of agent skills that impose an evidence-driven development flow on Claude Code and Codex CLI. Each step expects the agent to ground its changes in verifiable evidence rather than assumption. Portable across both CLIs from one skill set.

skillsworkflowcodexevidenceprocess
by yyqqCoding Sep 12, 2026 6/10
skill GitHub

valcraft: Spec-Driven Delivery Loop for Claude Code, Codex and OpenCode

One plugin of agent skills for spec-driven delivery across Claude Code, Codex, and OpenCode. At its center is an agentic loop — plan, review, implement, review, merge — run over fresh-context worker agents. Around it, helper skills scaffold specs into the repo, turn PRDs into feature specs, and feed lessons from shipped work back into the next cycle.

skillsspec-drivenworkflowmulti-agentplugin
by valzav Sep 12, 2026 7/10
skill GitHub

agent-skills: Symlink Skills Into Agent Home Instead of Copying Them

A personal skill collection that links its skills into the agent home directory rather than copying them, so the git checkout stays the single copy. Editing a skill in the repo takes effect immediately with no re-install step. A small pattern worth borrowing for anyone keeping skills under version control.

skillssymlinkdotfilesworkflow
by yasuyuki Sep 12, 2026 5/10
skill GitHub

resume-builder: Agent Skill That Lints AI Buzzwords Out of Resumes

A skill that drafts and audits technical resumes, using deterministic linting to strip generic AI phrasing and grounding claims in facts pulled from your actual codebases. It targets modern ATS semantic search and the six-second recruiter F-pattern scan. For engineers who want a resume that survives both the filter and the human.

skillresumeatscareerlinting
by prathameshlonare Sep 12, 2026 6/10
skill GitHub

arvancloud-agent-skill: Drive ArvanCloud CDN, DNS and IaaS From an Agent

An unofficial agent skill for driving ArvanCloud's APIs — CDN, DNS, IaaS, Object Storage, Edge, CaaS, and VOD/Live — from Claude Code or any SKILL.md-compatible agent. It also handles Let's Encrypt DNS-01 certificate issuance through acme.sh. Useful for teams on ArvanCloud who want infrastructure changes driven from the terminal.

skillcloudcdndnsinfrastructure
by erfnzdeh Sep 12, 2026 5/10
skill GitHub

formlabs-claude-skills: Prep and Print Formlabs Jobs From Claude Code

A plugin marketplace connecting Claude Code to Formlabs 3D printers, bundling an MCP server with print-prep skills. It takes a model through preparation and sends the job to the printer without leaving the agent. A concrete example of wiring Claude Code to physical hardware.

3d-printingformlabsmcppluginhardware
by mkebiclioglu Sep 12, 2026 6/10
skill GitHub

youtube-skills: CTR Titles, SEO Descriptions and Hooks as Agent Skills

An MIT-licensed set of skills for YouTube and Shorts marketing from Claude Code or Codex, covering high-CTR titles, SEO descriptions, retention hooks, thumbnails, and a full content plan. Publishing runs through Publora. For creators who want the content-strategy grind scripted rather than improvised.

skillyoutubemarketingseocontent
by sergebulaev Sep 12, 2026 5/10
skill GitHub

chapter-to-synced-lecture: Turn a PDF Chapter Into a Narrated Lecture

A Claude Code skill that converts a book chapter PDF into a lecture given by its author: HTML slides driven by narration, questions the audio stops on, and word-synced captions. Speech is generated locally on GPU with Kokoro, so it is free and unmetered. A strong example of a skill producing a complete multimedia artifact.

skillttseducationpdfkokoro
by ajaygunalan Sep 12, 2026 7/10
skill GitHub

github-profile-studio: Build a GitHub Profile README as a Claude Skill

A Claude skill for composing a GitHub profile README that fits the person behind it. You can copy a style you like, turn a photo into an ASCII portrait card, assemble widgets, and preview the result in both light and dark themes before publishing.

skillgithubreadmeprofile
by DEOWL-kan Sep 12, 2026 6/10
skill GitHub

open-science-pillars core: Earth Science Foundation Plugin for Claude

The foundation plugin of the Open Science Pillars stack, covering earth science data formats, statistics, uncertainty quantification, cartography, quality control and reproducibility. It provides the start, discover-data and report workflows plus analysis review, and the project's domain plugins build on top of it.

pluginsciencedata-analysisreproducibility
by open-science-pillars Sep 12, 2026 5/10
skill GitHub

job-application-assistant: Job Search Skill With Human Sign-Off

A Chinese-language job hunting Skill for Claude and Codex that searches companies that are hiring, does background research before you apply, keeps application records in one place, and helps fill in application forms. Every real submission requires manual confirmation.

skilljob-searchchineseautomation
by LH-kevin Sep 12, 2026 5/10
skill GitHub

job-hunt: Job Search Skill That Refuses to Invent Your Achievements

A Chinese-language job hunting Skill for Claude Code and Codex: find roles, judge whether they are worth applying to, produce a resume and application materials, check them, and run mock interviews. It will not fabricate skills or numbers and will not predict your odds, and it reviews resumes for ATS readability plus separate recruiter and hiring-manager passes.

skilljob-searchresumechinese
by addsumtech Sep 12, 2026 5/10
skill GitHub

content-wizard: Six Steps From Vague Topic to a Concrete Content Brief

Takes a broad content direction and narrows it in six steps into a brief that answers who you are talking to, what you are saying, where to start and what the opening line is. Available as both a web version and an Agent Skill.

skillcontentwritingchinese
by luvif666-arch Sep 12, 2026 5/10
skill GitHub

GlideGrail: ServiceNow Coding Rules for Humans and AI Agents

A set of actionable ServiceNow development rules written to be followed by both human developers and AI coding agents. The goal is standardizing how ServiceNow work gets done so agent-generated code matches house style.

servicenowcoding-standardsrules
by Thebaultsemirigid251 Sep 12, 2026 5/10
skill GitHub

skr-cram-night: Turn a Teacher's PDF Into HTML Lessons Overnight

A Claude Code skill for last-minute studying: it takes the PDF sheet your teacher handed out and produces HTML lessons from it. Aimed at Thai high-school chemistry, biology, physics and math, with every number verified in Python.

skilleducationpdfthai
by PeerawitDeesamer Sep 12, 2026 5/10
skill GitHub

skill-engine: Curated Multi-Repo Index for Claude, Reviewer in the Loop

A plugin that builds and then maintains a curated index of several repositories so Claude knows your codebase and stays current as it changes. Every change to the index goes through a reviewer rather than being written blindly.

plugincodebase-indexcontext-managementmulti-repo
by nick-railsback Sep 12, 2026 7/10
skill GitHub

kuaishou-searchs: Search Kuaishou Videos by Keyword From Your Agent

An agent skill that searches live Kuaishou video data by keyword, with filters for most-liked, newest, publish date and video duration. Results include title, author, plays, likes, comments and saves, each linking through to the original post.

skillkuaishousearchchinesesocial-media
by why20261 Sep 12, 2026 5/10
skill GitHub

new-project-init: Document System Skill for Projects Already Underway

A documentation-system skill built mainly around existing projects: it improves the docs you already have and locks in a role-based AI collaboration workflow. It also handles joining a project mid-flight or initializing a new one. Question-driven, 26 templates, MIT licensed.

skilldocumentationtemplateschinese
by warm-flame-core Sep 12, 2026 5/10
skill GitHub

write-chinese-exam-essays: Exam Argumentative Essays That Sound Human

A Skill for Chinese high-school exam argumentative essays (材料议论文): it pulls a thesis and argument layers out of the source material while keeping a student's own voice. It deliberately avoids stock phrasing and mechanical parallel constructions.

skillwritingeducationchinese
by lbyh0116 Sep 12, 2026 5/10
skill GitHub

anime-80s-skill: Turn a Brand Into 1980s Anime Print Pieces

Takes any brand, product, event or phrase and produces original 1980s-anime print work: posters, packaging, merch, magazine covers and riso flyers in limited ink counts.

skilldesigngraphicsretro
by m-mahadi Sep 12, 2026 5/10
skill Reddit

Quartermaster: Plugin That Keeps Your Claude Code Setup Improving

The author's new first install in every Claude Code project, taking the slot codebase-mapper used to hold — quartermaster sets codebase-mapper up for you, builds the map, seeds live rules drawn from how you actually work, and picks stack plugins and permissions to fit the project, asking before it touches anything. It then stays in place and keeps the whole setup improving as the project changes, reading real session history to surface things you would never go looking for, like a capability you keep rebuilding by hand.

pluginsetupself-improvingcodebase-mapper
by TheDeadlyPretzel Sep 12, 2026 7/10
skill GitHub

keel: 101-Line Contract, 40 Lazy Skills, No Runtime Services

A kernel for Claude Code projects built around a 101-line contract, 40 lazily-loaded skills, 7 hooks and 2 subagents, with nothing running in the background. The author presents it as the successor to SkillForge.

skillpluginhookssubagentslightweight
by bogdanov-igor Sep 12, 2026 6/10
skill GitHub

meshcode skills: 73 Business Agent Skills at 2KB Each

An MIT-licensed collection of 73 Agent Skills for business work — SEO and AEO, marketing, copywriting, operations, planning, research and executive advisory. Each is knowledge-first and around 2KB, carrying judgment criteria and output contracts rather than scripts. Works with Claude Code, Codex, Cursor and meshcode.

skillbusinessmarketingseocollection
by meshcode-ai Sep 12, 2026 6/10
skill GitHub

aren: Personal Development Coach Skill With Verifiable Stage Calls

A Chinese-language coaching Skill that moves someone from a messy description of their situation to a checkable judgment about what stage they are at and what to do next. Runs in Codex, Claude Code, OpenClaw, WorkBuddy and other Agent Skills environments.

skillcoachingchinesepersonal-development
by renhuanyi Sep 12, 2026 5/10
skill GitHub

research-superpowers: Theology and Ancient History Research Skills

A skill-driven research workflow for Claude Code covering theology, biblical archaeology, ancient history and digital humanities. It is methodology-aware — hermeneutic, quantitative or mixed — with SOFT-GATE audit trails and optional MCP integration.

skillresearchhumanitiesworkflow
by leiverkus Sep 12, 2026 5/10
skill GitHub

vibe-rules: One Coding Standards Library Shared by 15+ Agents

A shared vibecoding standards library that plugs into more than 15 coding agents at once — Claude Code, Cursor, Codex, Qoder, Trae, Windsurf, Copilot, Cline, Roo, Aider and others. Cross-platform on macOS, Linux and Windows, with a personal notes area and scripts for migrating existing projects.

skillcoding-standardscross-toolchinese
by handsongice Sep 12, 2026 6/10
skill GitHub

puppet-master: Four Skills to Drive and Profile iOS Apps With Evidence

Four composable Agent Skills that let a coding agent drive, inspect, debug and profile an iOS app, reporting what it actually observed instead of guessing. Works in Claude Code, Codex, Cline and any Agent Skills runtime.

skilliosdebuggingprofilingtesting
by ksypinro Sep 12, 2026 7/10
skill GitHub

whetstone: Nine Claude Code Skills From Video Rough Cuts to Print

Nine Claude Code skills built on the idea that a whetstone cuts nothing but makes the blade cut: rough-cutting unscripted footage, auditing to a verdict, holding a visual contract, taming sprawl, drawing print layouts in code, and three on Chinese writing. CC BY-NC-SA 4.0, non-commercial use only.

skillvideowritingdesignchinese
by j912835225-prog Sep 12, 2026 5/10
skill GitHub

guardskill: Scan Git Settings That Let a Repo Run Code in Your Agent

A read-only scanner for git configuration that would let a cloned repository execute code inside a coding agent, covering the GitSpawn class of issues and CVE-2026-45033. Works with Claude Code, Codex, Cursor and Copilot, with no dependencies, no network and no telemetry.

skillsecuritygitscannercve
by soemoescode Sep 12, 2026 7/10
skill GitHub

long-task-runner: Windows-First Agent Skill for Long-Running Jobs

An Agent Skill for jobs that outlast a single turn: local queues, bounded logs, safe recovery after an interruption, and checks on the artifacts produced. Windows-first and built on the Python standard library.

skillwindowslong-runningqueuepython
by dhzyw Sep 12, 2026 6/10
skill GitHub

competlab-ci-skills: Competitor Dossiers and Battlecards for Agents

Competitive intelligence skills for AI agents covering landscape analysis, competitor dossiers, AI visibility reports, weekly briefings and battlecards. Powered by CompetLab and works with Claude Code, Cursor, Codex and Gemini CLI.

skillcompetitive-intelligenceresearchbusiness
by competlab Sep 12, 2026 5/10
skill GitHub

douyin-video-read: Read a Douyin Video's Content in Two Depth Levels

An Agent Skill for extracting the content of Douyin videos: L1 pulls metadata and the official chapter highlights, while L2 drives a browser to screenshot frames and OCR subtitles into a full transcript. Supports WorkBuddy, Claude Code and Codex, with pluggable browser and OCR backends.

skilldouyinvideoocrchinese
by 52Siriyue Sep 12, 2026 5/10
skill GitHub

skills: Claude Code Skills for Video and Audio Post-Production

A small set of Claude Code skills aimed at content creators: cut silence from video, normalize audio levels, and strip filler words. It turns common editing chores into agent-driven steps instead of manual timeline work. Handy if you record screencasts or podcasts alongside your coding work.

skillsvideoaudiocontent-creation
by AndersonAdelino Sep 12, 2026 6/10
skill GitHub

agent-skills: Cross-Agent Skill Manager for Java and JVM Specialists

A skill package manager that installs specialist skills across multiple coding agents, shipping with sets for Java, JVM performance tuning, software architecture, and distributed systems. The cross-agent packaging means the same skills work beyond Claude Code. Worth a look for JVM teams who want deeper domain knowledge than a generic CLAUDE.md provides.

skillsjavajvmarchitecturepackage-manager
by robsonkades Sep 12, 2026 7/10
skill GitHub

resume-builder-skill: ATS-Optimized Resumes With a 100-Point Rubric

An open-source Claude skill that drafts resumes scored against a 100-point rubric, with playbooks per candidate type and a strict no-fabrication rule. The scoring rubric is the interesting part — it gives the agent a concrete target instead of vague prose advice. A clean example of encoding an evaluation rubric into a skill.

skillresumerubricats
by saranya-sallagundla Sep 12, 2026 6/10
skill GitHub

skills: Agent Skills for Code Review, Planning, and Testing

A personal collection of agent skills covering code review, planning, testing, and general day-to-day development flow. Nothing exotic, but it is a compact reference for how to split routine dev tasks into discrete skills. Good starting point if you are assembling your own skill set.

skillscode-reviewplanningtesting
by nielsmadan Sep 12, 2026 5/10
skill GitHub

quant-buddy-skills: Agent Skill for A-Share, HK, and US Stock Analysis

An agent skill for quantitative equity analysis across A-share, Hong Kong, and US markets, covering market data, valuation, financial queries, stock screening, factor computation, and strategy backtesting. Broader in scope than most finance skills, which usually stop at price lookups. Niche but a substantial example of a data-heavy skill.

skillquantfinancebacktestingscreening
by pseudo-longinus Sep 12, 2026 6/10
skill GitHub

claude-skill-plan-hotel-stays: Ranked Hotel Comparisons via Apify

A Claude skill that plans hotel stays by pulling listings through the Apify Google Hotels Search Scraper, then producing a ranked hotel-versus-rental comparison and an email-ready price table. Shows a straightforward pattern for wrapping a third-party scraper API in a skill. Off the core dev path, but a clean structural example.

skilltravelapifyscraping
by johnisanerd Sep 12, 2026 5/10
skill GitHub

thinking-framework-skills: 63 Evidence-Graded Thinking Methods as Skills

A library of 63 thinking frameworks reduced to their working mechanism, each graded for evidence quality and made to produce a concrete artifact rather than a discussion. Ships with 4 tools and 9 recipes for Claude Code, Codex, and other agents. The honest evidence grading sets it apart from the usual prompt-pattern dumps.

skillsframeworksreasoningrecipes
by product-on-purpose Sep 12, 2026 7/10
skill GitHub

humanizer-it: Strip AI Tells From Italian Text

An MIT-licensed Claude skill that detects and removes the markers of machine-written Italian — English calques, nominal bureaucratese, missing intercalari and clitics. Ships 52 patterns, 15 hard bans and a dependency-free scanner.

writingitalianhumanizeropen-source
by ilyautov Sep 11, 2026 6/10
skill GitHub

monograph-writing: Batch-Writing Pipeline for Books and Theses

An Apache-2.0 Agent Skill for long-form scholarly writing — monographs, textbooks, technical books and theses. Works in verifiable batches so an AI can resume the manuscript across sessions without fabricating citations or losing structure.

writingacademiclong-formskill
by newdeme Sep 11, 2026 6/10
skill GitHub

skill-library: 28 QA-Lifecycle Agent Skills With Playwright Automation

A library of 28 reusable SKILL.md files covering the full QA lifecycle plus Playwright test automation. Every skill produces a review-ready draft that a human confirms before anything ships. Portable across Claude Code, GitHub Copilot and similar assistants.

qatestingplaywrightskill-library
by Shivani26Singh Sep 11, 2026 6/10
skill GitHub

feature-workplan: Durable Feature Workplans That Survive Sessions

An Agent Skill that turns a complex feature request into a durable, actionable workplan on disk. Decisions and progress are preserved across sessions, so a new context window picks up where the last one stopped rather than re-deriving the plan.

planningpersistenceskillcontext
by bicccio Sep 11, 2026 7/10
skill GitHub

mistok-chytalnia: Archival Research Skills for Ukrainian Villages

Claude Code skills, methods and raw materials for archival genealogical research on Ukrainian villages, developed for the Mistok project and released publicly. A concrete example of packaging domain research methodology as reusable skills.

researchgenealogyarchivesskill
by OuFinx Sep 11, 2026 5/10
skill GitHub

soulscrape: Build an Evidence-Backed Working Model of a Person

An Agent Skill that assembles a dated working model of a person from authorized sources, keeping evidence and counterevidence side by side and producing a revisable personal operating manual. Built around explicit sourcing rather than vibes.

researchprofilingevidenceskill
by hraness Sep 11, 2026 5/10
skill Reddit

cstack: Cursor's pstack Skills Ported to Claude Code

A port of Lauren Tan's pstack skills from Cursor to Claude Code, installable as a plugin marketplace. Includes unslop, which strips AI tells out of prose (em dashes, "not just X but Y", puffery), plus deslop pulled in from cursor-team-kit to do the same for code.

skillsportcursorwriting
by ivanrgazquez Sep 11, 2026 7/10
skill GitHub

sugra-api-skills: 1,500+ Sugra API Endpoints as Agent Skills

Official Sugra API skills covering 1,500+ endpoints across 36 domains behind a single response envelope, available over HTTPS or MCP. Packaged for Claude, Grok, Codex, Cursor, Gemini and ChatGPT.

apiskillsmcpintegration
by Sugra-Systems Sep 11, 2026 5/10
skill GitHub

tldr: Make Coding Agents Lead With a Three-Line Summary

A skill that forces Claude Code and 13 other agents to open with a three-line TL;DR and fold the detail below instead of burying the answer mid-response. Cuts subagent and tool-output tokens on the principle of demote, don't delete — nothing is lost, it is just moved out of the way.

output-styletokensskillsubagents
by SurefireStudios Sep 11, 2026 6/10
skill GitHub

codebase-map: Map an Unfamiliar Repo Into Contributable Docs

An Agent Skill that turns a repository you have never seen into something you can contribute to: it maps the architecture, traces real execution flows, and writes the result to docs/codebase-map/ so the work is reusable rather than trapped in one session.

onboardingdocumentationarchitectureskill
by rdilruba Sep 11, 2026 6/10
skill GitHub

agent-skill: Senior Engineering Standards and a Log for AI Agents

A skill encoding senior-level engineering standards for AI coding agents, paired with an engineering log so decisions and their rationale accumulate across sessions instead of evaporating.

standardsengineering-logskillquality
by bikash-20 Sep 11, 2026 5/10
skill GitHub

claude-spring-architect: Keep AI-Written Spring Boot On-Architecture

Generates Spring Boot projects preconfigured for AI-assisted coding, shipping Claude Code skills, agents and hooks that enforce DDD boundaries, dependency direction and naming across domain, persistence, REST, messaging and tests.

spring-bootdddarchitecturehooks
by ice-lfernandes Sep 11, 2026 6/10
skill GitHub

research-writing-kit: Verified-Citation Papers and Grant Proposals

A method plus self-installing Claude Code toolkit for research papers and grant proposals: argument skeleton first, citations verified, scans for retractions and uncited claims, document regression tests and submission checks. Code MIT, method CC BY 4.0.

academiccitationswritingtoolkit
by chenweichiang Sep 11, 2026 6/10
skill GitHub

seo-preflight: Keyword Research and an Audit That Gates Bad Posts

Claude Code skills for SEO content: DataForSEO keyword research, one post format rendered to either WordPress or Next.js, and an on-page audit that blocks broken posts from shipping.

seocontentwordpressaudit
by christian259200 Sep 11, 2026 5/10
skill GitHub

plan-a-trip: Flights, Hotels and Logistics Into One Itinerary

An agent skill that plans an entire trip — flights, hotels and ground logistics — into a single total-cost itinerary, powered by the Apify Google Flights and Google Hotels scrapers.

travelskillapifyplanning
by johnisanerd Sep 11, 2026 5/10
skill GitHub

consilium-principis: An AI Advisory Board With Word-for-Word Quotes

A Claude Code skill plus MCP server that convenes an advisory board of historical figures and verifies every quote word-for-word against public-domain sources, abstaining when it cannot. Fail-closed fidelity instead of plausible-sounding attribution.

mcpskillcitationsverification
by ilyautov Sep 11, 2026 6/10
skill GitHub

fact-check-skill: A Six-Step Fact-Checking Routine as an Agent Skill

Compresses a journalism fact-checking handbook into a skill an agent can execute: a six-step process, a table of eight misinformation patterns, and quick-reference checks for images, video, geography and timestamps. Useful when you want an agent to verify claims methodically rather than guess. Documentation is in Chinese.

fact-checkingresearchverificationchinese
by shawn0818 Sep 11, 2026 5/10
skill GitHub

skills: A Curated Skills Hub With Automated Upstream Sync

A downstream aggregation of agent skills pulled from multiple upstream repositories and kept current by automated ingestion. Useful as a single install point if you would rather not track a dozen skill repos by hand.

skillsaggregationsync
by harshsinghmp Sep 11, 2026 5/10
skill GitHub

skill-auditor: Scan Skills for Prompt Injection Before Installing

A Claude Code skill that audits other skills for prompt injection, data exfiltration and privilege escalation before you install them. Given how much third-party skill code now runs with full tool access, this is the missing safety step in the install flow.

securityprompt-injectionskillsaudit
by ki-stuff Sep 11, 2026 8/10
skill GitHub

video-ai-analyzer: Transcribe and Summarize Videos From a Link

A skill that takes a video URL from Douyin, Bilibili, Xiaohongshu, Kuaishou and other platforms, downloads it, transcribes the audio — including Cantonese and other dialects — and strips filler words and repetition. Custom prompts then produce summaries, rewrites, pull-quotes or shot lists. Chinese-language docs.

videotranscriptioncontentchinese
by why20261 Sep 11, 2026 5/10
skill GitHub

meta-capi-skills: Diagnose Meta Conversions API Measurement Problems

Claude Code skills for debugging a Meta Conversions API integration after it is live — event deduplication, match quality, event taxonomy, and reconciling reported conversions against actual revenue. Narrow, but exactly the part that usually breaks.

marketinganalyticsmeta-capidebugging
by MadalaVijay Sep 11, 2026 5/10
skill GitHub

pxwebapi-skills: Query Statistics Norway and Other PxWeb APIs

Claude skills for PxWebAPI v1 and v2, aimed primarily at Statistics Norway (SSB), with Jupyter notebooks and JavaScript examples. Useful to anyone pulling official statistics from a PxWeb-backed agency.

statisticsapinorwaydata
by janbrus Sep 11, 2026 5/10
skill GitHub

gongwen-skill: Chinese Official Documents With Layout Verification

A SKILL.md pack for producing GB-standard Chinese government-style documents: docx generation, WPS PDF export, and coordinate-level verification that the rendered layout matches the standard. Claims compatibility across 70+ agents.

documentsdocxchineseformatting
by mazihua-lgtm Sep 11, 2026 5/10
skill GitHub

Tony-Claude-Code-Skills: 320+ Skills, 9 Agents and 39 Commands

A large curated bundle of Claude Code skills, subagents and slash commands with sanitized configs and a Codex bridge, auto-indexed from the skills directory. Worth browsing for ideas even if you install none of it.

skillscollectionsubagentscommands
by shengdabai Sep 11, 2026 6/10
skill GitHub

retro-skill: Turn Session Friction Into Memories, Rules and Skill PRs

Reviews an agent session for friction points, then routes each learning to where it belongs — user memory, project rules, a pull request against a skill, a checkpoint, or a harness artifact. Closes the loop between 'that went badly' and a durable fix.

retrospectivememoryself-improvementskills
by netresearch Sep 11, 2026 7/10
skill GitHub

agent-skills: Run Codex as a Claude Code Subagent With Scoped Rights

Invokes Codex as a subagent from Claude Code with permissions declared per call — read-only analysis, or write-and-test confined to a git worktree — and returns an exit code reflecting what actually ran rather than what was requested.

codexsubagentsworktreepermissions
by Nowely Sep 11, 2026 7/10
skill GitHub

frontend-studio: Frontends That Don't Look AI-Generated

A Claude skill for producing distinctive, production-grade frontend interfaces, aimed squarely at the sameness of default agent-generated UI. Worth a look if every project you ship comes out looking like the same purple gradient.

frontenddesignuiskills
by czarnikrobert Sep 11, 2026 7/10
skill GitHub

liquid-glass-claude-skill: Glassmorphism With Real Contrast Rules

A SKILL.md for Liquid Glass and glassmorphism UI work, covering Apple's layering model, material tiers, accessible contrast ratios, and fallbacks for web, SwiftUI and mobile. The accessibility and fallback coverage is what separates it from a pile of CSS snippets.

uidesignglassmorphismaccessibility
by Armitanemati Sep 11, 2026 6/10
skill GitHub

stop-slop-ru: A Russian Port of the stop-slop Anti-Slop Skill

Strips bureaucratic phrasing, filler openers and other tells of machine-written Russian text. A language-specific port of stop-slop, since the giveaways differ per language.

writinganti-sloprussianediting
by chipizubovdima Sep 11, 2026 5/10
skill GitHub

ios-architecture-skills: Choose, Audit and Migrate iOS Architectures

A Claude Code and Codex agent plus skills for picking an iOS app architecture, auditing an existing one, and running a refactor or migration between them. Opinionated guidance where agents usually default to whatever they saw most in training.

iosarchitecturerefactoringswift
by kbelasheuski Sep 11, 2026 6/10
skill GitHub

dev-skills: 23 Skills Behind a 13-Phase Development Orchestrator

A full development-lifecycle skill library where a single orchestrator, dev-master, drives thirteen phases from an SRS as source of truth through design, implementation, testing, release audit and shipping. Installs on Claude Code, Codex and Cursor. Chinese-language docs.

sdlcorchestrationskillschinese
by iDWong Sep 11, 2026 6/10
skill GitHub

qa-buddy-skills: A QA Partner Skill Set That Tests and Logs Evidence

A bundle of skills that turns an agent into a QA partner: it plans a test pass, runs it, verifies the results, and keeps evidence logs it learns from on later runs. Project knowledge is compiled by an accompanying context tool rather than re-read from scratch each session. For teams who want repeatable, auditable QA instead of one-off 'does it work?' checks.

qatestingskillsverification
by TimothyHan Sep 11, 2026 7/10
skill GitHub

conthunt-cli: Social Content Research as an Agent Skill

Packages ContHunt as an agent skill alongside its official CLI, letting a coding agent search and pull social content as research mid-session. The skill wraps the CLI so Claude Code calls it directly instead of you pasting links in. Useful when an agent needs to gather what people are actually saying about a topic before it writes.

researchskillclisocial
by Synthenova Sep 11, 2026 6/10
skill GitHub

agent-config: Portable Instructions, Skills and a WezTerm Session Fleet

One repo of shared agent configuration spanning Claude Code, Codex and Grok: portable instruction files and skills, specialist review agents, and launchers that keep multiple accounts safely separated. It also manages a fleet of WezTerm sessions and makes transcripts durable so work survives a closed pane. A useful reference if you run several agents across several accounts.

configdotfilesmulti-agentwezterm
by kauffj Sep 11, 2026 7/10
skill GitHub

dsh-skills-anywhere: Use Any Agent's Skill Directory from One Provider

A live Agent Skills provider for DeepSeek Harness that reads skills in place from wherever they already live — Claude Code, Codex, Cursor and 60+ other agents' skill directories, Claude Code plugin marketplaces, and arbitrary GitHub skill repos. No copying and no symlinks, so edits to a skill take effect immediately. Useful if you maintain one skill library across several agent tools.

skillsagent-skillsplugin-marketplaceinterop
by noteflowai Sep 11, 2026 6/10
skill GitHub

xiaohongshu-trends-insights: Trend Analysis Skill for Xiaohongshu

A Chinese-language skill for researching trends on Xiaohongshu (RED): spotting hot topics, summarizing trend signals, and deciding content direction. Aimed at content operators, brand researchers and creators rather than developers. Narrow in audience, but a clean example of a domain research skill.

skillxiaohongshutrendscontent-marketingchinese
by why20261 Sep 11, 2026 5/10
skill GitHub

velo-coach-skills: Cycling Coach Skills That Sync intervals.icu Data

A skill pack that turns Claude Code into a cycling coach by syncing training data from intervals.icu. It produces workout plans, post-ride reviews, recovery guidance, and race strategy. A good example of wiring a personal-data API into a domain skill set.

skillscyclingintervals-icutrainingdomain-skills
by Monikas1149 Sep 11, 2026 5/10
skill GitHub

underwriter-os: One-Paste Claude Setup for Real-Estate Underwriting

A Claude configuration that turns the assistant into a research and underwriting teammate for institutional real-estate and multifamily teams. Installs by pasting a single setup block, MIT licensed. A clean example of packaging a vertical finance workflow as a drop-in Claude setup.

real-estateunderwritingfinanceverticalmit
by Fusion-Data-Company Sep 11, 2026 5/10
skill GitHub

odoo-skills: Addon Reviews, OCA Migrations, and OWL Frontend Automation

A skill pack covering common Odoo development chores: reviewing addons, performing OCA version migrations, writing tests, and making OWL frontend changes. Encodes Odoo conventions so the agent doesn't have to rediscover them each session. Practical for shops maintaining many Odoo modules.

odooerpmigrationstestingskills
by Immoderate-humulin783 Sep 11, 2026 6/10
skill GitHub

vitruvian-design: Countable Apple-Grade Design Rules for Your Agent

Design discipline skills for Claude Code that state rules an agent can actually count and check — spacing, sizing, hierarchy — rather than vague aesthetic advice. Aimed at getting consistent, Apple-grade UI output from agents. Good complement to a component library.

designuiskillsdesign-systemfrontend
by shumatsumonobu Sep 11, 2026 6/10
skill GitHub

3dviz-pro-max: Turn an Idea Into a Three.js or Blender Scene

An agent skill for creative 3D visualization, shipping as a Claude Code and Codex plugin. It bundles 223 recipes, 440 knowledge records, 22 proven kits, and 37 runnable studies so the agent has concrete patterns rather than guessing at Three.js or Blender APIs. One of the more heavily researched skill packs around.

3dthreejsblendervisualizationpluginskills
by viettranx Sep 11, 2026 7/10
skill GitHub

Monozukuri: A Craftsmanship Skill for Simple, Verifiable Code

An AI coding skill that applies Japanese monozukuri craftsmanship principles to software: build things that are simple, correct, verifiable, and maintainable. It gives the agent an explicit quality bar to check its own work against rather than optimizing for speed. A counterweight to output-volume-oriented prompting.

skillscode-qualitycraftsmanshipmaintainabilityreview
by kuya-egg Sep 11, 2026 6/10
skill GitHub

power-app-yaml: Convert Mockups and Screenshots Into Power Apps Canvas YAML

A Claude skill that takes HTML/CSS mockups, Figma exports, or plain UI screenshots and emits paste-ready Power Apps Canvas YAML (.pa.yaml v3.0). Removes the manual translation step between design and the Power Apps editor. Valuable if you build on the Microsoft low-code stack.

power-appslow-codefigmayamlmicrosoftskills
by YKUNAKORN Sep 11, 2026 6/10
skill GitHub

kmp-agent-skills: Kotlin Multiplatform Skills for Architecture and Scaffolding

Agent skills covering Kotlin Multiplatform development end to end: clean architecture, feature scaffolding, Compose UI, MVI state management, navigation, networking, and testing. Gives the agent KMP-specific conventions instead of generic Kotlin advice. Worth comparing against other KMP skill packs before picking one.

kotlinkmpcomposemvimobileskills
by ronjunevaldoz Sep 11, 2026 6/10
skill GitHub

dashkit: One-Command Agentic Power BI Stack Across Five Agents

Installs a complete Power BI agent setup — Microsoft's official skills plus data-goblin's guardrails — into Claude Code, Copilot, Cursor, Codex, or Gemini with a single command. Works on Windows, macOS, and Linux. Saves assembling the BI toolchain by hand for each agent.

power-biinstallerskillsguardrailscross-agent
by Leonsang Sep 11, 2026 6/10
skill GitHub

invoice-auditor: Invoice Extraction That Proves Its Own Arithmetic

A Claude skill where the model extracts invoice data and deterministic code then audits the arithmetic, so extraction errors are caught rather than trusted. Reports 0 false positives across 76 real invoices, and the audit pass found 2 mislabeled records in a public training dataset. A strong template for the extract-then-verify pattern in document work.

invoicesextractionverificationdocumentsskills
by Jessmatth Sep 11, 2026 7/10
skill GitHub

eu-mdr-skills: EU Medical Device Rules That Say Where They Stop

Agent skills for EU medical device regulation that are statute-pinned to specific legal text, ablation-measured, and source-verified. Notably, they define their own scope boundaries so the agent declines rather than improvising on regulatory questions it can't ground. A model for building trustworthy skills in high-stakes compliance domains.

complianceregulationmedicaleu-mdrskillsgrounding
by Ecgecer Sep 11, 2026 6/10
skill GitHub

dsh-control: Let Agents Drive DeepSeek Harness Sessions

A community skill that lets AI agents operate DeepSeek Harness — workspace and session control, task cards, and multi-model fanout review. Enables cross-harness orchestration where Claude Code drives DSH work. Not an official DeepSeek project.

dshdeepseekorchestrationcross-agentskills
by jacjackai Sep 11, 2026 5/10
skill GitHub

precedent: A skill that surfaces your past architectural decisions

A Claude Code skill that records architectural and business decisions across all your projects and resurfaces them as precedent when a comparable choice comes up again. Aims to stop the agent from re-litigating settled questions differently in each repo. Effectively an ADR log the agent actually reads.

memoryarchitecturedecisionsadrcross-project
by asm0dey Sep 10, 2026 7/10
skill GitHub

companion-skill: Keep an assistant persona out of always-loaded rules

A template for splitting an assistant's persona and background dossiers out of the always-loaded CLAUDE.md rules and into a skill that loads on demand. The pitch is "who we are" versus "what to do", so identity material stops eating context on every turn. Useful pattern if your rules file has grown into a grab bag.

personacontextclaude-mdtemplate
by rokokol Sep 10, 2026 5/10
skill GitHub

nano-banana-advogados: Law-firm brand image skill via the Gemini API

A copy-paste prompt that installs a skill in Claude Code or Cowork for generating images in a law firm's visual identity through Google's official Gemini API. Portuguese-language and squarely aimed at Brazilian legal practices. Narrow audience, but a clean example of packaging a branded image pipeline as an installable skill.

image-generationgeminilegalbrandingportuguese
by legalworkshop Sep 10, 2026 5/10
skill GitHub

gpt-image-2-skill: GPT Image 2 generation and editing from Claude Code

A free MIT skill for generating and editing images with OpenAI's GPT Image 2 from inside Claude Code or Codex, with 21 style presets, per-platform sizing, carousels and photo edits. Drafts cost about $0.006 each so you iterate cheap and only pay full price for the render you approve. Requires an OpenAI API key.

image-generationopenaigpt-imagedesignskill
by dbhq-uk Sep 10, 2026 7/10
skill GitHub

ai-toolkit: Portable Agent Skills for Claude Code, Codex, and Copilot

A set of reusable agent skills and project baselines that install across Claude Code, Codex, and Copilot. Ships deterministic install and verify tooling so the same skill set can be reproduced on a new machine or checked for drift.

skillscross-platformcodexcopilottooling
by justinmchoi Sep 10, 2026 6/10
skill GitHub

mobiscroll-marketplace: Mobiscroll Component Skills for Claude Code and Codex

A vendor plugin marketplace publishing Mobiscroll agent skills, covering the UI component library and the Connect calendar API. Gives the agent first-party API knowledge instead of relying on whatever it remembers about the framework.

marketplaceskillsui-componentsmobiscroll
by acidb Sep 10, 2026 5/10
skill GitHub

claude-code-minoan: A Curated ~/.claude Config with 90+ Skills and 46 Hooks

A full personal Claude Code configuration published as a reference setup: over 90 skills, 46 hooks, and supporting CLI tools wired together for professional development workflows. Worth reading as a worked example even if you only adopt pieces of it.

configurationskillshooksdotfiles
by tdimino Sep 10, 2026 7/10
skill GitHub

repeatable-dev-envs-plus: Claude Code Skill for Flox Dev Environments

A free skill that lets Claude Code set up Flox-based development environments with pinned tool versions and local services on macOS and Linux. Built on affaan-m/ECC, aimed at making an environment reproducible rather than machine-specific.

floxdev-environmentreproducibilityskill
by agenticluke Sep 10, 2026 6/10
skill GitHub

sublimecoding: Senior-Engineer Prompt Packs Plus the AIOS Markdown Memory System

A free collection of Claude Code and Cursor prompts aimed at experienced engineers — code review, debugging, plus CLAUDE.md and .cursorrules templates. Bundled with AIOS, an open-source markdown-based memory system for coding agents.

promptsclaude-mdmemorycode-reviewcursor
by sublimecoder Sep 10, 2026 6/10
skill GitHub

dev-workflow-skills: Plan, Build, Critique, Govern, Prune as Five Skills

A Spanish-language skill set spanning the full lifecycle of a digital project: planning, building, critiquing the interface, governance, and pruning. Works with Claude Code, Codex, and other compatible agents.

skillslifecyclespanishgovernanceui-review
by bfernandois059 Sep 10, 2026 6/10
skill GitHub

fableforge-agent-skills: Agent Skills for Game Dev, Visual Assets, and Ops

An independent collection of agent skills covering game development, visual asset production, operations, and content workflows. A useful reference if you want skills outside the usual web and backend engineering territory.

skillsgame-developmentassetscontent
by Fable-Forge Sep 10, 2026 6/10
skill GitHub

ascend-assistant: Agent Skill for Operating Huawei Ascend AI Servers

An agent skill for working with Huawei Ascend compute servers: environment checks, troubleshooting, command generation, deployment guidance, and performance tuning. Cross-references the AscendMate manual so answers cite the vendor documentation.

ascendhuaweitroubleshootinginfrastructurechinese
by RevolutionLA Sep 10, 2026 5/10
skill GitHub

adversarial-review (RevolutionLA): Blue Team, Third-Party Audit, Neutral Verdict

A structured three-role adversarial code review skill: a hostile blue-team pass, an independent third-party audit, then a neutral adjudication that resolves the two. Gives AI coding agents a closed review loop instead of a single self-assessing pass.

code-reviewadversarialmulti-agentquality-gatechinese
by RevolutionLA Sep 10, 2026 7/10
skill GitHub

learn-likecc: Claude Code Source Recovered from Source Maps, Plus a Course

A reverse-engineering project that reconstructs Claude Code's shipped bundle from its source maps into 1900+ files and roughly 510k lines, along with a runnable build. It ships a 12-chapter course walking through the architecture it found. Written in Chinese; of interest to anyone curious how the CLI is actually put together.

reverse-engineeringarchitectureinternalschinese
by Harzva Sep 10, 2026 6/10
skill GitHub

antigravity-skill-converter: Transpile Any Agent Skill to Google Antigravity

A skill whose job is converting other skills: hand it something written for Claude Code, Copilot CLI, Amp, Cursor or Cline and it rewrites it into Antigravity's format. Positioned as a universal transpiler rather than a one-way port. Handy if you maintain a skill library and a second agent host just entered the picture.

skillsantigravityportabilityconverter
by shaashiekumha Sep 10, 2026 6/10
skill GitHub

learn-skill: Turn Claude Code into a Daily Tutor with a Persistent Notebook

A skill that researches a curriculum for whatever you want to learn, then runs roughly 30-minute intuition-first sessions against it. It keeps a notebook of what actually clicked, so later sessions build on your real understanding rather than restarting cold. A study-habit tool rather than a coding tool.

learningtutorcurriculumnotes
by derwells Sep 10, 2026 6/10
skill GitHub

blind-spot-hunt: Adversarial Pass for Business Logic No Checklist Covers

A hypothesis-driven audit skill that goes looking for exploitable business-logic flaws instead of walking a fixed vulnerability checklist. It forms guesses about how the domain could be abused and then tries to confirm them. Complements, rather than replaces, standard static analysis.

securityauditbusiness-logicadversarial
by chaoticravena Sep 10, 2026 6/10
skill GitHub

university-teacher-skills: 22 Skills for Teaching, Research and Admin

A Chinese-language skill pack covering university faculty work: teaching prep, research, student supervision, administrative tasks and assessment. It includes a custom Office output layer that produces native Word comments, courseware and grade analyses. Works with Claude Code, Codex and other Agent Skills clients.

educationofficechineseacademia
by EtherealMingo Sep 10, 2026 6/10
skill GitHub

agent-skills-kit: Workflow Skills and Routing for Coding Agents

A collection of workflow-oriented skills plus routing logic that decides which one applies to a given request. Positioned as shared infrastructure across coding agents rather than a single-purpose skill. Documentation is thin, so expect to read the repo to see what the routing actually does.

skillsroutingworkflow
by MarkBovee Sep 10, 2026 5/10
skill GitHub

crawlora-skills: Structured Public Web Data as Installable Agent Skills

Skills that pull structured data from search, e-commerce, social, finance, app stores, media and reviews through the Crawlora REST API. Installs via the skills CLI or as a Claude Code plugin marketplace. Requires a Crawlora account, so it is a paid-service wrapper rather than a standalone scraper.

web-datascrapingapimarketplace
by Crawlora-org Sep 10, 2026 6/10
skill GitHub

sortic-ip-sentinel-free: Flag IP-Sensitive Moments Before You Demo

Detects points in a session where intellectual-property exposure is a risk and returns show/hold maps, demo hygiene guidance, AI contribution logs and a staged disclosure plan. Portable across Codex, Claude and Grok via agentskills.io. Explicitly not legal advice.

ipcompliancedisclosureportable
by Reghnam Sep 10, 2026 5/10
skill GitHub

chrono-pm-skill: Markdown-Driven PMO with Human Confirmation Gates

A project-management skill covering requirements, risks, milestones, costs and daily/weekly reporting, all stored as markdown. The AI drafts and tracks, but state changes require human confirmation. Aimed at PMP-style rigor without a SaaS project tool.

project-managementmarkdownreportingpmo
by qiusuo0226 Sep 10, 2026 6/10
skill GitHub

vibe-skill: Lifecycle Skills for Planning, Building, Reviewing and Shipping

A set of vibe-* skills, each one a structured instruction set for a specific moment in a project: plan it, build it, review it, test it, deploy it, hand it off. The value is coverage of the whole arc rather than any single skill. Read the individual skill files before adopting the whole set.

skillslifecycleplanningreviewdeploy
by aakashdhar Sep 10, 2026 6/10
skill GitHub

survey-digitizer: Photos of Handwritten Forms to Validated Excel

Takes photographs of paper surveys and forms and produces a validated Excel file, embedding the cropped image fragment next to any answer it was unsure about. That fragment-next-to-doubt design makes human verification cheap instead of forcing a full re-check. A genuinely well-shaped use of vision in a skill.

ocrformsexcelvisiondata-entry
by nadirbekpulatov-cyber Sep 10, 2026 7/10
skill GitHub

ai-html-annotation: Build, Annotate and Iterate Real DOM UI with an Agent

A prototyping toolkit and Agent Skill for working on actual HTML rather than mockups: build a page, annotate it, review, screenshot and iterate. Works with Claude Code, Codex and Cursor. The annotation layer is what lets you point at a region and describe the change you want.

htmlprototypinguiannotationscreenshots
by Lisuiwen Sep 10, 2026 6/10
skill GitHub

chudarin-figma-skills: Field-Tested Figma Skills for Claude Code and Codex

Covers Figma Plugin API gotchas, design process, design-system audits, variable repair and flow planning. Described as field-tested rather than generated, and the Plugin API notes in particular are the kind of thing that saves hours. Useful if your agent work touches Figma files.

figmadesign-systemsplugin-apiaudit
by schudarin Sep 10, 2026 6/10
skill GitHub

agent-html: Single-File, Offline HTML Design System for LLM Output

A zero-dependency HTML design system inspired by shadcn/ui, delivered as one file with no npm step, plus an agent skill that drives it. Ships six layout archetypes and an atomic utility set. Solves the problem of agent-generated HTML looking like unstyled markup without dragging in a build toolchain.

htmldesign-systemofflineshadcnzero-dependency
by QingYunA Sep 10, 2026 6/10
skill GitHub

scoville-handoff: Transfer the Work State, Not the Whole Conversation

A handoff skill that extracts what the next session actually needs — current state, decisions, open threads — instead of dumping the transcript. Keeps continuity across compaction and restarts without burning context on history. Simple idea, executed narrowly.

handoffcontextstatesessions
by benjaminstelzer Sep 10, 2026 6/10
skill GitHub

claude-code-handbook-ru: Russian-Language Claude Code Handbook

A curated handbook covering hooks, skills, CLAUDE.md templates, MCP servers and worked cases, written in Russian. Fills a real gap — most Claude Code documentation of this depth is English or Chinese only. Maintained rather than a one-off dump.

documentationrussianhooksskillsmcp
by sfrangulov Sep 10, 2026 6/10
skill GitHub

claude-toolbox: A Full Personal ~/.claude Config with TDD Review Tiers

One developer's complete Claude Code setup: 33 skills, 16 slash commands, 13 review agents, 8 hooks and MCP wiring, organized around a TDD plus multi-tier-review workflow. Worth reading as a reference for how the pieces compose, even if you cherry-pick. The review-agent tiering is the distinctive part.

configskillshookstddreview
by louisdijkstra Sep 10, 2026 6/10
skill GitHub

github-readme-writer: Reads Every File Before It Writes a Word

A skill that inventories the whole repository first, then writes a README containing real commands and real output — and only the sections that repository actually needs. Ships a file inventory script and a README linter alongside. Directly targets the generic, half-invented README that agents usually produce.

readmedocumentationlintergithub
by rishabhrawat35 Sep 10, 2026 7/10
skill GitHub

open-research-skills: Ten Skills from Topic Selection to Reproducible Release

Independently installable research skills covering scientific figures, conference and journal manuscripts, funding proposals, iterating a method toward SOTA, cold review, and code/data artifact release. Chinese and English. Broad coverage of the academic pipeline rather than a single writing helper.

researchacademiawritingfiguresreproducibility
by gxCaesar Sep 10, 2026 6/10
skill GitHub

small-business-ru: 34 Skills for Russian Small Business Accounting

Covers simplified-tax calculations, cash flow and counterparty verification by INN, pulling from real government registries. Numbers are computed in code rather than generated by the model, which matters for anything tax-adjacent. Narrow jurisdiction, but a good pattern for compute-not-guess skill design.

businesstaxrussiaregistries
by ilyautov Sep 10, 2026 5/10
skill GitHub

yzfly/skills: One-Line Install Agent Skills for 17+ Agent Tools

A unified skills repository including a CTO skill that turns an idea into an executable software design over one conversation, among others. Installs with a single command and targets Claude Code, Cursor, Cline and a dozen-plus other hosts. Chinese-language, actively maintained.

skillschineseinstallmulti-host
by yzfly Sep 10, 2026 6/10
skill GitHub

claude-amit-mizrachi: Skills for Handing Off and Running Overnight

Three skills for unattended work: next-prompt hands a session off, night-sprint takes a feature through the night and lands it as one PR, and mywayfinder charts a map of the work. Includes a sliding 8-hour macOS caffeinate hook so the machine stays awake. Practical set for long autonomous runs.

unattendedhandoffovernightmacoshooks
by amit-mizrachi Sep 10, 2026 6/10
skill GitHub

match-reference: Measure the Gap to a Reference Image and Fix It Per Region

Compares a rendered frontend against a reference image and returns an actionable per-region fix list: category, perceptual colour delta, the offending DOM element and CSS, and a fix hypothesis. Includes image strips, SSIM scoring and a convergence verdict so you know when to stop iterating. Far more rigorous than 'make it look like this screenshot'.

frontendpixel-perfectssimcssvision
by Filtar2000 Sep 10, 2026 8/10
skill GitHub

organic-search-operator: Evidence-Led SEO and GEO Skill with GSC and IndexNow

An SEO and generative-engine-optimization skill that works from Search Console data and pushes updates through IndexNow, structured for recurring rather than one-shot growth work. Runs under Codex or Claude Code. The evidence-led framing means it works from your actual search data instead of generic advice.

seogeosearch-consoleindexnow
by amanmaqsood Sep 10, 2026 5/10
skill GitHub

billing-truth-plus: Proof-First Billing and Revenue Checks as a Skill

A Claude Code skill for auditing revenue, pricing, refund, and team billing questions with a proof-first approach — every answer is expected to cite the underlying record rather than be asserted. Built on the affaan-m/ECC skill base. Narrow in scope but a good template for making an agent show its work on financial data.

billingrevenueauditskill
by agenticluke Sep 10, 2026 5/10
skill GitHub

ClaudeMarketplace: Community Collection of Custom Claude Code Skills

A community-driven repository of custom skills for Claude Code, collected in one place for browsing and installation. Open to contributions rather than curated by a single author. One of many skill marketplaces, but worth a look if you are shopping for ready-made skills.

skillsmarketplacecommunity
by RealDougEubanks Sep 10, 2026 5/10
skill GitHub

dotdesign: Countable Design-Discipline Rules as Claude Code Skills

A set of Claude Code skills encoding Apple-style design discipline as rules an agent can actually check — spacing, hierarchy, and layout constraints expressed numerically rather than as taste. Aimed at stopping agents from producing generic-looking UI. Useful if your agent writes frontend code that keeps drifting off-system.

designuiskillsfrontend
by shumatsumonobu Sep 10, 2026 6/10
skill GitHub

flox-dev-environments-plus: Repeatable Flox Dev Environments Skill

A free Claude Code skill for creating and repairing reproducible Flox development environments on macOS and Linux. Built on the affaan-m/ECC skill base. Useful if you use Flox and want the agent to handle environment drift instead of you.

floxdev-environmentreproducibilityskill
by agenticluke Sep 10, 2026 5/10
skill GitHub

gesh75/claude-skills: A Curated 123-Skill Personal Library, Kept Lean

A personal ~/.claude/skills library of 123 on-demand skills built around progressive disclosure, so each skill loads detail only when needed. The author audits and prunes it with a "skill-stocktake" process rather than letting the collection sprawl. Worth browsing both for individual skills and for the maintenance approach to a large skill set.

skillsprogressive-disclosurecollectiondotfiles
by gesh75 Sep 10, 2026 6/10
skill GitHub

ultraindex: Turn a Whole Repo Into an AI-Navigable Encyclopedia

Indexes code and docs into a navigable encyclopedia — a repo map, per-module entries, and a typed link graph — so an agent can work in a huge codebase without loading it all into context. Ships as a single auto-routing skill with grounded, citation-checked analysis. Optional local semantic search runs through Ollama.

context-managementcodebase-indexskillollamasemantic-search
by maxgfr Sep 10, 2026 8/10
skill GitHub

fal-media-maker-plus: Generate Images, Video, Speech and Music via fal.ai

A Claude Code skill that wraps fal.ai so you can produce images, video, speech, music, and sound effects from a session. Built on affaan-m/ECC and extended with additional models and options. Handy for adding media generation to a project without wiring up the API yourself.

skillfal-aimedia-generationimagesaudio
by agenticluke Sep 10, 2026 6/10
skill GitHub

book-translator: Turn an EPUB Into a Bilingual Traditional Chinese Edition

A Claude Code skill that translates literary EPUBs into bilingual zh-TW editions, keeping the original text alongside the translation. It is aimed at literary prose rather than technical docs, so it preserves structure and voice across the book. A clear worked example of a skill handling a long, multi-chapter document pipeline.

skilltranslationepubchinesedocuments
by fredchu Sep 10, 2026 6/10
skill Reddit

CLAUDE.md Design Principles Section That Curbs Agent Over-Engineering

A shared CLAUDE.md block aimed at three habits coding agents fall into unprompted: writing a duplicate of a function that already exists, solving problems outside the ticket, and narrating every diff line in comments. Covers DRY, single source of truth, YAGNI, KISS and comment policy, with a few Python/Pydantic-specific bullets. The thread collects other people's equivalent paragraphs.

claude-mdprompt-engineeringcode-qualitypython
by EvalRaccoonDev Sep 9, 2026 6/10
skill GitHub

rpa-skills: Agent Skills Marketplace for RPA, Formal Logic and MikroTik Configs

Skill collection installable in Claude Code, Codex and Cursor covering an RPA BDD workflow, a Logika formal-logic skill based on Chelpanov, token-cost accounting, and a MikroTik router config generator. Niche mix, but the RPA and network-config skills are hard to find packaged elsewhere.

skillsrpanetworkingmarketplace
by EvilFreelancer Sep 9, 2026 5/10
skill GitHub

game-skills-for-agents: Skills That Let an Agent Find, Join and Play Real Games

One SKILL.md per game, giving an AI agent the protocol for finding a table, joining, and actually playing against other participants. Starts with live Texas Hold'em poker. An unusual demonstration of skills as a way to teach an agent an external interactive system rather than a dev task.

skillsgamespokeragents
by appleweed Sep 9, 2026 6/10
skill GitHub

zyun_community: Agent Skills for New-Media Operations and Content Analytics

Chinese-language skill pack for social/new-media operators covering content production and data analysis, installable into Claude Code, OpenClaw, Cursor or any skills-capable agent. Useful example of skills applied to marketing operations rather than software.

skillsmarketinganalyticschinese
by Kaorixsol Sep 9, 2026 5/10
skill GitHub

agent-harness-plugins: Cross-Agent Commands, Hooks and Skills

One repo of a developer's harness configuration kept portable across three agents. Contains slash commands, hooks and skills meant to be cherry-picked rather than installed wholesale. Handy reference if you are assembling your own cross-agent setup.

skillshookscommandsdotfiles
by cboone Sep 9, 2026 5/10
skill GitHub

pm-skills: 52 Product-Manager Skills Across a 13-Stage Lifecycle

Chinese-language product-management skill library organized as 52 skills and 9 plugins mapped onto a single 13-stage process, from discovery through launch. Installs into Claude Code, Codex or Cursor. One of the more structured non-engineering skill sets published so far.

skillsproduct-managementpluginschinese
by iDWong Sep 9, 2026 6/10
skill GitHub

vaayu: Production-Grade Skills for AI and AI Coding Agents

Skill collection organized around four jobs — evaluating models and outputs, building, scaling, and compressing context. Targets agents being run in production rather than casual local use.

skillsevaluationproductioncontext
by okyashgajjar Sep 9, 2026 5/10
skill GitHub

webmcpify: Make Any Web App Agent-Ready and Verify It in a Real Browser

Agent skill that walks a web app through WebMCP adoption end to end: inventory what the app exposes, integrate the interface, verify it by driving a real browser, then heal what fails. Runs under Claude Code, Codex, Cursor, opencode and Copilot.

webmcpskillsbrowserverification
by TueJon Sep 9, 2026 7/10
skill Reddit

Renaming CLAUDE.md to AGENTS.md Made Instruction-Following Worse

A user moved a working CLAUDE.md to AGENTS.md with a symlink back and reports Claude Code began ignoring rules it had previously followed, with a concrete formatting rule as the example. Relevant to anyone consolidating instruction files across agents; the comments weigh whether the symlink or the filename is the cause.

claude-mdagents-mdinstructionsdiscussion
by AllTalkie Sep 9, 2026 6/10
skill GitHub

agent-config: Claude Code Setup for Microsoft Fabric and Power BI on Windows

One developer's full harness — skills, subagents, hooks and rules — for data work in Microsoft Fabric and Power BI on Windows, published to cherry-pick from. Rare example of an agent configuration tuned to the Microsoft data stack.

skillshookspower-biwindows
by wardawgmalvicious Sep 9, 2026 5/10
skill GitHub

clawtube: YouTube Transcript and Playlist Extraction for Agents, No API Key

Agent skill that pulls transcripts and playlist contents from YouTube locally without requiring an API key, so an agent can summarize or mine video content directly. Works with Claude Code, OpenClaw/ClawdBot, Hermes Agent, Cursor and Codex.

skillsyoutubetranscriptslocal-first
by mehmetresitgul Sep 9, 2026 6/10
skill GitHub

reading-analysis: English Exam Reading Skill With a Distractor Taxonomy

Agent skill for Chinese English-exam prep (Gaokao, CET-4/6, Kaoyan) that maps question types, classifies distractors into ten categories, and draws on a 125-card methodology library to output fully annotated, explained passages. A detailed example of encoding domain pedagogy as a skill.

skillseducationexamschinese
by shenquan520 Sep 9, 2026 5/10
skill GitHub

agent-ops-plus: skill for running long-lived Claude Code agents

A Claude Code skill aimed at agents that run for a long time rather than one-off sessions, focused on safe updates, strict access boundaries, readable logs and fast recovery after failure. Built on top of affaan-m/ECC. Relevant if you run unattended or scheduled agent sessions.

skilllong-runningopsloggingrecovery
by agenticluke Sep 9, 2026 6/10
skill GitHub

agentic-creator-os: cross-harness skills, commands and agents pack

A collection of skills, slash commands, subagents and plugins packaged as a "creator operating system" for content and AI-native workflows. Targets several harnesses at once — Claude Code, Codex, Cursor, Grok and Antigravity Gemini — so the assets are written to be portable rather than Claude-specific.

skillscommandspluginsmulti-harness
by frankxai Sep 9, 2026 5/10
skill GitHub

solo-factory: 45 Skills, 3 Agents and a Sensor Harness for Solo Projects

A large Claude Code bundle of 45 skills and 3 agents covering research, planning, shipping and verification across 13 different stacks. The sensor harness gives the agent feedback signals so it can check its own work rather than declaring done. Aimed at solo developers who want a full pipeline instead of assembling skills one at a time.

skillsagentsharnesssolo-dev
by fortunto2 Sep 9, 2026 7/10
skill GitHub

VisionEngine Skills: Image, TTS, Voice Cloning, Subtitles and Video for Agents

A zero-dependency Python CLI exposed as agent skills for media production: image generation, text-to-speech, voice cloning, subtitles, video, digital humans and Remotion rendering. Lets an agent handle a whole media pipeline without pulling in a heavy toolchain. Documentation is bilingual Chinese/English.

mediattsvideoremotion
by vecai-dev Sep 9, 2026 6/10
skill GitHub

skill-a11y-audit: Accessibility Regression Evidence for Large Web Estates

An accessibility auditing skill built for big sites, using template-aware sampling so it checks representative pages instead of crawling everything. Accepted baselines let CI fail only on new regressions rather than the whole existing backlog. Produces evidence you can hand to a reviewer.

accessibilitya11yciaudit
by snapsynapse Sep 9, 2026 6/10
skill GitHub

spec-agent-skill: Markdown-First Planning That Writes Implementation Prompts

A planning skill that first builds project context, then routes each request through the relevant checks before writing an implementation prompt with scope, risks, tests and rollback notes. Everything lives in Markdown so the plan is reviewable and diffable. Works with any coding agent.

planningspecmarkdownprompts
by emanoeI Sep 9, 2026 6/10
skill GitHub

Publora Skills: Post and Schedule to 10 Social Platforms from Your Agent

Nine official skills that let Claude Code, Codex, Cursor or OpenClaw post and schedule to LinkedIn, X, Instagram, Threads, TikTok, YouTube, Facebook, Bluesky, Mastodon and Telegram through the Publora MCP server. Install with a single npx command. MIT licensed.

socialpublishingmcpscheduling
by publora Sep 9, 2026 6/10
skill GitHub

Clownware Plugins: A Claude Code Marketplace for Astro and Design-System Work

A plugin marketplace bundling Astro and general code tooling, a design system, and product development workflows. Installs as a Claude Code marketplace so you pick the pieces you want rather than cloning a monorepo. Handy if you work in the Astro ecosystem.

marketplaceastrodesign-systemplugins
by clownware Sep 9, 2026 5/10
skill GitHub

PsyLinks-360-Security: Secure-by-Default Guidance Plus a Python Scanner

Pairs security guidance for coding agents with a Python scanner that looks for secrets, misconfiguration, injection flaws, dependency issues and AI-agent-specific risks. The guidance shapes what the agent writes; the scanner catches what slips through. Runs locally.

securityscannersecretsstatic-analysis
by PsylinksSecurityWeb Sep 9, 2026 6/10
skill GitHub

solid-game-code: SOLID Principles Applied Pragmatically to Game Code

A Claude Code skill that applies SOLID principles to game code without the usual dogma, staying data-driven and aware of Unity, Unreal and Godot idioms. Recognizes that game code has different performance and architecture constraints than typical business software. Useful guardrail when an agent is refactoring gameplay systems.

gamessolidunityunrealgodot
by Jeffery-Liu Sep 9, 2026 6/10
skill GitHub

learning-video-skills: Turn Tutorial Videos Into Reproducible Documentation

Converts teaching videos into documents complete enough to follow without watching the video, using a local engine built on whisper transcription, OCR and indexing. Blind-test and verification gates check that the doc actually reproduces the result. The output can be distilled further into a callable agent skill.

videowhisperocrdocumentation
by vinsunfeng Sep 9, 2026 6/10
skill GitHub

ShareXtract: Protocol-First Extraction of Public Share Links

An agent skill that pulls content out of public share URLs — AI chat transcripts, social posts, media and open web pages — using a protocol-first approach rather than brittle scraping. Handy when you want an agent to read something someone linked you. Bilingual documentation.

extractionscrapingshare-linkscontent
by wuaishare Sep 9, 2026 5/10
skill GitHub

knowledge-asset-health-check: A Fully Local Audit of Enterprise Docs

An agent skill that assesses the health of a company's knowledge assets entirely locally, with no LLM call in the analysis path. Suits environments where internal documentation cannot be sent to a model. Chinese-language documentation.

knowledge-baseauditlocalenterprise
by s2dongman Sep 9, 2026 5/10
skill GitHub

ai-lesson-prep: University Course Prep From Timetable Screenshot to Slides

A skill pack that walks the whole lesson-prep chain for university teachers: timetable screenshot to teaching spreadsheet to lesson plan to lecture notes to slides with speaker notes, delivering xlsx, docx and pptx. Built for Claude Code and ZCode with deep adaptation to Chinese teaching conventions. MIT licensed.

educationdocumentspptxchinese
by ch1209498273 Sep 9, 2026 5/10
skill GitHub

Scalably Agent Skills: Production-Derived Agent Ops and SEO Ops

Two skill families extracted from production use: agent operations and SEO operations. Installable as Claude Code plugins and usable from Codex or any Agent Skills runtime. Worth a look if you run SEO work through an agent.

seooperationspluginsskills
by scalably-io Sep 9, 2026 5/10
skill GitHub

ultrapolish: Two Design-Polish Skills for iOS and Web Interfaces

Covers motion, colour, type, layout, sheets, haptics, sound, buttons, icons, copy, states, onboarding, paywalls, widgets and accessibility, split into a SwiftUI skill and a React/TypeScript/CSS one. Designed to raise an app's finish without imposing one house style. Works across Claude Code, Cursor, Codex, Windsurf, Aider, Continue and Zed.

designuiswiftuireactpolish
by heyimjames Sep 9, 2026 7/10
skill GitHub

DEC-aanbestedingen: A Claude Plugin for Dutch Public Tender Work

Fetches schedules and documents from TenderNed and Mercell, sharpens clarification questions, and converts tender documents to Markdown so an agent can work with them. A concrete example of packaging a domain-specific bureaucratic workflow as skills. Dutch-language.

tendersprocurementdutchdocuments
by martinwolve Sep 9, 2026 5/10
skill GitHub

deccansoft-claude-skills: Guided OpenClaw Deploy to Azure Container Apps

A Claude Code plugin that walks through deploying OpenClaw to Azure Container Apps with Telegram and LiteLLM, including a persistence wizard. Bakes in the Azure Files, BuildKit and IPv6 gotchas that usually cost you an afternoon. Narrow but saves real time if that is your stack.

azuredeploymentopenclawcontainers
by suresh-deccansoft Sep 9, 2026 5/10
skill GitHub

devils-advocate: One Cold Adversary Attacks Your Decision Before You Act

A Claude Code plugin that produces a kill shot, three ranked attacks, a probability that you are making a mistake, and a forced verdict on a decision. Deliberately simpler and harsher than multi-model council setups. Meant to be run before you commit to an approach, not after.

decision-makingadversarialreviewplanning
by hadicancatak-coder Sep 9, 2026 6/10
skill GitHub

claude-portfolio-management-skills: Stock and Portfolio Analysis Skills

A Claude Code plugin with stock analysis and portfolio management skills aimed at retail investors. Packages the research and tracking steps rather than making recommendations. Niche relative to coding work but a clean example of a domain skill pack.

financestocksportfolioanalysis
by from68 Sep 9, 2026 5/10
skill GitHub

naming-scout: Name Your Project, Then Prove the Name Is Actually Available

Generates candidate names for a startup, product or side project and then verifies each one against the domain registry, trademark databases, GitHub, npm, app stores and search results. The verification step is what separates it from asking a model for name ideas. Works with Claude Code, Cursor, Codex and around 75 other agents.

namingdomainstrademarkvalidation
by me-shaon Sep 9, 2026 6/10
skill GitHub

SureForge: Research, Ask, Plan, Build, Verify, Then Review Independently

An agent skill that enforces an ordering for complex work: research before asking questions, ask before planning, plan before building, verify before delivering, and get an independent review before calling it done. Plain text with no runtime to install. A discipline layer rather than a tool.

planningverificationreviewprocess
by Da7-Tech Sep 9, 2026 6/10
skill GitHub

mailbox-pilot-plus: Sort Mail, Draft Replies and Send Safely

A free Claude Code skill for email triage: sorting incoming mail, writing drafts, sending with guardrails, and checking Sent afterwards to confirm what actually went out. Built on the ECC tool suite. The verification step is a sensible touch for anything that sends on your behalf.

emailautomationdraftsecc
by agenticluke Sep 9, 2026 5/10
skill GitHub

claude-dlc: Personal Plugins for Planning, Review, Git Workflow and Go

A personal collection of Claude Code plugins covering planning, brainstorming, reviewing, git workflow and Go tooling. Small and opinionated rather than comprehensive. Worth browsing for ideas if you are assembling your own plugin set.

pluginsplanninggitgolang
by parMaster Sep 9, 2026 5/10
skill GitHub

SploitAgent: 85+ Security Skills Across 16 Domains for AI Agents

An open library of pentest, bug bounty and defensive security skills spanning web, API, cloud, AI/LLM, Active Directory, mobile and more, loaded on trigger so they do not all sit in context. Loads into Claude Code, Codex, Gemini or a local model. One of the larger security skill collections available.

securitypentestbug-bountyskills
by NoorQureshi Sep 9, 2026 7/10
skill GitHub

itsjavi/skills: Spec-Driven Development With Durable Product Memory

Skills that help a project adopt spec-driven development, backed by product memory documents that persist across sessions. Aims at teams whose specs otherwise live only in a chat log. Agent-agnostic.

spec-drivenmemorydocumentationprocess
by itsjavi Sep 9, 2026 5/10
skill GitHub

formify-skills: E-Signing and Document Workflows for Agents

Skills for small-business document work: building fillable PDF forms, sending contracts for electronic signature, verifying signers with BankID or an ID scan, and tracking status after sending. Reachable over MCP from Claude, ChatGPT, Codex, Cursor and around 25 other agents. Identity verification is a notable inclusion.

e-signaturepdfdocumentsmcpbankid
by formify-e-sign Sep 9, 2026 5/10
skill GitHub

Game-Engagement-Retention-Skills: Reward Moments and Lifecycle Retention

Three routed skills for games and consumer interactive apps covering in-session reward moments, lifecycle retention cohorts, and the link between the two. Packaged as a Claude Code plugin with routing so the right skill loads for the question asked. Product rather than engineering focused.

gamesretentionengagementproduct
by ajitta Sep 9, 2026 5/10
skill GitHub

voice-agent-kit: An ElevenLabs Voice Agent Build Method From 30k Calls

A Claude skill pack that takes a stated goal to a deployed ElevenLabs voice agent, with base configuration derived from roughly 30,000 production calls. The call volume behind the defaults is what makes it more than a template. Covers the build method, not just the config.

voiceelevenlabsagentsdeployment
by callflows Sep 9, 2026 6/10
skill GitHub

fusion-launchaudit: Senior-Dev Launch Audit Skill That Proves What Breaks

An 80/20 launch audit skill that probes your app the way a senior developer would and produces evidence for each failure rather than a generic checklist. The audit logic is open source under MIT, with paid hosted audits offered separately. Aimed at the pre-launch pass over a shipped app.

skillauditlaunchqa
by Fusion-Data-Company Sep 9, 2026 5/10
skill GitHub

model-optimizer-lite: Model Routing and Effort Guidance for Claude and Codex

A lightweight skill that picks which model to route a task to, suggests a reasoning effort level, and verifies review output across Claude, Codex, and Astra. It targets the common problem of spending a heavy model on work a cheaper one handles fine. Deliberately minimal compared to full orchestration harnesses.

skillmodel-routingeffortcost
by nyldn Sep 9, 2026 6/10
skill GitHub

marketing-skills: 48 Free Claude Marketing Skills Plus a Ryze MCP Connector

A free collection of 48 Claude marketing skills spanning Google Ads, Meta Ads, SEO, and AI visibility work. It also ships a hosted Ryze MCP connector over HTTP so the skills can pull live data instead of working from pasted numbers. The MCP dependency is vendor-hosted, so check that before adopting.

skillmarketingseoadsmcp
by irinabuht12-oss Sep 9, 2026 6/10
skill GitHub

clio: A Standard Layout Convention for the .claude Directory

A proposed standard directory layout for .claude/, covering where skills, commands, agents, and config should live. The value is consistency across repos and teams so agents and humans can find things in the same place every time. Small in scope but addresses real drift as .claude directories grow.

skillconventionproject-structureclaude-md
by nhhthong Sep 9, 2026 6/10
skill GitHub

ekphrasis: Image and Animation Prompt Skill That Bans Adjective Padding

A Claude Code skill for writing image and animation prompts on the premise that piling on adjectives creates slop rather than fixing it. It enforces a structure: name the subject, fix the lighting, restrict the medium, and state what the image is not. Practical for anyone driving image models from inside their editor.

skillpromptingimage-generationanimation
by Pr1m4lc0d3 Sep 9, 2026 6/10
skill GitHub

google-scholar-lab: Turn a Research Question Into a Ranked Literature Table

A literature research skill that runs the full chain from a research question to a ranked table: keyword extraction, Google Scholar search driven over Chrome DevTools Protocol, automatic annotation, then xlsx export. The CDP approach means it drives a real browser rather than depending on an API key. Handy for lit reviews that end in a spreadsheet.

skillresearchgoogle-scholarcdpexport
by CookieMoonPie Sep 9, 2026 7/10
skill GitHub

ecc-navigator-plus: Skill to Find, Install, and Reset Everything Claude Code

A Claude Code skill that acts as a front end to the Everything Claude Code (ECC) collection, letting you search the catalog, pick parts, install them, and reset back to a clean state. It removes the manual step of browsing the ECC repo and copying files by hand. Credits the original affaan-m/ECC project as the upstream source.

skillinstallereverything-claude-codecatalog
by agenticluke Sep 9, 2026 6/10
skill GitHub

claude-operator-pass: Skill Wrapping 22 GTM Tools Behind One API

An Operator Pass API skill that exposes the JMC go-to-market tool suite to Claude Code, including a cold-email linter, EVP generator, pipeline calculator, GEO visibility audit, and competitive teardown. It is designed for cross-runtime agent use rather than a single client. Requires your own Operator Pass API key.

skillapigo-to-marketsales
by JMC-Go-to-market Sep 9, 2026 5/10
skill GitHub

claude-pricing: B2B Pricing Skill for Value Metrics and Tier Design

A Claude Code skill that treats pricing as the highest-leverage B2B lever and walks through a fixed sequence: diagnose willingness-to-pay, choose the value metric, set a reference frame, build a three-tier contrast set, and close discount leaks. Useful if you want structured pricing analysis rather than ad-hoc prompting. Niche outside of founders and product marketers.

skillpricingb2bstrategy
by cmj-hub Sep 9, 2026 5/10
skill GitHub

claude-founder-brand: Four-Pillar Founder Content Rotation Skill

A writing skill that generates founder-brand content on a Pillar, Proof, Process, Person rotation in the founder own voice. It explicitly refuses thought-leader cadence, engagement bait, and AI-detection filler, which is the main differentiator from generic content prompts. Aimed at solo founders maintaining a posting habit.

skillcontentbrandingwriting
by cmj-hub Sep 9, 2026 5/10
skill GitHub

claude-cold-email: Signal-Based Cold Email Skill Under 90 Words

A cold email skill that enforces four jobs in under 90 words: a verbatim public signal, the pain that signal implies, a 22-word early value proposition, and a binary ask. It rejects demographic targeting as a substitute for a real signal. The tight word budget makes output easy to review.

skillcold-emailoutboundcopywriting
by cmj-hub Sep 9, 2026 5/10
skill GitHub

claude-evp: Value Proposition Skill Tuned to Buyer Awareness Tiers

A skill that writes Early Value Propositions capped at 22 words and matched to a Schwartz awareness tier, producing five different lines for the same product. The premise is that an unaware buyer and a vendor-comparing buyer need different framing. Pairs naturally with the same author cold email skill.

skillpositioningcopywritingmarketing
by cmj-hub Sep 9, 2026 5/10
skill GitHub

hefesto-publico: Portuguese-language Claude Code plugin marketplace

A PT-BR marketplace bundling six Claude Code plugins: hefesto (a plugin forge), odin (double-diamond product design), hermes (marketing), bragir (brand voice), mimyr (course building), and hestia (finances). Everything is written in Brazilian Portuguese. Useful if you want ready-made business-oriented plugins or a template for shipping your own marketplace.

pluginsmarketplacept-brskills
by sallzzbr Sep 9, 2026 5/10
skill GitHub

baodao-skill: Keyless agent skills for Taiwan open data

A skill collection that queries Taiwanese government open data for everyday questions — no login and no API keys required. Covers common daily-life lookups against official public datasets. A good reference for building region-specific skills on top of free public APIs.

skillsopen-datataiwanapi
by tahodev Sep 9, 2026 5/10
skill GitHub

joshfng/skills: Agent skills for backend and platform engineering

A curated set of agent skills aimed at backend and platform work, installable either as a Claude Code plugin or via `npx skills@latest add joshfng/skills`. Covers the kind of infrastructure and service-side tasks most general skill packs skip. Handy if your day job is closer to ops than to frontend.

skillsbackendplatformplugin
by joshfng Sep 9, 2026 6/10
skill GitHub

Revayat-Comic-Skill: Persian comic and manga translation skill

An agent skill that translates manga, manhwa, manhua, and Western comics into Persian with pixel-accurate speech-balloon detection and real right-to-left Persian typesetting. It also produces evidence that the original artwork was left untouched during the process. A strong example of a vision-heavy skill with verifiable output guarantees.

skillstranslationpersiancomicsrtl
by KiaroSama Sep 9, 2026 6/10
skill GitHub

popjam-io/skills: Free agent skills for marketing, ads, and creatives

An open collection of agent skills covering marketing, advertising, and creative production, installable with `npx skills add popjam-io/skills`. Aimed at non-engineering workflows that still run through a coding agent. Reasonable starting point if you want marketing tasks handled without writing the prompts yourself.

skillsmarketingadscreative
by popjam-io Sep 9, 2026 5/10
skill Reddit

Some claude skills to make my websites look good?

My claude website are looking so much vibe coded(cause they are) recently. But I have seen some people make mesmerizing websites through it. And ig its because of the skills they're using. I want m...

skill
by Able_Elderberry_3786 Sep 8, 2026 6/10
skill GitHub

youtube-fetcher-to-markdown: YouTube Videos into Obsidian-Ready Notes

A Claude Code skill that pulls a YouTube video down into structured Markdown, including full metadata, chapter breakdown, and transcript. Output is formatted for an Obsidian vault, so research and talk notes land straight in your knowledge base. Useful for anyone who takes notes from conference talks or tutorials.

skillyoutubeobsidianmarkdowntranscripts
by JimmySadek Sep 5, 2026 7/10
skill GitHub

honecode: Eight Code-Quality Skills for Claude Code

A skill pack covering the review side of the loop: scope, grade, structurize, simplify, harden, clean up, and audit, plus a skill that leaves concerns flagged inline for teammates. Each is a distinct pass rather than one catch-all "review my code" prompt. Good fit if your agent ships fast and your review discipline needs to keep up.

skillscode-qualitycode-reviewrefactoringaudit
by LinardsLiepenieks Sep 5, 2026 8/10
skill GitHub

craft-collection: A Plugin Marketplace Codifying Python and Data-Engineering Craft

A Claude Code plugin marketplace bundling disciplined Python and data-engineering practice as reusable skills, alongside workflows for capturing knowledge from a session. The framing is craft rules rather than one-off prompts. Relevant if your data pipelines need the agent to follow house standards.

marketplacepluginsskillspythondata-engineering
by grimaldost Sep 5, 2026 7/10
skill GitHub

product-engineer: Four Skills That Push Agents from Code to Outcomes

A skill set that reframes agent work around customer impact instead of diffs, plus a zero-dependency check that enforces a "For-the-customer" block in commit messages and PR descriptions. The check is the interesting part — it makes the product rationale a required artifact. Good for teams where agent PRs arrive without any stated why.

skillsproductcommitspull-requestsprocess
by Bubblegunn Sep 5, 2026 6/10
skill GitHub

ai-life-skills-toolkit: Eight Reusable Non-Coding Skills for AI Assistants

A skill bundle aimed outside the editor: studying, building presentations, customer service replies, handing work off to a browser, and privacy hygiene. Written to be portable across assistants rather than tied to one harness. Modest in scope, but a decent starting point for non-engineering skill authoring.

skillsproductivityprivacypresentationsnon-coding
by Williamunpalatable7706 Sep 5, 2026 5/10
skill GitHub

code-review-skill: Policy-Driven Review Skills for Local Diffs and PRs

A pair of review skills for coding agents that check changes against explicit written policy rather than generic taste. Works on uncommitted local changes and on GitHub pull requests, so the same rules apply before and after you push.

code-reviewskillgithubpolicy
by amirbena Sep 5, 2026 6/10
skill Reddit

A Three-Part Explanation Structure for CLAUDE.md: Issue, Fix, User Impact

A CLAUDE.md rule that fixes Opus 5 verbosity by shaping it instead of shortening it: every issue, fix or plan step is explained as root cause (file:line), what changes and why, then the before/after from the user's side. Predictable structure makes long output skimmable, and the user-experience section surfaces invisible wins like crashes that no longer happen.

claude-mdverbositypromptingopus-5
by BullfrogRoyal7422 Sep 5, 2026 6/10
skill GitHub

skills: Curated SKILL.md Collection for Claude Code, Codex, Cursor and More

A collection of ready-to-use Agent Skills written as SKILL.md files, portable across Claude Code, Codex, Cursor, OpenCode and Devin. Coverage includes building MCP servers, code review, draw.io architecture diagrams, Composio, NotebookLM and SonarQube.

skillscollectionportableskill-md
by afonsoft Sep 5, 2026 7/10
skill Reddit

mira-test-engineer: Skills for Writing Fewer, Better Tests

Two skills built out of a specific annoyance: agents writing piles of pointless tests. One checks test quality on the premise that a solid test beats ten flaky ones, the other refactors an existing test mess. The author benchmarked the checker against known good and bad tests and tightened it until it stopped being forgiving.

testingskillrefactoringbenchmark
by haukebr Sep 5, 2026 7/10
skill GitHub

tenured: Reviews Your Change Against the Repo's Own History, with Commit Hashes

A reviewer persona that grounds every objection in the repository's actual past — each complaint cites the commit hash where that mistake was made before. Ships as a plugin for 14 coding agents plus a write gate, a GitHub Action and a benchmark, so you can check the persona actually catches things.

code-reviewpersonagit-historyplugingithub-action
by lazy-senior-dev Sep 5, 2026 7/10
skill GitHub

paranoid-sre: An On-Call Persona That Reviews the Deploy, Not the Code

A review persona focused on the operational surface a code reviewer usually skips: resource limits, liveness and readiness probes, rollout strategy, rollback path and alerting. Distributed as a plugin for 14 coding agents with a write gate, a GitHub Action and a benchmark.

sredeploymentpersonareviewkubernetes
by lazy-senior-dev Sep 5, 2026 7/10
skill GitHub

philomatheia: A Learning Skill with Knowledge Maps and Cross-Session Checkpoints

A skill for using Claude as a study partner over time rather than a single sitting. It builds a knowledge map for a stated goal, requires evidence for claimed understanding, and writes exact checkpoints so the next session resumes where the last one actually left off.

learningskillmemorycheckpoints
by Ch1nYu Sep 5, 2026 6/10
skill GitHub

claude-skill-cave: Caveman Mode Skill for Fewer Output Tokens

A caveman-mode skill that strips Claude's output down to terse phrasing so you burn fewer output tokens and get further before hitting usage limits. One of several independent takes on the Caveman idea, whose measured savings have been contested — JetBrains put it nearer 8.5% than the claimed 65%.

skillstoken-efficiencycavemanusage-limits
by asauntung Sep 5, 2026 6/10
skill Reddit

ReqProof: A Skill That Makes Claude Prove Every Requirement Before Finishing

ReqProof turns a prompt into numbered requirements, tracks 'don't touch X' constraints, and demands evidence before any requirement can be marked PASS. It reports PASS / FAIL / PARTIAL / UNKNOWN instead of a blanket 'done', and flags skipped tests, placeholders, and fake completion. Free, open source, no server or account.

skillsverificationrequirementsopen-source
by Admirable-Put7423 Sep 5, 2026 8/10
skill Reddit

repo-to-course: Three Skills That Turn Any Repo Into a Full Coding Course

A set of three Claude Code skills that read a repository and generate a complete course on its stack at zero, amateur, or advanced level. Output is a textbook, a workbook, an optional 14-day crash-course schedule, and exams with at least 25 shuffled questions per module. Everything runs from disk with quizzes, drag-and-drop matching, and spot-the-bug exercises.

skillslearningdocumentationonboarding
by IanPlaysThePiano Sep 5, 2026 8/10
skill Reddit

Restoring Nested CLAUDE.md and Path-Scoped Rules With One Env Var

Auto-Mode's bash-first instructions were overriding nested CLAUDE.md files and path-scoped rules. Setting CLAUDE_CODE_THRIFTY_SONIC to "false" in the env block of your settings file disables those instructions and makes scoped rules take effect again. Tracked upstream as claude-code issue #90450.

claude-mdsettingsconfigurationauto-mode
by Isyckle Sep 5, 2026 7/10
skill GitHub

kipi-system: A Markdown Memory and Role System Built on Claude Code

An externalized 'AI brain' kept entirely in plain markdown: it records what you do, then reconfigures the same skeleton into whatever role you need — chief of staff, lawyer, PM, or investigator. No database or service, just files Claude Code reads.

memorymarkdownrolespersonal-assistant
by assafkip Sep 5, 2026 6/10
skill GitHub

ai: Claude Code Plugin Collection for SDD, API Debugging and Submodules

A bundle of Claude Code plugins covering AI harness engineering with a spec-driven-development pipeline, an API debugger, a content analyzer, and a submodule manager. Useful as a starting point if you want several workflow plugins from one install rather than assembling them piecemeal.

pluginssdddebuggingsubmodules
by 1989v Sep 5, 2026 5/10
skill GitHub

claude-code-adhd-skills: Two Skills for ADHD Developers

Two skills — mirror and librarian — copied unedited from the author's daily ~/.claude/skills rather than packaged for release. MIT licensed, no installer and no dependencies, so you can read them in a minute and copy what you want.

skillsaccessibilityadhdproductivity
by Citability Sep 5, 2026 6/10
skill GitHub

modbus-skills: Read-Only Modbus Engineering Skills for Coding Agents

A skill pack for Modbus industrial protocol work, deliberately read-only so an agent can inspect and reason about devices without issuing writes. Compatible with Claude Code, Codex, Cursor, and other Agent Plugins clients.

skillsmodbusindustrialread-only
by studioxvii Sep 5, 2026 5/10
skill GitHub

claude-skills: Research Workflow Skills for Polishing and Proving Ideas

A workflow aimed at keeping you in the driver's seat while the agent does the grunt work: skills for refining an idea, expressing it rigorously, and implementing it properly, in that order. Targeted at staff-researcher-level output and usable from both Claude Code and Codex.

skillsresearchrigorworkflow
by shubham0704 Sep 5, 2026 6/10
skill GitHub

manager-skill: Run a Project From One Session With Issues as the Board

A manager session reads GitHub issues as its task board, opens one builder tab per issue, then self-reviews and auto-merges the results. Turns multi-issue work into a single supervisory session rather than a stack of terminals you drive by hand.

orchestrationgithub-issuesparallel-agentsauto-merge
by orrgal1 Sep 5, 2026 7/10
skill GitHub

awesome-agent-skills: A Small, Verified, Security-Aware Skill Directory

A deliberately small directory of Agent Skills in SKILL.md format, where entries are verified and reviewed with security in mind rather than accumulated by volume. A useful counterweight to the large unvetted skill lists.

skillsdirectorysecuritycuration
by royalpinto007 Sep 5, 2026 6/10
skill GitHub

design-workflow: Five-Layer Design Workflow Skill With 12 Sub-Skills

A general-purpose design workflow modeled as five chained layers — scenario, perceptual material, formal organization, information narrative, subjective output — with twelve specialized sub-skills hanging off them. Chinese-language.

designskillsworkflowchinese
by yang20040317-svg Sep 5, 2026 5/10
skill GitHub

foreman: A Claude Code Plugin That Keeps the Plan Next to the Code

Ask what's next and get the task, the reasoning behind it, and a ready-to-run prompt that has been checked against the files actually in your repository. Keeps project planning inside the codebase rather than in a separate tracker the agent never reads.

pluginplanningpromptsproject-management
by V-Songbird Sep 5, 2026 6/10
skill GitHub

razor: A Claude Code Plugin That Blocks Code Nobody Asked For

One check runs before every new package, file, or abstraction, forcing a justification instead of letting the agent expand scope silently. The pitch is the same job in half the lines.

pluginsimplicitycode-qualityscope-control
by V-Songbird Sep 5, 2026 7/10
skill GitHub

job-hunt-skill: Job-Search Copilot Skill for Claude Code

Screens whether you are actually eligible for a posting before writing anything, archives the posting for later reference, and checks your drafts for the machine-written register that gets applications binned.

skillsjob-searchwritingproductivity
by geumjin99 Sep 5, 2026 5/10
skill GitHub

ba-generation-skill: Evidence-Bound Business Architecture Engineering

Produces strategy, value streams, capabilities, and process architecture behind deterministic gates, so each artifact has to satisfy explicit checks before the next one is generated rather than being free-form output.

skillsbusiness-architecturegatesenterprise
by yslicn Sep 5, 2026 5/10
skill GitHub

claude-skill-finder: Find the Skill That Already Exists Before Building

Searches in order — installed skills, a verified vendor catalog, community indexes, then live GitHub — on a strict three-search budget, so the lookup itself does not eat your context. Aimed at the common failure of rebuilding a skill someone already published.

skillsdiscoverysearchtoken-efficiency
by nohseongmin Sep 5, 2026 7/10
skill GitHub

test-suite-doctor: Audit, Minimize and Heal Bloated Vitest/Jest Suites

An agent skill plus standalone CLIs that compute per-test coverage metrics, greedily minimize redundant tests, detect AI-slop tests, and verify what remains with mutation scoring. Aimed squarely at suites that ballooned from agent-generated tests.

testingvitestjestmutation-testingai-slop
by JoseAntonioNuevo Sep 5, 2026 8/10
skill GitHub

skills: OOMOL's Catalog of App-Skills for Third-Party Services

The official OOMOL catalog of app-skills, letting AI assistants operate third-party services through the oo CLI. Worth a look if you want service integrations as skills rather than as another MCP server to run.

skillsintegrationsclicatalog
by oomol-lab Sep 5, 2026 5/10
skill GitHub

twa-edu-harness: Taiwan K-12 Teaching Skill Harness in Three Layers

An agent harness for Taiwan's 108 curriculum, organizing teaching skills into a three-tier Skill / Bundle / Preset architecture so a teacher can pull a preset rather than assemble skills manually.

educationskillstaiwancurriculum
by FW1201 Sep 5, 2026 5/10
skill GitHub

trz: Bulgarian Payroll Audit Skill for Claude Code and Copilot

Audits Bulgarian payroll statements against the Labour Code, social insurance code, income tax act, and national wage classification. A concrete example of encoding jurisdiction-specific compliance rules as an agent skill.

skillspayrollcompliancebulgarian
by svedbg Sep 5, 2026 5/10
skill GitHub

design-engineering: A Skill Graph for Animation, Typography and Taste

A connected graph of design engineering skills covering animation, transitions, taste, typography, color, components, and anti-patterns — structured as a graph so the agent pulls the relevant node rather than one monolithic style guide.

designskillstypographyanimationfrontend
by AgentsORG Sep 5, 2026 6/10
skill GitHub

obsidian-skills-pack: Agent Skills for Obsidian Queries and Vault Audits

Skills covering Obsidian plugin syntax (queries, tasks, charts, interactive UI), graph view tuning, vault auditing, and heatmap visualizations. Compatible with Claude Code, Codex CLI, OpenCode, and any agent-skills runtime.

skillsobsidiannotesvisualization
by lexbritvin Sep 5, 2026 6/10
skill GitHub

self-improving-claude: Feedback Loops From Human PR Review Into Claude

A Claude Code plugin that calibrates review behavior against the feedback humans actually leave on pull requests, tracks where the pipeline missed something, and promotes lessons up a confidence ladder rather than treating every one-off note as a permanent rule.

pluginfeedback-loopscode-reviewlearning
by kirilklein Sep 5, 2026 7/10
skill GitHub

jgs-archi-skills: ArchiMate Modelling Skills Driving an Archi Bridge

One orchestrator skill plus specialists that drive the JGS Archi Bridge MCP to build ArchiMate models in Archi. Works with Claude Code, Cursor, Gemini CLI, Codex, Copilot, and ZCode.

skillsarchimatemodellingenterprise-architecture
by jgsystemsconsulting Sep 5, 2026 5/10
skill GitHub

telegram-research: Claude Code Skill for Reading Public Telegram

Reads public Telegram channels with no account at all, and groups using your own account. Useful for research and monitoring workflows where Telegram is where the discussion actually happens.

skillstelegramresearchmonitoring
by warodan Sep 5, 2026 6/10
skill GitHub

jira-user-story-from-commit: Staged Changes Into a Jira User Story

Turns staged git changes or a specific commit into a Jira user story, and only creates the issue after you approve the draft — the approval gate being the part most ticket-generation tools skip.

skillsjiragitapproval-gate
by DiegoLibonati Sep 5, 2026 6/10
skill GitHub

ai-migration-kit: Gate-Verified .NET Migration and Issue-to-PR Loops

A Claude Code plugin with two loops: a gate-verified pipeline for migrating legacy .NET applications via RoselineMCP, and a hands-off GitHub issue to pull request lifecycle (create-issue, implement-issue, merge-pr, auto-dev) that runs on any repository from one committed profile.

plugindotnetmigrationgithubautomation
by phmatray Sep 5, 2026 6/10
skill GitHub

unai: Agent Skill That Strips AI Tells From Japanese Writing

Removes the machine-written register from Japanese prose — the equivalent of the English de-slop skills, but tuned to Japanese phrasing patterns rather than translated heuristics.

skillsjapanesewritingai-detection
by kitepon Sep 5, 2026 5/10
skill GitHub

wp-code-optimizer: Three Claude Code Skills for Live WordPress Sites

A set of three Claude Code skills targeting production WordPress: safe deployment, dead-code removal with proof, and Core Web Vitals tuning. Each check is calibrated against a known-bad case first, so you can tell whether the detection actually works before trusting it on a live site. Useful if you maintain client WordPress installs and want agent help without breaking things.

wordpressskillsperformancecore-web-vitalsdead-code
by mediagyancy Sep 5, 2026 7/10
skill GitHub

ops-and-scale-os: 26 Claude Code Skills for GTM and AI Ops

An open-source skill pack covering go-to-market engineering and AI operations — data plane work, agent building, evals, and martech plumbing. Aimed at the systems underneath revenue playbooks rather than the playbooks themselves. Worth a look if you are wiring Claude Code into ops tooling rather than pure app code.

skillsgtmai-opsevalsmartech
by guerrilla2799 Sep 5, 2026 6/10
skill GitHub

foundry: Three Claude Code Plugins for Plan, Chatter and Scope

A single marketplace shipping three independent Claude Code plugins: foreman holds the plan steady, hush cuts output chatter down to one answer at the end, and razor pushes back on over-building. Install any one of them without the others.

pluginsmarketplacescope-controlplanning
by V-Songbird Sep 5, 2026 6/10
skill GitHub

sassydog-skills: Reusable Skills and Review Agents for AI Coding Tools

A collection of agent skills and review agents written to work across Claude Code, Gemini CLI and other AI coding tools rather than being locked to one. The review agents are the main draw for anyone who wants a second opinion pass without wiring one up themselves.

skillscode-reviewgemini-cliportable
by Sassy-Dog Sep 5, 2026 5/10
skill GitHub

doctrine-skills: Parallel Agent Waves and Adversarial Red-Teaming

A Claude Code plugin encoding an execution doctrine: run agents in phases and waves, red-team the output adversarially, loop until confident, and cut back to the simplest thing that works. It is opinionated process packaged as a plugin rather than a single tool.

pluginorchestrationred-teamparallel-agents
by scottcrosby-securebine Sep 5, 2026 6/10
skill GitHub

av/skills: Orchestration, Code Quality and Writing Skills for Agent CLIs

A skills collection covering autonomous orchestration, code quality passes, local LLM use through Harbor, and writing pipelines, written to run under Claude Code, Codex, OpenCode and Cursor. The local-LLM angle is unusual for a skills repo and useful if you want some steps off the hosted models.

skillsorchestrationlocal-llmcross-tool
by av Sep 5, 2026 6/10
skill GitHub

linkedin-growth-skills: Six Agent Skills for Auditing and Growing LinkedIn

Six skills aimed at founders and creators: profile audit, company page audit, content strategy, lead generation, authority building and metrics. Explicitly not built for job seekers. Straightforward marketing automation, useful if that is your use case and noise otherwise.

skillslinkedinmarketinggrowth
by 9heaven Sep 5, 2026 5/10
skill GitHub

paper-sharpener: Claude Code Skills for Academic Writing and Revision

Agentic skills for academic writing that simulate peer review, drive revision passes and tighten prose. Aimed at researchers who want structured criticism of a draft rather than generic copy editing.

skillsacademic-writingpeer-reviewediting
by borgr Sep 5, 2026 6/10
skill GitHub

ai-writing-audit: Two-Layer Audit for Text That Reads as Machine-Written

An audit that checks writing on two levels: surface tells like word choice and punctuation habits, plus discourse tells in how an argument is structured. Layered by text type, so the standard for an email differs from an essay. Useful as a final pass on anything an agent drafted.

writingauditai-detectionediting
by thebgtagency Sep 5, 2026 5/10
skill GitHub

ultra-skills: Portuguese Claude Code Skills for Sites and SEO Audits

Two Claude Code skills documented in Portuguese: one builds websites with art direction applied, the other audits SEO, GEO, analytics instrumentation and code. Notable as one of the few non-English skill packages in circulation.

skillsseoweb-designportuguese
by guiloureiromkt Sep 5, 2026 5/10
skill GitHub

research-obsidian-skill: Turn Papers Into a Cross-Linked Obsidian Vault

Skills that convert papers and conversations into an Obsidian knowledge base, producing ten-section notes with inline figures and filing them under topic hubs so the vault stays navigable. Aimed at researchers who accumulate PDFs faster than they can read them.

skillsobsidianresearchknowledge-base
by alfredzhang98 Sep 5, 2026 6/10
skill GitHub

workbuddy-skill: Search 10,000+ Public Agent Skills and Adapt Them

A skill that searches a large index of public agent skills and adapts trusted ones into WorkBuddy workflows. The search-and-adapt idea is the reusable part: rather than writing a skill from scratch, find one that already works and port it.

skillssearchdiscoveryworkbuddy
by sandbaseai Sep 5, 2026 5/10
skill GitHub

sliced-review: Whole-Codebase Review in Blast-Radius-Ordered Slices

A Claude Code skill that reviews an entire codebase with a second model by cutting it into slices ordered by blast radius, with a cost ledger and a watchdog so the model never wanders the repo unsupervised. Directly addresses the two failure modes of whole-repo review: unbounded cost and unfocused attention.

skillcode-reviewcost-controlsecond-model
by Mariomarquezt Sep 5, 2026 7/10
skill GitHub

write-like-me: Voice Profiles Enforced by a Deterministic Checker

Measures how you actually write, builds a voice profile from it, then enforces the profile with code rather than instructions: em dashes, filler, hedges and AI tells are caught by a deterministic checker instead of asking the model to be careful. Supports multiple named voices and ships an eval harness with golden tests, no dependencies.

skillwritingstyledeterministic
by Hiro-Inagawa Sep 5, 2026 7/10
skill GitHub

awesome-product-management-skills: Agent Skills for Product Work

A curated collection of agent skills aimed at product management. The repository ships no description, so the actual scope and quality have to be judged from the source once cloned.

skillsproduct-managementawesome-list
by karozi Sep 5, 2026 5/10
skill GitHub

graphify: Turn a Codebase Into a Queryable Knowledge Graph

A /graphify skill that ingests a codebase along with its docs, SQL schemas, configs and PDFs and builds a queryable knowledge graph. Parsing is local, deterministic and AST-based with every edge explained, and there is no vector store involved. Runs under Claude Code, Cursor, Codex and Gemini CLI.

skillknowledge-graphastcodebase-analysis
by Graphify-Labs Sep 5, 2026 7/10
skill GitHub

code-skills-package: A Pluggable Suite of AI Coding Capabilities

A bundled set of AI coding capabilities meant to cover common development workflows in one pluggable framework instead of a pile of separate skills. The description stays high level, so check the source before adopting.

skillsbundleworkflows
by maythyai Sep 5, 2026 5/10
skill GitHub

mcp-vet: Find, Vet and Safely Install MCP Servers Before They Land

A Claude Code skill that searches for MCP servers, then actually reads the source and flags inflated star counts before anything is added to your setup. Addresses a real supply-chain gap, since installing an MCP server means running someone else's code with your agent's permissions.

skillmcpsecurityvetting
by Furkiozknn Sep 5, 2026 7/10
skill GitHub

presentation-skills: Rebuild Canva Decks and Fit a Talk to Its Clock

Two agent skills for presentations: one rebuilds an existing Canva design with new content, the other builds a talk sized to the time slot it has to fill. The timing constraint is the more interesting half, since that is where most generated decks fail.

skillspresentationscanvapublic-speaking
by aminehaddad-git Sep 5, 2026 5/10
skill GitHub

ThatGuySam/skills: Calibrated Decision Measurement Skills for Agents

Skills focused on measuring decisions in a calibrated way, so an agent's confidence can be scored against outcomes rather than asserted. Small and abstract, but relevant to anyone trying to make agent judgement auditable.

skillscalibrationdecision-makingevaluation
by ThatGuySam Sep 5, 2026 5/10
skill GitHub

skill-boilerplate: Setup Wizard That Generates Your Own Skill-Creator

A starting point for building Claude Skills that deliberately avoids baking in someone else's conventions. A setup wizard asks how you name, version, and lay out skills, then generates a skill-creator preloaded with your answers. Useful if existing skill templates keep fighting your repo's structure.

skillsboilerplatescaffoldingconventions
by colomet Sep 4, 2026 7/10
skill GitHub

store-publish: Ship to App Store and Google Play From One File

An Agent Skill that pushes an app to App Store Connect and Google Play from a single metadata file: localized texts, screenshots, pricing, builds and review submission. Uses only curl, python3 and openssl — no fastlane.

skillmobileapp-storerelease
by LeeHueeng Sep 4, 2026 7/10
skill GitHub

agentii-investment-intelligence: 25 Skills for Equity Research

Institutional equity-research skills covering SEC filings, XBRL financials, earnings calendars, DCF/comps/LBO models and PowerPoint generation. Backed by the agentii.ai data plane; works across Claude Code, Codex, Goose and others.

skillsfinanceresearchsec
by agentii-ai Sep 4, 2026 6/10
skill GitHub

turkish-humanify: Rewrite AI-Sounding Turkish Into Natural Turkish

A Turkish humanizer skill that rewrites machine-sounding text with native sentence architecture and register-aware tone, while keeping technical terms intact. Works in both Claude and Claude Code.

skillwritingturkishhumanizer
by durmazoguzhan Sep 4, 2026 5/10
skill GitHub

Chewbacca: Self-Installing Standards, Skills, Subagents and Hooks

A bundle of standards, skills, subagents, hooks, MCP servers and macOS tools that install themselves into Claude Code. The pitch is nothing to remember and nothing to type after setup.

skillshookssubagentsmacossetup
by calebnewtonusc Sep 4, 2026 6/10
skill GitHub

macOS-Trace: Closed-Loop xctrace Performance Tuning for macOS Apps

An Agent Skill that profiles a macOS app headlessly with xctrace, applies targeted code fixes, then re-tests differentially to confirm the fix helped. Works with Claude Code, Codex, Cursor and Antigravity.

skillperformancemacosprofiling
by kmgcc Sep 4, 2026 7/10
skill GitHub

iOS-Trace: Closed-Loop xctrace Performance Tuning for iOS Apps

The iOS and iPadOS counterpart: headless xctrace profiling on physical devices and simulators, targeted code fixes, and differential A/B re-testing. Harness-agnostic Agent Skill.

skillperformanceiosprofiling
by kmgcc Sep 4, 2026 7/10
skill GitHub

auxfirst-skill-global: Score and Cap an AI Agent's Autonomy

Scores every action an agent can take, caps autonomy at the hottest dimension, and emits the mandate, exceptions and owner's manual behind that decision. A governance skill, free under CC BY 4.0.

skillgovernancesafetyautonomy
by auxfirst Sep 4, 2026 6/10
skill GitHub

shipit-skill: One-Pass Launch Pipeline for Developer Tools

An Agent Skill running a single-pass launch pipeline — engineering baseline, publish, directory listings, promotion. Distilled from the author's own shipped tools.

skillreleaselaunchpublishing
by skyzhao1223 Sep 4, 2026 5/10
skill GitHub

10000x-engineer: Size Up a Change Before You Make It

Skills for scoping a change before writing it: impact, tradeoffs, decision points, and a first-principles pass on your own reading of the problem. Delegates the mechanical work to cheap subagents, and works in your language.

skillsplanningscopingsubagents
by Jsnnmsc Sep 4, 2026 6/10
skill GitHub

awesome-agent-skills (fralapo): Skills Mined From Docs and Books

Production-grade agent skills for Claude Code and any SKILL.md-compatible agent, each derived from real corpora, official documentation and books. Install as a plugin or drop into any agent.

skillscollectionplugin
by fralapo Sep 4, 2026 7/10
skill GitHub

celorus-plugin: Sales Intelligence on Indian Companies, Cited

Covers the sales workday from lead research to follow-up on Indian companies and the people behind them, with every record figure cited to its source. Published as a generated mirror.

skillsalesresearchindia
by Celorus Sep 4, 2026 5/10
skill GitHub

qapla-api-skill: Agent Knowledge Pack for the Qapla' Shipping API

An agent knowledge pack for the Qapla' public REST API v1.3 covering shipments, raw orders, carrier labels, tracking, real-time quotes, PUDO and webhooks. Usable as a Claude skill, an AGENTS.md or a Cursor rule.

skillapilogisticsshipping
by Qapla Sep 4, 2026 5/10
skill GitHub

visual-video-summarizer: Video to HTML With Aligned Frames

A Claude Code skill that summarizes a video into an English HTML page with transcript-driven chapters, embedding selected frames — slides, screens, demos — next to the text they illustrate.

skillvideosummarizationtranscript
by yosishe Sep 4, 2026 7/10
skill GitHub

AlterLab-Academic-Skills: 239 Evaluated Skills, 17 Research Domains

Academic agent skills spanning bioinformatics, data science, clinical work, social-science methods and Turkish academia, each with an executable eval. Includes a deterministic citation verifier and a research-write-review-publish pipeline.

skillsacademicresearchcitationsevals
by AlterLab-IEU Sep 4, 2026 7/10
skill GitHub

wheel: A Market-First Gate That Checks Before You Build

A gate for Claude Code that searches for an existing solution before a single line of code is written, on the premise that the wheel usually already exists.

skillresearchgateplanning
by kalpakprod Sep 4, 2026 6/10
skill GitHub

ux-skills: Agent Skills for Working UX Designers

Skills that challenge ideas, surface blind spots, use the real design system, preserve evidence and decisions, and carry UX intent into engineering handoff.

skillsuxdesignhandoff
by Tranz007 Sep 4, 2026 6/10
skill GitHub

review-skills: Seven Portable, Evidence-Backed Audit Skills

Seven review skills — bugs, security, tests, docs and structure — that make any coding agent file evidence-backed, severity-graded audits instead of prose opinions.

skillsreviewsecuritytestingaudit
by specialone0007 Sep 4, 2026 7/10
skill GitHub

sapcc-skill: Natural Language to Groovy and FlexibleSearch on SAP

Turns natural-language requests into Groovy scripts or FlexibleSearch queries and runs them live against a SAP Commerce Cloud (Hybris/CCv2) instance through the HAC. Picks the right tool from your intent without manual query writing.

skillsaphybrisgroovy
by eljoujat Sep 4, 2026 6/10
skill GitHub

maic_skill: Offline Authoring of OpenMAIC DSL Courses

Authors OpenMAIC DSL courses inside Claude Code — outline, scene generation, TTS voiceover, translation, editing and a gated review pipeline — compiling git-friendly sources into importable .maic.zip bundles.

skillcoursewarettsdsl
by weinaike Sep 4, 2026 5/10
skill GitHub

knowledge-space: 851+ Dense Reference Articles for Agents

A curated technical knowledge base spanning 26 domains in an agent-first format with wiki-links, gotchas and runnable code. Verified references rather than tutorials.

knowledge-basereferencedocumentation
by AnastasiyaW Sep 4, 2026 6/10
skill Reddit

A CLAUDE.md Standing Rule That Kills Excess UI Verbosity

A verbatim CLAUDE.md rule that stops Claude from padding frontend work with explanatory paragraphs and lets the UI explain itself. The author reports never having to ask for terser copy again after adding it.

claude-mdfrontendpromptingverbosity
by RepliesAsOtherPeople Sep 4, 2026 7/10
skill Reddit

A Skill That Cut Claude Code's Command Count by 55%

Two sessions on the same repo with Opus 5 at medium effort: the baseline had Claude discover and run commands itself, while the second used a Skill that turned repeatable repo procedures into deterministic higher-level commands. The second session issued 55% fewer commands.

skillexperimentcommandsefficiency
by adi1405 Sep 4, 2026 7/10
skill Reddit

A Browser-Based CLAUDE.md Generator With Stack Presets

A free in-browser generator that produces a CLAUDE.md from checkbox rules and a chosen stack, with no signup. Currently only Next.js has a framework preset; the author is asking which rules are missing.

claude-mdgeneratorweb-tool
by Ice-Medium Sep 4, 2026 5/10
skill GitHub

ai-commit-trailers-skill: Disclose an Agent's Share of a Commit

A Claude Code skill that adds Assisted-by / Generated-by trailers to commits, recording how much of the work an agent did. Useful for teams that want an auditable record of AI involvement without hand-writing trailers.

gitcommitsskillprovenance
by rokokol Sep 4, 2026 6/10
skill GitHub

designer: A Claude Code Plugin That Gives Claude a Real UI-Design Practice

A plugin that pushes Claude to commit to one design stance, build on semantic tokens, use real content instead of lorem ipsum, and hold an accessibility and taste floor. Ships an Essentialist persona distilled from Rams, Bauhaus, and Ive.

ui-designpluginaccessibilitydesign-tokens
by SSFSKIM Sep 4, 2026 7/10
skill GitHub

BurnItAllDown: An Adversarial Reviewer That Red-Teams Your Own Plan

An "anarchist" reviewer for Claude Code that treats fixed constraints as asymmetric leverage, attacks the plan you just wrote, and runs an anti-sycophancy check. For when the agent agrees with you far too readily.

reviewred-teamplanninganti-sycophancy
by LearnDataLive Sep 4, 2026 6/10
skill GitHub

krrish-skills: Claude Code Skills That Verify Their Own Output

Two skills built around measurable self-checks: SVG logo and icon design gated on a quality threshold, and a per-project todo board. The output has to pass the gate before the skill calls itself done.

svgdesigntodoself-verification
by nkrrish Sep 4, 2026 6/10
skill GitHub

aero-agent-skills: 416 Verified Aerospace Engineering Skills for Agents

An aerospace knowledge layer of 416 skills in 85 installable packs across 12 engineering families, mapped to 30 standards including ECSS, DO-178C, and NASA. Validated by an 846-task deterministic gate battery; AgentSkills.io format, Apache-2.0.

aerospaceskillsstandardsdo-178cdomain-knowledge
by ashfordeOU Sep 4, 2026 7/10
skill GitHub

claude-skills (devteam): A Three-Layer Pipeline From Client Idea to Product

A marketplace of agentic workflows whose centerpiece, devteam, carries a project from a client brief to a working product under a signed charter — traceable requirements, independent verification of every report, and escalations classified by how reversible they are.

marketplacepipelinerequirementsverification
by alternative-intelligence-cp Sep 4, 2026 6/10
skill GitHub

mkt-data-warehouse: A Query-Anytime Marketing Data Warehouse Skill

A Claude Code skill pulling Ads, GA4 and agent data into a local SQLite warehouse with normalized metric views, a two-window comparison dashboard and a three.js 3D data city view. Published as a sanitized public template with entirely fictional demo data. Chinese-language docs.

skillanalyticssqlitemarketing
by Haili321 Sep 3, 2026 6/10
skill Reddit

paper-radar: A Skill That Tracks Which AI Labs Actually Lead arXiv Papers

A SKILL.md agent skill that pulls every paper from 28 AI labs over a date range and splits each lab's count into papers they led versus papers where they were only a co-author. Affiliation matching goes through ROR IDs and email domains rather than fuzzy string matching, so it doesn't hallucinate. Useful for anyone tracking publication output across Google, Meta, OpenAI, Anthropic and the major Chinese labs.

skillresearcharxivai-labs
by navune Sep 3, 2026 7/10
skill GitHub

xingtu-skills: 26 Production-Grade SKILL.md Files, Cross-Tool Compatible

An aggregation repo of 26 production-grade agent skills written as SKILL.md, built to work across tools and compatible with the DeepSeek Harness. A drop-in starting library if you want skills without writing them from scratch.

skillscollectioncross-toolskill-md
by xingtu1996 Sep 3, 2026 6/10
skill GitHub

health-skill: A Longevity and Health Workspace Companion for Claude

A health workspace that connects lab results, training data, sleep and family history so each conversation with Claude builds on the last instead of starting from scratch. Aimed at long-horizon health tracking rather than one-off questions.

skillhealthlongevitypersonal-data
by googlarz Sep 3, 2026 6/10
skill GitHub

dstack: A Collection of AI Skills for Roblox Development

A set of agent skills targeted at Roblox development. Narrow, but there's very little published skill material for the Roblox toolchain, so it fills a gap for anyone building there with an AI agent.

skillsrobloxgame-devcollection
by HungryKelvin123 Sep 3, 2026 5/10
skill GitHub

opinion-map: Scout Which Angles on a Topic Are Already Taken

Researches how many distinct schools of thought exist on a topic and which angles nobody has claimed yet — topic reconnaissance for content creators. Retrieval-driven and designed to stay neutral rather than pick a side. Chinese-language docs.

skillresearchcontentretrieval
by ianx52 Sep 3, 2026 5/10
skill GitHub

solo-skills: 26 Agent Skills From a Solo Founder's Automation Kit

A solo entrepreneur automated 49 parts of their business without employees and published the 26 agent skills that were directly reusable, with the supporting execution scripts. Korean-language docs.

skillsautomationsolobusiness
by bam-bam-2 Sep 3, 2026 5/10
skill GitHub

claude-codex-skills-assembly: Skills, Deterministic Activation, Safety Hooks

Reusable agent skills bundled with deterministic activation rules, safety hooks and installers for both Claude Code and OpenAI Codex. The deterministic activation is the interesting part — skills fire on defined conditions instead of the model deciding.

skillshooksactivationcodex
by alex-macra Sep 3, 2026 6/10
skill GitHub

recipes: Pullable, Inspectable Agent Recipes for Real Software Jobs

A library of agent recipes for actual software and knowledge-work tasks, designed to be pulled in and read rather than run as a black box. The emphasis is on inspectability — you can see what the recipe will do before it does it.

skillsrecipescollectionworkflow
by Software-Sausage Sep 3, 2026 5/10
skill GitHub

web-engineer-skills: Agent Skills for Vue, React, Next.js, a11y and Perf

A skill pack for frontend and full-stack engineers covering Vue 3, React, Next.js, TypeScript, accessibility and performance, compatible with Claude Code, Cursor and Codex. The author's motivation: science and security already had skill packs and frontend engineering didn't.

skillsfrontendreactaccessibility
by LeonxLJX Sep 3, 2026 7/10
skill GitHub

teach-me: A Claude Code Skill That Explains Any Topic From First Principles

A personal skills repo whose current entry, teach-me, explains any technical topic from first principles and can output either as chat or as a printable PDF. Useful for onboarding notes or study material you want to keep.

skilllearningdocumentationpdf
by sahanaramesh09 Sep 3, 2026 5/10
skill Reddit

claude-code-remotion: A Skill for Scriptable Claude Code Demo Videos

A Remotion-based skill that produces demo videos nearly identical to a real Claude Code terminal, with a template included so you can script your own. A companion skill handles realistic typing animation, with natural pauses after commas and per-character jitter that stays stable across renders.

skillremotionvideodemo
by HMHAMz Sep 3, 2026 7/10
skill GitHub

Mobile-ReverseSkill: Agent Skills for Android Reverse Engineering

Reusable agent skills for mobile reverse engineering and Android native fuzzing, including on-device AFL++ and a stub-JNIEnv harness. Installable via skillfish. A rare example of security research tooling packaged as agent skills.

skillsreverse-engineeringandroidfuzzing
by alvinhayy Sep 3, 2026 6/10
skill GitHub

dotfiles: An Instruction Architecture With a Behaviour Test Suite

A full instruction architecture for coding agents — rules, skills and subagents — paired with a routing and behaviour test suite and an evidence-grade session evaluation pipeline. Notable because it treats agent instructions as something you can actually test rather than tune by vibes.

dotfilesinstructionstestingevaluation
by saranyoopkp Sep 3, 2026 6/10
skill GitHub

pm-skill: Claude Orchestrates Delivery From Discovery to Ship via Subagents

A project/product manager skill where Claude runs the delivery cycle — discover, plan, get sign-off, then build, review and ship through subagents. Puts an explicit human sign-off gate between planning and building.

skillproject-managementsubagentsdelivery
by bendusz Sep 3, 2026 6/10
skill GitHub

skills: Distribute AI Skills as Composer Dependencies

Packages AI skills so they install and version through Composer, PHP's dependency manager. Skills become a normal dependency in your project rather than files you copy around by hand.

skillscomposerphpdistribution
by roxblnfk Sep 3, 2026 6/10
skill GitHub

everything-skills: A Cross-Referenced Encyclopedia of 500+ Agent Skills

An encyclopedia-style curation of over 500 open-source agent skills, cross-referenced into a network and installable in one step as a Claude Code plugin marketplace. Chinese-localized with English coverage.

skillscollectionmarketplacecuration
by findscripter Sep 3, 2026 7/10
skill GitHub

cookbook: Battle-Tested Lessons From Real AI-Agent Coding Sessions

Lessons pulled from actual agent sessions that went wrong — Rust FFI/JNI crashes, silent Android UI failures, multi-agent git coordination — each written as scar, fix and check. Tool-agnostic across Claude Code, Cursor and Copilot.

lessonsdebuggingrustandroid
by AkashPriyadarshii Sep 3, 2026 6/10
skill GitHub

claude-scope: Session Forensics and a Visual Timeline From Transcripts

A /session-report skill that reads a session's own transcript and produces token, timing and conversation-shape analytics with a visual timeline. Installable as a plugin — useful for working out where a session actually spent its budget.

skillanalyticssessionplugin
by konradcinkusz Sep 3, 2026 7/10
skill GitHub

rune-codex-page: Production-Tested Prompts, Roles and Configs

A collection of prompts, agent roles and configurations for Claude and Codex that the author runs in production, kept private by default and published once they've proven out.

promptsconfigsrolescodex
by abraira85 Sep 3, 2026 5/10
skill GitHub

fitness-diet-planner: Weekly Training and Meal Plans From Body Data

A Codex skill generating personalized weekly training and daily meal plans from body data, goals, diet preferences and available equipment, driven by a deterministic calorie and macro engine that adjusts as progress comes in.

skillfitnessnutritioncodex
by Kyo-zmol Sep 3, 2026 5/10
skill GitHub

mellions-coxen: Durable Responsibility and Verification for Coding Agents

A discipline layer for frontier coding agents built around durable responsibility, adversarial verification, continuity across sessions and autonomous completion. Squarely aimed at agents that declare victory early.

skillsreliabilityverificationdiscipline
by LetA-Tech Sep 3, 2026 5/10
skill Reddit

An 11,000-Word Korean CLAUDE.md That Shipped a 30,000-Line Godot Game

BOY1 is a turn-based stealth puzzle for iOS — a discarded humanoid climbing the 30-floor tower that built him, on an 8x8 deterministic grid. The author doesn't code; Claude Code wrote all ~30,000 lines of GDScript over three months, and they credit an 11,000-word Korean CLAUDE.md as the reason it held together. Shipped to the App Store on Sep 1.

claude-mdgodotcase-studygame-dev
by OkSun790 Sep 3, 2026 8/10
skill GitHub

system-design-skill: Architecture With Capacity Math and Stress-Tests

A system design skill for coding agents covering mapping, designing, reviewing and evolving architectures, with capacity math, failure stress-tests and right-sizing gates. The right-sizing gates are the useful part — a check against agents over-engineering by default.

skillsystem-designarchitecturecapacity
by DAAS2 Sep 3, 2026 6/10
skill GitHub

vibe-ui-suite: Design Contracts and WCAG AA Gates for Coding Agents

Deterministic design contracts, component recipes and WCAG AA evaluation gates for Cursor, Claude Code, Windsurf and Antigravity. Makes accessibility a gate the agent has to pass rather than a review comment afterwards.

skillsdesign-systemaccessibilityui
by omid-io Sep 3, 2026 6/10
skill GitHub

skillstate: O(1) Prompt-Footprint Runtime for Long-Horizon Agent Skills

An implementation of the SKILL.state paper (arXiv:2608.26263) for Claude Code and opencode. It keeps a skill’s prompt footprint constant no matter how long the task runs, by holding progress in external state instead of an ever-growing context. Useful if your long-running skills keep blowing up the context window.

skillscontext-managementruntimeresearch
by vitkuz573 Sep 3, 2026 7/10
skill GitHub

deslop-GPT: Deletion-First Skill for Stripping Test Bloat and Dead Fallbacks

An Agent Skill that reviews a codebase looking for things to delete rather than add — redundant tests, "verification theater", and speculative fallback branches that never fire. It aims to preserve behavior while cutting the volume of code AI agents tend to pile up. A counterweight to agents that only ever write more.

skillscode-qualityrefactoringcleanup
by MrZoyo Sep 3, 2026 7/10
skill GitHub

robinhood-trading-agent-skills: SKILL.md for the Robinhood Trading MCP Connector

An open SKILL.md package that drives the Robinhood Trading MCP connector: market research, stock screening, portfolio and P&L monitoring, and pre-trade order review. Portable across Claude Code, Claude Desktop, ChatGPT, Cursor and other SKILL.md-aware agents. The pre-trade review step is a sensible guardrail for an agent touching a brokerage account.

skillsmcptradingfinance
by yashpatel-py Sep 3, 2026 6/10
skill GitHub

notebooklm-course-builder: Build Citation-Backed Courses in Google NotebookLM

An Agent Skill that turns source material into structured courses inside Google NotebookLM, with each claim traced back to a citation and verified rather than generated freely. Useful for anyone assembling training material who needs the output to be checkable.

skillsnotebooklmeducationcitations
by hmj1026 Sep 3, 2026 5/10
skill GitHub

deep-research-skill: Multi-Step Research With Parallel Subagents

An agent skill for deep research that fans work out to parallel subagents, keeps structured evidence, and emits rich output artifacts. Written for Cursor agents but the skill format carries over. Worth a look if your research prompts keep collapsing into one long unstructured answer.

skillresearchsubagentscursor
by TheAdamLabs Sep 3, 2026 6/10
skill GitHub

dialectic: A Skill for Reflective Dialogue, Not Answers

An agent skill that runs sustained back-and-forth to help you form and examine your own thinking instead of handing you a conclusion. Deliberately withholds the model's opinion so the reasoning stays yours. A different use of an agent than the usual do-this-for-me pattern.

skillthinkingdialoguereflection
by ivanoid Sep 3, 2026 6/10
skill GitHub

novelty-hunt: Search a Solution Space for Genuinely Original Ideas

A Claude Code skill that explores a solution space for original candidates and scores them without pruning away the odd ones too early. Every scoring mechanism traces to a measured result from the creativity-assessment literature. Useful for brainstorming where a normal model pass converges too fast.

skillideationcreativitysearch
by rwshiraishi Sep 3, 2026 6/10
skill GitHub

curtoom: ffmpeg Skills for Coding Agents

A set of ffmpeg-based skills that let coding agents encode, stitch, and verify video, including the verification step most ffmpeg wrappers skip. Encodes the practical knowledge of what actually ships rather than exposing raw flags. Useful for agents producing demo clips or media pipelines.

skillffmpegvideomedia
by ALCHEMINT-INC Sep 3, 2026 7/10
skill GitHub

new-app-scaffolding-skills: Repo Initialization With Security Guardrails

A set of agent skills for bootstrapping new repositories with common workflows, security guardrails, and baseline best practices already wired in. Covers the setup work usually repeated by hand at the start of every project. Worth adapting if your team has a house standard for new repos.

skillscaffoldingsecuritybootstrap
by iadknet Sep 3, 2026 6/10
skill Reddit

Fix Style Drift With Output Styles Instead of CLAUDE.md

A practical fix for Claude drifting back to technical prose mid-session: put style rules in a file under ~/.claude/output-styles/ rather than CLAUDE.md, since output styles land in the system prompt and are reinforced every turn. Keep keep-coding-instructions: true in the frontmatter so the style layers on top of the coding instructions instead of replacing them.

output-stylesclaude-mdconfigurationprompting
by Just-Arugula6710 Sep 3, 2026 7/10
skill GitHub

design-dna: Web Design Skill That Verifies the Rendered Page, Not the Code

A cross-host web-design skill for Claude Code and Codex that derives art direction from the project itself instead of applying a fixed style pack. A decision router picks choices per context, and a verification harness measures the rendered output rather than trusting the generated CSS.

designfrontendverificationcodex
by mjcreations123 Sep 2, 2026 7/10
skill GitHub

loadout: Product Leadership Skills From the Mission Built Ecosystem

An open-source skill pack that turns product leadership principles from the Mission Built book into operational agent skills. For PMs and leads who want their judgment encoded as repeatable prompts rather than tribal knowledge.

productleadershipskills
by missionbuilt Sep 2, 2026 5/10
skill GitHub

chem-properties-excel: Chemical Property Lookup to Annotated Excel

A Claude Code skill that extracts chemical names from messy input, queries 14 property fields across 12 sources, and writes an Excel workbook with per-cell provenance annotations. Handles dirty lists, clean lists, and partially filled sheets.

chemistryexceldataresearch
by jonathanwong0086 Sep 2, 2026 5/10
skill GitHub

ontology-skills: Build, Review and Refactor Domain Models and Taxonomies

A domain-agnostic methodology packaged as a Claude Code plugin for constructing and maintaining ontologies, domain models, taxonomies, and knowledge-graph schemas. Includes review and refactor paths, not just greenfield modeling.

ontologymodelingknowledge-graphskills
by mgillett43 Sep 2, 2026 6/10
skill GitHub

brand-playground: Compile Any Design System Into Your Brand's Tokens

Treats a design system as something to compile against your brand rather than adopt wholesale. Aimed at teams that want a consistent house style without hand-rewriting every component library they pull in.

design-systembrandingfrontend
by humanbird Sep 2, 2026 5/10
skill GitHub

auto-support: Answer Discord Questions From Public Docs Only, Fail Closed

A support agent constrained to answer only from public documentation, with fail-closed guards against leaking internal material and escalation to founders when it is unsure. A concrete pattern for grounding a customer-facing agent.

supportdiscordgroundingguardrails
by DaizeDong Sep 2, 2026 5/10
skill GitHub

gambit: Skills Library for Strategy, Research, Planning and Negotiation

A plugin of agent skills aimed at decision work rather than code: strategy, research, planning, risk management, negotiation, and execution. Useful if you use Claude Code as a thinking harness outside the editor.

strategyplanningresearchskills
by skyf0xx Sep 2, 2026 5/10
skill GitHub

xout: Falsification-Based CLAUDE.md Compiler With Evidence Receipts

Compiles a CLAUDE.md or AGENTS.md from behaviors you want eliminated, testing each rule by trying to falsify it and keeping a receipt of the evidence. An unusually rigorous take on why most rule files quietly stop working.

claude-mdrulesverificationagents-md
by brnyxx Sep 2, 2026 7/10
skill GitHub

nullius (tanyelai): A Claude Code Harness for Research That Trusts Nothing

A research harness built around refusing to take claims on authority — every assertion has to be traced back to a source the agent actually checked. For literature work and analysis where a confident summary is the failure mode.

researchverificationharness
by tanyelai Sep 2, 2026 6/10
skill Reddit

Demystifying How Skills and MCPs Actually Work Under the Hood

A clear technical explainer of how harnesses actually implement Agent Skills and MCP, aimed at people who have used both passively and want the mechanics. Good grounding before you write your own skill or server.

explainermcpskillsinternals
by shared_ptr Sep 2, 2026 8/10
skill GitHub

Huanyu-Skills: Six Field-Tested Agent Skills for a One-Person Company

A Chinese-language collection of six skills covering founder IP strategy, content prediction calibration, customer acquisition, deep reading, skill engineering, and video production. Built and iterated in public around a real solo-operator workflow.

chinesecontentsoloskills
by Huanyu-Hibiki Sep 2, 2026 5/10
skill GitHub

Enil-ling-pesing: End-to-End Penetration Testing and Security Research Skill

A Chinese-language agent skill covering the full penetration testing and vulnerability research workflow. Relevant for authorized security assessment work where the agent needs a structured methodology rather than ad hoc prompting.

securitypentestchineseskills
by enilmalus Sep 2, 2026 5/10
skill GitHub

daitsch: 74 Patterns That Stop German AI Text From Sounding Like AI

A German-language writing skill listing 74 tells, each paired with a plain rewrite and the cases where the original is actually correct. Ships a check script so the rules run rather than being advisory.

germanwritingeditingskills
by lord-helicon Sep 2, 2026 5/10
skill GitHub

unjargon: Make Opus 5 and Fable Write Plainly Without a Second Model

A skill plus output style that stops Claude inventing words and pushes it toward plain English or Chinese. Zero dependencies, no judge model, no API key — it changes how the primary model writes rather than post-processing.

writingoutput-styleplain-languageskills
by maxxiedddd Sep 2, 2026 6/10
skill GitHub

claude-migration-skills: Drupal 10 to 11, Gulp to Vite and PHP/Docker Bumps

A Claude Code plugin of migration skills for Dockerized, Makefile-driven web projects: Drupal 10 to 11, PHP and Docker version bumps, Gulp to Vite, Sass, jQuery 4, and PHP_CodeSniffer. Concrete upgrade paths rather than generic refactoring advice.

migrationdrupalphpvite
by JMAILLY Sep 2, 2026 6/10
skill GitHub

skills-radar: Crawl, Dedupe and Rank Skills Across Five Sources Into Obsidian

Aggregates Agent Skills from GitHub, skills.sh, skillregistry, npm and Hacker News, dedupes and ranks them, and sinks the result into an Obsidian knowledge base. Surfaces capability comparisons at the start of a task rather than requiring a manual search.

discoveryskillsobsidianaggregation
by tomtdhzz Sep 2, 2026 7/10
skill GitHub

skillc: A Skill That Turns Intent Plus Examples Into One Portable Skill File

Generates a single self-contained skill file from a description and a couple of examples, with portability as the design goal so it does not break when someone else installs it. Meta-tooling for people who write a lot of skills.

metaauthoringskillsportability
by baron-3dl Sep 2, 2026 7/10
skill GitHub

openmapstack: Reproducible Validated GIS Analysis on an Open-First Stack

An agent skill that runs GIS work end to end — authoritative data discovery through interactive maps — on OSM, Overture, STAC, DuckDB, PostGIS, QGIS and MapLibre. Emphasizes reproducibility and validation over one-off map generation.

gisgeospatialduckdbskills
by jaakla Sep 2, 2026 6/10
skill GitHub

Harness-Creator: Build a Project-Specific Claude Code Harness by Interview

Walks you through a structured interview and produces a harness tailored to the project, then validates and maintains it as the project changes. Addresses the gap between generic templates and a config that fits your repo.

harnessconfiginterviewskills
by tjdwls101010 Sep 2, 2026 6/10
skill GitHub

auditor-skill: Solana Security Audits With 1,346 Checks and Executable PoCs

A full audit-firm lifecycle as an agent skill for Solana programs: a Rust pre-scanner, cross-audit memory, 1,346 checks across 20 checklists, 131 catalogued attack vectors, and delivery of executable proof-of-concepts plus fix patches.

securitysolanaauditrust
by solanabr Sep 2, 2026 7/10
skill GitHub

Six Ready-Made Claude Code Subagents That Adapt Themselves to Your Repo

A French-language plugin shipping six subagents — quality, error handling, security, user guide, API reference, and project memory. On first run in a project Claude asks which to enable, installs them, and adapts their context to the repository, then reminds you to invoke them after code changes.

subagentsfrenchpluginquality
by blaisebarrette Sep 2, 2026 6/10
skill GitHub

agent-spec-reviewer: Review Claude Code Agent Definitions Against an Oracle

Reviews Claude Code agent definitions and grades the review's own detection power with an oracle. A Japanese-language project useful if you maintain many subagent specs and cannot tell which are actually well-written.

subagentsreviewjapaneseevaluation
by hatohato-lab Sep 2, 2026 5/10
skill GitHub

managing-up: Message Review and Coaching Based on Wes Kao's 15 Principles

Portuguese-language Claude Code skills for managing up: reviewing messages before you send them to a boss or senior stakeholder, and coaching on the underlying situation, grounded in Wes Kao's principles.

communicationcareerportugueseskills
by HelioFernandes404 Sep 2, 2026 5/10
skill GitHub

awesome-agent-skills: Rule Files Teaching Agents TypeScript, React and A11y

A collection of rule files that encode standards for TypeScript, architecture, React, Angular and accessibility, portable across Claude Code, Cursor, Windsurf and MCP clients. Standards as installable context rather than a wiki page nobody reads.

standardstypescriptreactaccessibility
by danielteles Sep 2, 2026 6/10
skill GitHub

datacenter-geo: 59-Factor AI Data Center Siting Harness With Evidence Tiers

An agent harness for data center site selection covering power, water, climate, land, connectivity, regulation, community and supply chain, where every number carries the tier of evidence behind it. Domain-specific, but the evidence-tier pattern generalizes.

researchinfrastructureevidenceharness
by not-vibhu Sep 2, 2026 5/10
skill GitHub

solidjs-v2-skills: Write and Migrate SolidJS 2.0 Without React Reflexes

Agent skills for solid-js 2.x that suppress the React and Solid 1.x patterns models default to, covering writing new code, migrating old code, and reviewing. Useful template for any framework whose training data lags its current version.

solidjsfrontendmigrationskills
by khmm12 Sep 2, 2026 6/10
skill GitHub

nativish: Writing Coach Skill for Non-Native English Speakers

A skill that coaches rather than silently rewrites, aimed at non-native speakers who want to understand why a phrasing reads oddly. Teaching-oriented rather than a one-shot polish pass.

writingenglishcoachingskills
by denys-petryniak Sep 2, 2026 5/10
skill Reddit

Paste a Job Posting, Get That Company's Interview Running in Your Editor

A skill that researches a company's actual screen from recent candidate reports, writes an original question in that shape, and opens a full interview repo with problem statement, solution stub, sample tests and a running clock. Hidden tests grade submissions without revealing which failed, and a Python engine owns every number the agent could hallucinate.

interviewpracticetestingskills
by Complex-Age1704 Sep 2, 2026 6/10
skill GitHub

fun-skills: Generative SVG Scenes Graded by Deterministic Physics Evals

Skills that produce SVG interior scenes and hand-inked sketchnotes, scored by deterministic physics evals and metric arithmetic in a self-improving agent loop. The eval design is more interesting than the output.

svggenerativeevalsskills
by surendranb Sep 2, 2026 5/10
skill GitHub

apply-kit: Faithfully Tailor a LaTeX Resume to a Job Posting

Claude Code skills that adapt an existing LaTeX resume to a specific posting with fidelity as the constraint — reweighting and rephrasing what is there rather than inventing experience.

resumelatexjob-searchskills
by DhruvPrajapati4 Sep 2, 2026 6/10
skill GitHub

fanfic-AU-apocrypha: An Editorial Constraint Set for AU and Fanfiction

Explicitly not a generator: a constraint set covering canon layering and prose tells for writing alternate-universe fiction with an LLM, in Chinese and English. Constrains an agent's editorial choices rather than producing text on demand.

writingfictionchineseconstraints
by sylviachangdou-prayer Sep 2, 2026 5/10
skill GitHub

baton (shanemhamilton): Handoffs That Tell the Next Session Its Model Tier

A portable session-handoff skill that passes not just state but operating parameters: which model tier to use, solo or swarm mode, review depth, and whether to fan out subagents. Framework-agnostic, derived from metaswarm.

handoffsessionscontextskills
by shanemhamilton Sep 2, 2026 6/10
skill GitHub

Five Skills: Interview Before Building, Restructure Brain Dumps, Audit Skills

Five self-contained Claude skills covering requirements interviews, turning brain dumps into structure, coaching beginners, authoring new skills, and auditing an existing skill library. Install docs for Claude Code, the Claude apps, Codex and ChatGPT.

skillsauthoringauditrequirements
by innovationengines Sep 2, 2026 5/10
skill GitHub

claude-proof-of-fix: Turn a UI Change Into a Machine-Checked Before/After

Two Claude Code skills that convert delegated UI work into a reviewable artifact — an interaction video, annotated stills, and a machine-checked verdict. Evidence you can review in seconds instead of pulling the branch.

uiverificationreviewvideo
by leonbeckert Sep 2, 2026 7/10
skill Reddit

A Repository of 600+ Structured Agent-First UI Components

A component library built explicitly as agent context: 600+ structured components an agent can draw from when building UI, with an early prototype of agentic search over them. Author is asking for feedback on direction.

componentsuicontextlibrary
by BuffaloConscious7919 Sep 2, 2026 5/10
skill GitHub

infra-audit: Read-Only Security Audit of a Deployed Server as a Skill

Audits a live server's host, proxy, containers, datastore roles, DNS, CI pipeline and public HTTP surface without changing anything, then produces an evidence-backed report, an ordered fix plan, and guided remediation.

securityauditinfrastructureskills
by manuacl Sep 2, 2026 7/10
skill GitHub

distributed-architect: Catch Distributed System Bugs Before Production

A reasoning framework plugin that gives Claude Code the failure-mode checklist for distributed systems — partial failure, ordering, idempotency, clock skew — so it reviews for the bugs models routinely miss.

distributed-systemsreviewarchitectureplugin
by Langerrr Sep 2, 2026 6/10
skill GitHub

help-center-markdown: Agent Skill for a markdown-backed Next.js help center

An Agent Skill that scaffolds a complete help center from markdown files with no CMS. It generates static landing, category, tag and article pages in the Next.js App Router, plus ranked client-side search, locale fallback with hreflang, JSON-LD and a sitemap. A CI content validator keeps the frontmatter and slugs honest, so docs sites stay buildable as they grow.

skillnextjsdocumentationmarkdownstatic-siteseo
by timerise-ai Sep 2, 2026 6/10
skill GitHub

review-council: Adversarial multi-lane code review skill for agent CLIs

A portable review skill that runs several adversarial reviewer lanes over the same diff instead of a single pass. It ships as an Agent Skill, so the same package works in Claude Code, Codex, and Cursor. Useful if you want structured, opinionated review rather than one generic summary.

code-reviewskilladversarialportable
by ianpcook Sep 2, 2026 7/10
skill GitHub

sprite-forge: Pixel-art sprite, pose and animation toolkit with a CC skill

A Python toolkit that turns arbitrary pixel-art images into clean game sprites, then generates new poses and animation frames from them. It comes with a Claude Code skill that encodes the full playbook, so the agent knows the pipeline rather than improvising it. Aimed at solo game devs who need sprite sheets without an artist.

gamedevpixel-artpythonskill
by isabellagreco1997 Sep 2, 2026 6/10
skill GitHub

claude-skills: llm-council, cc-changelog and fal-image-generator

Three general-purpose Claude Code skills in one repo: llm-council for multi-model deliberation, cc-changelog for generating changelogs from session history, and fal-image-generator for image generation via fal. Each is self-contained, so you can install only the one you need. A good sampler if you are starting a personal skills collection.

skillchangelogimage-generationmulti-model
by josefheld Sep 2, 2026 6/10
skill GitHub

claude-skill-suite: Security gates, eval harness and review skills

A bundle of Claude Code skills organized around running models cost-effectively: secret scanning and commit gates, an eval harness, token-squeeze and compact-io for context control, and review skills like audit, skill-vet, and research-brief. Also includes a read-only advisor that proposes repo reorganizations without touching files. Broad enough to cherry-pick from.

skillsecurityevalcost-control
by Evan-Daruwalla Sep 2, 2026 7/10
skill GitHub

ai-regression-guard-plus: Claude Code skill for AI regression testing

A skill that drives regression tests around AI features, API routes, and bug fixes, with both sandbox and live check modes. Built on affaan-m/ECC. Useful when nondeterministic model output makes ordinary test suites insufficient.

skilltestingregressionapi
by agenticluke Sep 2, 2026 6/10
skill Reddit

Does CLAUDE.md earn its place when README.md already exists?

A recurring community argument laid out plainly: project description belongs in README, style constraints belong in rules, and build or deploy procedures belong in a skill, so CLAUDE.md may be duplicated context with no unique job. The thread is a useful frame for auditing your own CLAUDE.md. Relevant to anyone trimming context to save tokens.

claude-mdreadmediscussionconventions
by blender-bender Sep 2, 2026 5/10
skill Reddit

probe: Six Subagents That Critique Your Ideas From Different Angles

A free Claude Code plugin that sharpens raw ideas and decision drafts by running six subagents that each attack the text from a different angle. Aimed at thinking work rather than code, and deliberately unflattering.

pluginsubagentscritiquedecision-making
by danmakesthings Sep 1, 2026 7/10
skill Reddit

opencode-worker: Delegate Tasks From Claude Code to a Local Model

Claude Code can't hold both the Anthropic API and a local API in one process, so this pair of skills fits a local model on your machine, configures opencode to serve it, and teaches Claude Code to hand work off to a headless opencode worker. Written around Qwen3.8-27B to stretch a subscription further.

skilllocal-modelsopencodedelegationcost-saving
by SailingToFenway Sep 1, 2026 7/10
skill GitHub

openspec-plus: Agentic Skills for Spec-Driven Development

Extends OpenSpec's spec-driven development with skills covering discovery, requirements, design decisions, execution planning, and execution itself. Harness-neutral — works with Claude Code, OpenCode, GitHub Copilot, and other coding agents.

skillspec-drivenopenspecplanning
by sudokar Sep 1, 2026 7/10
skill GitHub

skills-that-say-i-dont-know: Nine Eval Skills With Stated Refusals

Nine Claude Skills for evaluating AI systems, including the skills you install to do that evaluating. Each one carries an explicit refusal condition, so the skill declines rather than guessing when it is out of its depth.

skillevaluationrefusalshonesty
by ityaadiii Sep 1, 2026 7/10
skill GitHub

ml4t/skills: Leakage-Safe Quant ML and Backtesting Agent Skills

Agent skills for machine learning in algorithmic trading, focused on avoiding lookahead leakage, plus backtesting, validation, and autonomous research workflows. Aimed at people applying ML to markets rather than general coding.

skillquanttradingbacktestingml
by ml4t Sep 1, 2026 6/10
skill GitHub

buttonmasher: Finds the Bugs Impatient Users Cause

A skill that hunts a specific bug class — the thing that should happen once happening twice, and the thing that was already over happening again. Double submits, re-entrant handlers, and races triggered by users who don't wait.

skilltestingrace-conditionsqa
by Nova-47 Sep 1, 2026 7/10
skill GitHub

agent-native-design: Design CLIs That Serve Humans and Agents Both

A design-and-review skill for building command-line tools that work equally well for people typing them, AI agents calling them, and orchestration systems wiring them together. Covers the design pass and the review pass.

skillcli-designagent-nativereview
by Agents365-ai Sep 1, 2026 7/10
skill GitHub

midi-pianoroll-render: MIDI Files Into Annotated Piano-Roll PNGs

Renders MIDI into polished piano-roll images in either vertical Synthesia style or horizontal DAW style, with chord labels and automatic key detection. Useful when an agent needs to show musical structure visually.

midimusicvisualizationrendering
by flobo3 Sep 1, 2026 5/10
skill GitHub

interaction-doctor: A Conflict Matrix for Touch Gestures

Catalogues the ways touch gestures fight each other — drag versus scroll, tap versus long-press, and the rest — as a matrix an agent can check a UI against. Aimed at mobile and touch interfaces where these conflicts are easy to ship by accident.

skilluxtouchmobilegestures
by saramjh Sep 1, 2026 6/10
skill GitHub

super-prototyping: Copy Any App's UI as Plain HTML Artboards

Prototype on a local canvas made of plain HTML artboards — drop a file in a folder and it renders, with no design tool and no build step. Every color and metric in the output traces back to an actual measurement of the source UI.

skillprototypingui-designhtml
by ReScienceLab Sep 1, 2026 6/10
skill GitHub

explain-c-module: Embedded C/C++ Module Explainer With Call Graphs

Explains embedded C/C++ modules, RTOS behaviour, drivers, interrupts, DMA, and low-power flows, generating Markdown or HTML docs with call graphs. Written for junior engineers who can read code line by line but lack hardware intuition. Supports Claude Code with optional Codex hooks.

skillembeddedcrtosdocumentation
by gc9768 Sep 1, 2026 6/10
skill GitHub

claude-content-kit: Script to Rendered Reel, Edited With Remotion

Claude skills that take script-based Reels and TikToks from idea through to a rendered video, including automatic editing via Remotion. Covers the whole pipeline rather than just the writing.

skillvideoremotioncontent-creationsocial-media
by bendemartin97 Sep 1, 2026 6/10
skill GitHub

navigator: Context Engineering So Sessions Last 20+ Exchanges

Targets the failure where a session degrades and crashes around the seventh exchange. Applies context engineering to Claude Code so long sessions keep going and tasks actually get finished.

skillcontext-engineeringlong-sessionsreliability
by alekspetrov Sep 1, 2026 7/10
skill GitHub

reisi007/agents-skills: Portable Skills Registered Once, Globally

A personal set of portable Agent Skills following the .agents/skills spec — ui-review, codegraph-project-setup, and agent-config — kept in one central repo and registered globally through OpenCode's skills array rather than copied into each project. Documented in German.

skillportableopencodeagent-skills-spec
by reisi007 Sep 1, 2026 5/10
skill GitHub

Matt Pocock Skills Orange Book: 37 Skills, Annotated in Chinese

A Chinese-language guide to 37 Matt Pocock skills for newcomers to AI-assisted development, with an anonymized UI client example plus Excalidraw and hand-drawn diagrams.

skillguidechineselearningmatt-pocock
by TeFuirnever Sep 1, 2026 6/10
skill GitHub

brooks-lint: Code Review Grounded in 12 Classic Engineering Books

Diagnoses code decay risk with citations back to twelve classic software engineering books, applying severity labels across six analysis modes including a full-sweep auto-fix. Arguments come with a source rather than a vibe.

skillcode-reviewcitationstechnical-debt
by hyhmrright Sep 1, 2026 7/10
skill GitHub

talent-search-skill: Four-Channel Sourcing for AI and Quant Hires

Searches papers, GitHub, teams, and community channels, cross-verifies candidates, and writes them to Excel with a persistent candidate library and a weekly talent radar. Works with Claude Code, WorkBuddy, and any SKILL.md host.

skillrecruitingsourcingresearchexcel
by cw20051219-commits Sep 1, 2026 6/10
skill GitHub

CONCISE: A Skill That Cuts Prose Filler

Strips padding and filler from generated prose. Small, single-purpose, and aimed at the verbosity that creeps into agent output.

skillwritingconcisionediting
by 0xyph3r Sep 1, 2026 5/10
skill GitHub

explain-for-dumb: Code Changes Explained Without the Jargon

Explains a diff in plain human language, in either a "for dummies" narrative or a per-file walkthrough. For handing changes to people who need to approve them but don't read code.

skillexplanationcode-reviewcommunication
by MotleyWildside Sep 1, 2026 6/10
skill GitHub

manifest-dev: Skills for Output You Can Ship With Minimal Review

Skills for agentic coding CLIs aimed at two things at once — work that was worth doing, and output finished enough that reviewing it doesn't cost more than writing it would have.

skillqualityreviewagentic-cli
by doodledood Sep 1, 2026 6/10
skill GitHub

dining-places-skill: Your Google Maps Saves as a Taste Model

Turns your saved Google Maps places into a personal dining knowledge base and gives eating-out recommendations matched to the taste that history implies.

skillgoogle-mapsrecommendationspersonal-data
by ddalgrande Sep 1, 2026 5/10
skill GitHub

travel-agent-skills: Live Flight and Hotel Pricing for Agents

Cheapest-date search, fare watching, trip planning, hotel search, and rate-parity monitoring against live pricing. Works over MCP or plain REST, so it isn't tied to one harness.

skilltravelflightshotelspricing
by mtnrabi Sep 1, 2026 6/10
skill GitHub

job-market-recon: Survey What a Job Market Actually Pays

A Claude skill for surveying real compensation in a market before you apply to it, shipped alongside a stipend survey of nine Indian job boards that found 89% of advertised embedded internships unpaid.

skilljob-searchresearchcompensation
by Shiviansh Sep 1, 2026 5/10
skill GitHub

seo-ai-visibility-skills: SEO Checks Paid Per Call in USDC

SEO and AI-visibility skills for coding agents that bundle the underlying data, billed per check in USDC on Solana via x402 rather than requiring an API key or subscription.

skillseox402micropaymentssolana
by zaialamm Sep 1, 2026 5/10
skill GitHub

gidila91/claude-skills: Nine Skills for Shipping Production AI Apps

Nine Claude Code skills covering Lovable, Supabase, Stripe, accessibility under Israeli and EU law, and a Hebrew writing standard — the stack for shipping a real product rather than a demo.

skillsupabasestripeaccessibilityhebrew
by gidila91 Sep 1, 2026 6/10
skill GitHub

zincio/skills: Buy From 50+ US Retailers With a URL

An agent skill over the Zinc API for searching, buying, tracking, and returning items across Amazon, Walmart, Target, and more than 50 other US retailers. Anything with a product URL is purchasable.

skillcommerceshoppingzinc-apiautomation
by zincio Sep 1, 2026 6/10
skill GitHub

report-to-the-boss: Making Claude's Reports Actually Readable

A skill built from a corpus study of Claude's own writing tics. Its thesis is to name the referent rather than ban the words, which fixes the vagueness that word-level style rules leave behind.

skillwritingreportscommunicationstyle
by YuanpingSong Sep 1, 2026 7/10
skill GitHub

taxue-creative-style: A 14-Family Illustration Style Library

An illustration skill with fourteen style families and a deep variant library, seven-dimension prompt optimization, meta-prompt authoring, and local memory of your creative preferences. Documented in Chinese.

skillillustrationimage-generationpromptingchinese
by taxueseek Sep 1, 2026 5/10
skill GitHub

vibe-template: One AGENTS.md and One Gate Command in Any Language

An AI-agnostic project template: a single AGENTS.md every coding agent reads, one `npm run gate` that works regardless of language, and a 70-entry framework registry (Laravel, Next.js, NestJS, Tauri, Electron, Flutter, Spring Boot and more) that detects your stack and writes the commands for you.

templateagents-mdframework-detectionpolyglot
by ahnafudin Sep 1, 2026 7/10
skill GitHub

audio-tldr-skill: Summarize Video, Audio, and Podcasts Locally

Summarizes videos, audio files, and podcasts using local transcription with a cache, so repeat runs over the same media don't re-transcribe or leave the machine.

skilltranscriptionsummarizationlocal-firstpodcasts
by AugustusW Sep 1, 2026 6/10
skill GitHub

session-relay: Carry a Conversation to Another AI by Saying "Continue"

Moves an in-progress conversation between Claude Code, Codex, and Claude mobile without writing handoff notes — you just say to pick up where you left off. Documented in Japanese and English.

skillhandoffcross-harnesssession-continuity
by shoujiki-panman Sep 1, 2026 7/10
skill GitHub

storops: Safe Windows Storage Diagnosis and Cleanup for Agents

Lets an agent diagnose, clean up, and migrate Windows storage safely, built on WizTree for the scanning. Guards the destructive half of disk work rather than trusting the agent with rm.

skillwindowsstoragecleanupsafety
by tzzs Sep 1, 2026 5/10
skill GitHub

Productside Market Intelligence: 22 Skills for PMs and Analysts

Twenty-two instructional skills that teach market and competitive intelligence as collection disciplines rather than one-off research, aimed at product managers, product marketers, and business analysts.

skillmarket-researchcompetitive-intelligenceproduct-management
by Productside Sep 1, 2026 5/10
skill GitHub

plainspoken: Remove the Tells of AI Writing, Keep the Voice

An editing skill that strips the giveaways of machine-written prose while preserving the writer's own voice. Runs under Claude Code, claude.ai, or any capable model.

skillwritingeditinghumanizingstyle
by erikkurtu Sep 1, 2026 6/10
skill GitHub

stele: Task State in Markdown, Written Before the Work Not After

Written for getting rate-limited mid-task or locked into one harness by the context it holds. Keeps task state in plain markdown recorded ahead of the work rather than at exit, so any agent can resume cold. Works with Claude Code, Codex, and Cursor.

skillstatehandoffrate-limitscross-harness
by johnwangwyx Sep 1, 2026 7/10
skill GitHub

academic-paper-writing-skill: Ideation Through Rebuttals and Slides

A capability-routed, evidence-first skill covering ideation, literature review, statistics, figures, writing, peer review, rebuttals, theses, and paper-to-slide conversion — most of the academic pipeline in one place.

skillacademicwritingresearchpeer-review
by xcl2005 Sep 1, 2026 6/10
skill GitHub

ecko-lang/skill: The Language Where ai Is a Keyword

A Claude Code skill for Ecko, a language that treats ai as a first-class keyword. Every code sample in the skill is executed before it ships, so the examples are known to run.

skillprogramming-languageeckoverified-examples
by ecko-lang Sep 1, 2026 5/10
skill GitHub

ivan: An Executive Assistant That Pushes Back on the Merits

An assistant persona that asks when a request is ambiguous, distinguishes its own conclusions from yours, and objects on substance rather than agreeing. Ships in two builds: Claude Code/Cowork and Codex/ChatGPT Work. Documented in Russian.

skillassistantpersonapushbackrussian
by Coman-os Sep 1, 2026 5/10
skill GitHub

i-hate-ui: Deconstruct, Mirror, and Rebrand Any Web UI

Takes apart an existing web interface, mirrors it visually, and rebrands it — a cloning engine for when you want to start from a known-good layout rather than a blank page.

skilluicloningrebrandingweb-design
by khan-masud Sep 1, 2026 6/10
skill GitHub

macbook-agent-performance-profiles: AGENTS.md Tuned to Your RAM

Performance-first AGENTS.md and CLAUDE.md profiles matched to MacBooks from 8 GB to 128 GB, so the agent's parallelism and tooling assumptions fit the machine it's actually on.

claude-mdagents-mdmacosperformanceconfiguration
by saitakarcesme Sep 1, 2026 6/10
skill GitHub

brainstorm-questionnaire: Interactive HTML Decision Pages, Not Chat Q&A

Generates interactive HTML pages for product, website, and brand decisions, with multi-select pills, notes, autosave, export, and a live design lab. Deliberately not a back-and-forth chat questionnaire.

skillbrainstorminghtmldecisionsinteractive
by lareesahu Sep 1, 2026 6/10
skill GitHub

agentic-os-plus: A Lasting Multi-Agent System With File Memory

A Claude Code skill for a persistent multi-agent setup backed by file-based memory and local task tracking, so the system survives past a single session. Built on affaan-m/ECC.

skillmulti-agentmemorytaskspersistence
by agenticluke Sep 1, 2026 6/10
skill GitHub

kimi-first: Kimi Types, Claude Thinks and Verifies

Routes implementation work orders to the Kimi Code CLI while Claude keeps the thinking and verification. A port of steipete's codex-first to Kimi.

skilldelegationkimicost-savingverification
by boringmarketer Sep 1, 2026 7/10
skill GitHub

burn-before-reset: Turn Expiring Quota Into Reviewable Work

An agent skill plus a deterministic runner that spends quota you're about to lose on your actual backlog, hard-stopping before the reset. Burns down work rather than tokens.

skillquotabacklogautomationrate-limits
by steven-pku Sep 1, 2026 7/10
skill GitHub

marketread: Market Research From What Buyers Actually Say in Public

Interviews you about the business, mines public buyer language, and returns evidence-labeled findings with a ranked action plan. Free, no signup, and works with Claude, Codex, or any assistant.

skillmarket-researchevidencefree
by rogueduda Sep 1, 2026 6/10
skill GitHub

agent-skills-zh: Chinese-First Agent Skills for Claude Code and Codex

A skill pack aimed at Chinese-language workflows: translating docs to Chinese, downloaders for WeChat, Xiaohongshu, and X, repo hygiene checks, and GPT-image prompt helpers. Installs with a single `npx skills add` command and works across Claude Code and Codex.

skillschinesei18ntranslationcontent-tools
by hanzhangzzz Sep 1, 2026 6/10
skill GitHub

streamlit-security-audit-skill: Security Audit Playbook for Streamlit + Supabase Apps

A Claude Code skill encoding a security-audit process for Streamlit Community Cloud apps backed by Supabase or Postgres. It ships threat modeling, ten stack-specific traps the author actually hit in production, and four verification approaches. Documentation is bilingual (Chinese and English).

skillsecuritystreamlitsupabaseauditpostgres
by lml679939-cmyk Sep 1, 2026 6/10
skill GitHub

app-doctor: 39-Point Security and Launch-Readiness Audit That Fixes What It Finds

A portable agent skill that audits a web app on two axes — a 39-point security checklist and launch readiness covering legal, auth, polish, and retention — then reports each gap with its fix and implements them. Coverage is deepest on the Supabase, Vercel, and Stripe stack.

skillsecurityauditlaunch-checklistsupabasevercelstripe
by cryptozachla Sep 1, 2026 7/10
skill GitHub

agile-team-skill: A Simulated Agile Team for Solo Builders

Gives a project the roles and ceremonies of a senior software team — planning, review, and delivery discipline — without needing other people. Aimed at solo developers who want structure and checkpoints instead of an unbroken stream of ad hoc prompts.

skillagileplanningprocesssolo-devsubagents
by thecoderbuddy Sep 1, 2026 6/10
skill GitHub

CrewWatch: Ready-Made .claude/ Kit With 16 Skills, 5 Subagents, 4 Commands

A drop-in .claude/ directory bundling 16 skills, 5 subagents, 4 slash commands, and MCP server config. Its distinguishing idea is a multi-agent review policy where no agent reviews its own work, so critique always comes from a fresh context. A quick way to bootstrap a structured Claude Code setup instead of assembling one piece by piece.

skillssubagentscommandscode-reviewstarter-kit
by mateusands Sep 1, 2026 7/10
skill GitHub

rust-skills-comprehensive: Advanced Rust Skills From Google's Course

A set of Claude Code skills covering intermediate-to-advanced Rust: ownership, concurrency, unsafe code, FFI, and API design. The material is adapted from Google's Comprehensive Rust course, so the guidance follows an established curriculum rather than ad-hoc notes. Gives the agent concrete reference material when working in Rust codebases.

rustskillsownershipconcurrencyffi
by takurot Sep 1, 2026 7/10
skill Reddit

agent-scripts + lite-tools: Quiet Build and Test Output for Agents

A set of local CLI wrappers (mvn-lite, npm-lite, go-lite) that run the real build and test tools but collapse successful runs into a compact result, with full diagnostics preserved on failure. The author measured 98-99.99% output reduction on green runs, including one test that dropped from 1,476 lines to a single line. A companion lite-tools skill teaches Claude Code when to reach for the wrappers.

context-windowbuild-toolstestingcliskills
by fykup Sep 1, 2026 8/10
skill GitHub

agent-memory-skill: Semantic Search Over Your Agent's Memory Directory

Indexes your coding agent's memory directory into a local Mnemosyne OS vault and makes it searchable by meaning rather than filename. Because recall goes through search, the memory store can grow past what fits in a context window. Aimed at agents whose memory files have outgrown being loaded wholesale each session.

memorysemantic-searchvaultlocal-firstskills
by Mnemosyne-OS Sep 1, 2026 7/10
skill GitHub

feature-spec: Non-Contradicting Multi-Doc Specs With a Facts Registry

An agent skill for feature specs spread across several documents, keeping a single facts registry so the docs cannot contradict each other. Mechanical audits catch drift, and a verify mode refuses to mark something shipped until there is evidence behind the claim. Built for teams where agent-written specs outpace anyone's ability to read them all.

specsdocumentationverificationauditskills
by CesarRivasP Sep 1, 2026 7/10
skill Reddit

sonpus: A Skill That Makes Opus 5 Terser and Less Prone to Overengineering

A slash-command skill that constrains Opus 5 toward Sonnet-like behavior: fewer status messages, less overengineering, less overthinking. The author reports roughly 37% fewer messages in a controlled test and says it stacks with their /hush skill. Worth a look if you find Opus chatty on routine tasks.

skillsopusverbositypromptingslash-commands
by Jonathanproductions Sep 1, 2026 6/10
skill GitHub

seo-audit-skill: 108 SEO Audit Rules Across 12 Categories

A command-line SEO audit tool packaged as a Claude Code skill, applying 108 rules across 12 categories to any site. Covers SEO best practices, Core Web Vitals, security headers, structured data and accessibility. Gives an agent a concrete rubric instead of vague 'improve the SEO' instructions.

seoauditcliweb
by seo-skills Aug 31, 2026 6/10
skill GitHub

claude-code-usage-limits: Let Claude See Your Remaining Budget

Surfaces Claude Code usage limits to the model rather than only to you, so every reply is planned around what actually fits in the remaining budget. The idea is to avoid starting work the session cannot finish before the quota resets.

usage-limitsquotacontextplanning
by ridelink0 Aug 31, 2026 6/10
skill GitHub

reverse-skill: Structured Learning Path for Reverse Engineering

A skill that maps out essential cybersecurity and reverse engineering topics as a structured learning path. Aimed at using an agent as a study guide through a large, poorly-ordered field rather than as an exploit tool.

securityreverse-engineeringlearningskill
by Saprophytic-seattle561 Aug 31, 2026 5/10
skill GitHub

efficient-fable-orchestrator: Delegate Implementation to Cheaper CLIs

A Claude Code skill that reframes the session as a quota-conscious orchestrator: it plans at a high level and hands implementation work to cheaper AI CLIs (Codex, Grok) invoked directly as subagents. Aimed at users who hit Claude limits on long builds but want to keep the planning quality.

orchestrationsubagentsquotamulti-model
by Taleef7 Aug 31, 2026 6/10
skill GitHub

SKILL.md Skills for Planning, Adversarial Review and Adjudication

A small set of reusable SKILL.md agent skills covering application planning, adversarial review of work, and adjudication between conflicting outputs. The adversarial review and adjudication pair is useful if you run multiple agents and need a tie-breaker.

skillsreviewplanningadversarial
by JacobStephens2 Aug 31, 2026 5/10
skill GitHub

OP-teardown-any-website: Forensic Website Teardown for Claude Code

A skill that does a curl-first source capture of a target site, reads the code deeply, verifies findings against the live page, and emits a spec detailed enough to rebuild the site pixel-for-pixel. Useful for competitive analysis or reconstructing a design you only have in production.

webanalysisspecreverse-engineering
by vb-tyagi Aug 31, 2026 7/10
skill GitHub

claude-kit-mentorados: One-Command Claude Code Starter Kit (Portuguese)

A Portuguese-language Claude Code starter kit installable with a single command: global rules, settings, skills, slash commands, teaching docs, and CI/Playwright templates. Built for mentees being onboarded onto Claude Code, so it doubles as a curriculum.

starter-kitportugueseonboardingtemplates
by VAMOO-AI Aug 31, 2026 5/10
skill GitHub

digital-employee-pack: Chinese Skill Pack With Guard Hooks and SOPs

A Chinese-language productivity pack that turns Claude Code or Codex into a 'digital employee' for office work: six skills, protective hooks, and workflow SOPs. Aimed at non-engineering knowledge work rather than coding.

chineseskillshooksproductivity
by Hahaknight Aug 31, 2026 5/10
skill GitHub

claude-plugins: Grant Review, Citation Verification, Fabrication Audits

A Claude Code plugin marketplace aimed at research and clinical work: grant review, critical-care consults, citation verification, fabrication auditing and prompt optimization. The citation-verification and fabrication-audit plugins are broadly useful outside that niche.

pluginsresearchcitationsmarketplace
by neelshah4 Aug 31, 2026 6/10
skill GitHub

clayline-ads: Gated Skill That Builds a Claymation-Style Video Ad

A Claude Skill that takes a rough idea to a finished claymation-style video ad: brief, plan, style lock, keyframe stills, video clips and audio. Each phase ends at a review checkpoint, so the pipeline cannot run away with your budget.

videocreativegated-workflowads
by likeitdigital Aug 31, 2026 6/10
skill GitHub

dax-for-agents: Canonical DAX Language Reference for AI Agents

A DAX reference written for AI agents rather than humans: every function with its signature and semantics, plus the gotchas the official documentation leaves out. Drop-in context for agents working on Power BI models.

daxpower-bireferencecontext
by CSalcedoDataBI Aug 31, 2026 5/10
skill GitHub

claude-cloud-env: Bootstrap and SessionStart Scripts for Cloud Envs

Bootstrap and session scripts for Claude Code cloud environments: a setup-script body plus a SessionStart hook. A working starting point if you are standing up cloud sessions and need the environment prepared consistently.

cloudbootstrapsessionstarthooks
by LukeEvansTech Aug 31, 2026 6/10
skill Reddit

A Three-Line CLAUDE.md Rule That Reins In Opus 5 Verbosity

A short global CLAUDE.md response-style section instructing brief, request-specific answers with no excess explanation, leaving follow-up detail to the user to request. The author reports responses became markedly tighter afterwards. A minimal config tweak worth trying before reaching for heavier prompt engineering.

claude-mdverbosityconfigurationprompting
by Anxious-Turnover-631 Aug 31, 2026 6/10
skill Reddit

Launchify: A Claude Code Skill That Asks Everything Before You Ship

Turns the vague prompt "make this production ready" into an explicit checklist skill covering security, auth, dead code, tests, deployment, backups, privacy policy, rate limits, dependency vulnerabilities and half-finished features. Replaces the giant ad-hoc prompt chains people write after Claude finishes building. Open source.

production-readinesschecklistsecurityshipping
by jacobpowaza Aug 31, 2026 7/10
skill Reddit

Two Meta Ads Skills, Debugged by Running Them Instead of Proofreading Them

Meta's targeting IDs are 13-16 digit numbers that can't be guessed from an interest name, and no Meta Ads MCP tool returns them — so agents get 90% of a campaign built and stall on the audience. The author wrote two skills to close that gap, then found two bugs only by actually executing them. Worth reading for the testing lesson as much as the skills.

meta-adsmarketingskill-authoringtesting
by PerformanceTimely356 Aug 31, 2026 6/10
skill Reddit

Two Skills: Turn a Repo Into Slides, Then Detect When They Go Stale

One skill renders a repository into a single-file HTML slide deck; the other reports later which slides no longer match the code. Every claim records its source file, exact line range and a hash of those lines, so checking is plain standard-library Python — no model, no network, no tokens. It distinguishes MOVED from genuinely changed content, making it cheap enough to run on every pull request.

documentationdrift-detectionslidesci
by stack_underfl0w Aug 31, 2026 7/10
skill GitHub

pm-manager: A Local .pm Governance Skill Pack That Tells Agents What to Fix Next

A Spec Kit-inspired skill pack that keeps project governance in a local .pm directory so coding agents can see priorities instead of guessing. Turns a backlog into something an agent can act on within a session. Works across AI coding agents rather than being Claude-only.

project-managementgovernancespec-drivenskills
by wei63w Aug 31, 2026 5/10
skill GitHub

agent-skills: Product Design Skills for Claude Code and Antigravity IDE

A collection of product design-focused agent skills usable from Claude Code and the Antigravity IDE. Targets the design side of the workflow rather than pure implementation. Useful if you want design reasoning inside the same agent session as the code.

product-designskillsantigravity
by Uwayxt Aug 31, 2026 5/10
skill GitHub

lodestone: Pull Relevant Code by Meaning, Not by Name

An Agent Skill for Claude Code that surfaces the code that actually matters for a task, matching semantically rather than on identifier names. Reduces the amount of repo the agent has to read before it can act. Drops in as a skill with no separate service.

semantic-searchcontextcode-navigationskills
by choiHkk Aug 31, 2026 6/10
skill GitHub

iwe-org/skills: Graph-Aware Reads and Refactors of Markdown Knowledge Bases

Claude Code skills built for IWE that treat a markdown knowledge base as a graph rather than a pile of files. Supports navigating and refactoring across note links safely. Aimed at people whose notes are a real structure, not just a folder.

knowledge-basemarkdownrefactoringskills
by iwe-org Aug 31, 2026 5/10
skill GitHub

Transform Claude Code Prototypes Into Native WordPress Gutenberg FSE Themes

An agent skill that translates prototypes produced in Claude Code into proper WordPress Gutenberg full-site-editing themes. Bridges the usual gap between an agent-built mockup and something WordPress can actually ship. Narrow but well-scoped.

wordpressgutenbergthemesskills
by vicunav Aug 31, 2026 5/10
skill GitHub

vibe-proof-auditor: An Evidence-Based Production Audit Skill for Coding Agents

Audits a codebase for production readiness and requires evidence for each finding rather than asserting problems. Installs in one command via the skills CLI and works globally across projects. A counterweight to agents declaring work done without proof.

auditproduction-readinessevidenceskills
by pedroknigge Aug 31, 2026 6/10
skill GitHub

MetricBraid: Reconcile Oura and Garmin Health Data Without Double-Counting

Routes multi-device health data for Claude Code so overlapping Oura and Garmin metrics aren't double-counted, naively averaged or overclaimed. Handles the reconciliation logic that trips up naive health-data agents. Narrow domain, careful design.

healthdata-reconciliationouragarmin
by drleahzou Aug 31, 2026 5/10
skill GitHub

cv-job-market-research: Turn a CV Into a Verified Bilingual Target-Company Sheet

A Claude Skill that does real web research from a CV and produces a structured bilingual Excel file of companies to target. Scores fit against your actual skills rather than generic "hires fresh grads" heuristics, and estimates per-company salary. Ends with an actionable shortlist.

job-searchresearchexcelskills
by omar-abo-el-maaty Aug 31, 2026 5/10
skill GitHub

OfferLoop: A Seven-Skill Open-Source AI Job Search System

Connects opportunity discovery, application progress, experience mining, CV tailoring, interview prep and retrospectives through seven Agent Skills backed by a Feishu workspace. Supports Codex, Claude Code, Hermes Agent and WorkBuddy. Documentation is primarily in Chinese.

job-searchskillsfeishuopen-source
by riwonswain-ovo Aug 31, 2026 5/10
skill GitHub

infographic: Turn a Document or Topic Into a Designed Visual Explainer

A Claude Code skill with 52 block forms, an enforced word budget, and guards that fail the build when the output drifts from spec. The constraints are the point — they stop the model producing wall-of-text "infographics". Output is a designed explainer rather than a slide dump.

infographicdesignvisualizationskills
by remybroun Aug 31, 2026 6/10
skill GitHub

claude-handoff-skill: Additive Handoff Logs for Parallel Workstreams

A Claude Code skill for closing out and handing over multi-workstream sessions, keeping an additive log of live handoffs. Because entries are appended rather than replaced, parallel sessions don't clobber each other's context. Documentation is in Spanish.

handoffmulti-sessioncontextskills
by PieroJF Aug 31, 2026 5/10
skill GitHub

deep-review-loop: Five Review Rounds With Anti-Overfit Protection

An agent skill running an R0-R3 review loop — review, fix, re-review — until the code genuinely converges, backed by four layers of anti-overfit protection. Designed against the failure mode where an LLM declares convergence it hasn't reached. Bilingual English/Chinese docs.

code-reviewverificationconvergenceskills
by 1273984347 Aug 31, 2026 6/10
skill GitHub

mem-wrap-up: A Seven-Step Session Wrap-Up With a Verification Iron Law

Runs a memory audit, a doc-sync spot check and a six-facet status matrix at the end of a session. Its "verification iron law" is never to trust an "it's done" claim without evidence. Pairs naturally with handoff and retro skills.

session-managementmemoryverificationskills
by 1273984347 Aug 31, 2026 6/10
skill GitHub

self-evolution: Turn Session Retrospectives Into Durable Heuristics

An agent skill offering a three-question quick check or an eleven-dimension full retrospective, promoting findings from experience to pattern to heuristic to policy. The goal is that a mistake made once becomes a rule that prevents it recurring. Bilingual docs.

retrospectivelearningheuristicsskills
by 1273984347 Aug 31, 2026 5/10
skill GitHub

claude-session-skills: Parallel Sessions in One Repo, Without Collisions

/start-session snapshots the working tree, agrees a scope, and picks between main, a branch or a git worktree. /end-session works out which dirty files are actually yours, closes loose ends, and writes the handoff before you archive. Solves a real problem for anyone running several agents against one repository.

parallel-sessionsworktreehandoffskills
by edwardyen724-g Aug 31, 2026 7/10
skill GitHub

ai-dev-kit: A Portable, Versioned Agentic Development Skill Library

Lifecycle skills, a per-project adapter contract and a cross-platform installer, distilled from a real Next.js boilerplate. The adapter contract is the interesting part: it lets one skill library work across differently shaped projects. Versioned so upgrades are tractable.

skill-librarylifecycleinstallerportable
by jrittelmeyer Aug 31, 2026 5/10
skill GitHub

agent-root: Make Any Assistant Read Your Repo's Traps Before It Acts

Acts as a resident engineer for a repository, surfacing the pitfalls you already documented before the agent starts editing. It also warns when the file you're editing isn't the one that's actually running — a classic source of wasted sessions. Works with any AI assistant.

guardrailsrepo-contextonboarding
by chester0 Aug 31, 2026 6/10
skill GitHub

writing-craft: A Creative Writing Skill Validated by Blind AI Judging

Nine signals that three AI judges independently named after blind-scoring 50 samples, then measured again in a second blind test. Two files, portable to Claude Code, Codex, Gemini or any chat. The methodology is more rigorous than most writing skills.

creative-writingevaluationblind-testskills
by Ptlimited Aug 31, 2026 6/10
skill GitHub

saas-api-skills: API Integration Skills for Over 340 SaaS Platforms

A curated collection of skills connecting AI agents to more than 340 SaaS APIs. Saves writing the same integration boilerplate repeatedly. Breadth is the selling point; depth will vary by platform.

saasapi-integrationskillscollection
by Simplex-june29108 Aug 31, 2026 6/10
skill GitHub

nobrainer-tech-skills: Portable Workflows for Guarded Agent Autonomy

Covers guarded autonomy, visible sessions, spec-driven development, decision records, root-cause analysis, evaluation and knowledge retention. Portable across harnesses rather than tied to one. A broad but coherent methodology pack.

skillssddrcaknowledge
by nobrainer-tech Aug 31, 2026 5/10
skill GitHub

MaciejZet/agent-skills: 14 Specialists With CI, 336 Tests, 75 Routing Evals

Covers research, product ops, QA, release gates and decisions across Claude Code, Cursor and Codex. The routing evals are unusual — they test whether the right skill actually gets picked, not just whether each skill works. Testing rigor well above the norm for skill collections.

skillstestingroutingevals
by MaciejZet Aug 31, 2026 6/10
skill GitHub

viral-content-skills: Content Skills Built on STEPPS and SUCCESs Frameworks

Creates and evaluates sticky content using the frameworks from Contagious and Made to Stick rather than generic "write a viral post" prompting. Works with both Claude and ChatGPT. The evaluation half is the more useful part.

contentmarketingframeworksskills
by trananhtung Aug 31, 2026 5/10
skill GitHub

preen: Split a Messy Working Tree Into Clean Atomic Commits, Plan First

Analyzes an unstaged mess and proposes atomic commits with real messages, showing the plan before anything moves. Available as both a Claude Code skill and a standalone CLI. Directly addresses the sprawling single commit that agent sessions tend to produce.

gitcommitsrefactoringcli
by dcadolph Aug 31, 2026 7/10
skill GitHub

dependabot-alert-review-skill: Triage Alerts by Real Exploitability, Not CVSS

Checks whether a Dependabot vulnerability is actually reachable in your code before a fix PR exists, rather than ranking by CVSS score alone. Cuts the noise that makes teams ignore alert queues entirely. A focused, high-value security skill.

securitydependabotvulnerabilitiestriage
by iamravenous Aug 31, 2026 7/10
skill GitHub

open-seo-mcp-skills: Free MIT SEO and GEO Skills on Your Real Analytics Data

Keyword research, rank tracking, site audits, backlinks, competitor gaps and AI visibility, running against your actual Search Console, GA4 and ads data via MCP with DataForSEO built in. Working from real data rather than scraped estimates is the differentiator. Free and MIT licensed.

seogeomcpanalytics
by Ryze-AI-Adgent Aug 31, 2026 6/10
skill GitHub

carousel-skill: Turn a Blog Post Into a Posting-Ready Social Carousel

Produces PNGs, a LinkedIn-ready PDF, captions, alt text and a review page from a single blog post. The review page means you check before publishing rather than after. Covers the whole handoff to posting.

social-mediacarousellinkedinskills
by moihars Aug 31, 2026 5/10
skill GitHub

ai-dev-gates: Spec-to-Test Traceability and Regression-Guarded Fixes

Gates for AI-assisted development covering traceability from spec to test, fixes guarded against regression, quality metrics and a commit gate. Ships as agent skills for both Claude Code and GitHub Copilot. Focused on making "done" mean something measurable.

gatestraceabilitytestingcopilot
by jam7 Aug 31, 2026 6/10
skill GitHub

docker-doctor: Let Coding Agents Diagnose and Fix Your Docker Problems

Gives agents the structured access needed to investigate container and infrastructure issues rather than guessing from error strings. Covers diagnosis through to applying fixes. Useful when the failure is in the environment, not the code.

dockerdiagnosticsinfrastructureskills
by PunGrumpy Aug 31, 2026 6/10
skill GitHub

coding-kit: A Portable Agent-Brain Kit With SQLite FTS5 Cross-Chat Memory

Combines superpowers methodology, YAGNI minimalism, searchable cross-chat memory and adversarial trap-suite evals. Hermes-compatible skills work in OMP, Claude Code, Gemini CLI, Hermes, Antigravity and ZCode. The trap suites test whether the agent resists bad instructions.

memorysqliteevalsportable
by oleg494 Aug 31, 2026 6/10
skill GitHub

kuang-skills: A Daily-Driver Claude Code Skill Collection, Fully Open-Sourced

Covers open-source release, adversarial debate, documentation hygiene, WeChat public-account automation, Feishu notes and email readiness checks. These are the author's own daily-use skills rather than a curated demo set. Documentation is in Chinese.

skillscollectionwechatfeishu
by kuangketongxue Aug 31, 2026 5/10
skill GitHub

the-missing-semester-skills: 29 Skills Distilled From MIT's Missing Semester

Turns all nine 2026 lectures of MIT's The Missing Semester into reusable agent skills, installable in one step to Claude Code, dsh, OpenCode or Codex. Covers the practical tooling knowledge formal CS courses skip. Bilingual English/Chinese.

educationskillsmittooling
by AntheaLaffy Aug 31, 2026 6/10
skill GitHub

ai-agent-skills: 90 Skills Plus an MCP Directory and Command-Palette Store

Combines a production-grade skill collection with an MCP server directory and a command-palette-driven store for installing them. Works with OpenCode, Claude Code, Codex and Gemini CLI. Discovery UX is the differentiator over a plain repo of skills.

skillsmcp-directorymarketplacecollection
by marktantongco Aug 31, 2026 6/10
skill GitHub

patina: An AI-Writing Humanizer for Korean, English, Chinese and Japanese

Rewrites model output to read less like model output across four languages. Multilingual coverage is rare in this category — most humanizers are English-only. Useful where CJK tone conventions differ sharply from English.

writinghumanizermultilingualcjk
by devswha Aug 31, 2026 5/10
skill GitHub

naticorrea-03/claude-code-skills: Teach-While-Building and Factual Rigor Skills

A reusable set covering teach-while-building, factual rigor, an automation system-map generator, and Anthropic's own best practices distilled into skill form. The teaching skill is aimed at learning from a session rather than just shipping from it. Companion repo to claude-code-recipes.

skillsteachingbest-practicesrigor
by naticorrea-03 Aug 31, 2026 5/10
skill GitHub

claude-code-recipes: Paste-and-Build Recipes Including a FITFO Decision Skill

Short, copyable recipes for Claude Code, including a birthday-text auto-sender and a FITFO decision-forcing skill. Aimed at people who want a working example to adapt rather than a framework to learn. Companion to the author's skills repo.

recipesskillsautomationexamples
by naticorrea-03 Aug 31, 2026 5/10
skill GitHub

agent-collab-skills: A Marketplace for Multi-Agent Collaboration Primitives

Provides a task splitter, output reconciler, adversarial debate, shared memory and an acceptance gate as composable skills. Designed to work alongside codex-delegate and gemini-delegate for cross-model collaboration. The reconciler and acceptance gate are the pieces most collections omit.

multi-agentcollaborationmarketplaceskills
by WenyuChiou Aug 31, 2026 6/10
skill GitHub

Aisland-teach: A Teaching Skill That Verifies Learning by Restatement

Teaches from your actual level and then checks whether you learned it by asking you to restate the idea, rather than assuming the explanation landed. Adapted from Matt Pocock's teach skill under MIT. Works across AI coding agents.

teachinglearningverificationskills
by Aisland-SJL Aug 31, 2026 5/10
skill GitHub

ko-skill: Evidence-First Bugfixing and GitHub Reuse Research

Two portable Agent Skills: one enforcing evidence before a fix is proposed, the other researching whether an existing GitHub project already solves the problem. The reuse-research skill counteracts agents reflexively writing new code. Portable across harnesses.

bugfixingevidencereuseskills
by kaluli123123 Aug 31, 2026 5/10
skill GitHub

open-steps: Translate Agent Output Into Honest Plain Language

Skills that turn a coding agent's output into honest reports, straight verdicts and steps you can actually follow. Targets the hedged, jargon-heavy summaries agents default to. MIT licensed.

reportingplain-languageverdictsskills
by kharmanskyi Aug 31, 2026 5/10
skill GitHub

elp-notes-method: A Documentation Methodology as a Claude Code Plugin

Ships a progress board, ADRs, an archive, a doc linter and a safety gate for hardware projects. Includes a committed snapshot so the repository stays self-contained rather than depending on an external install. Methodology and enforcement in one package.

documentationadrlinterplugin
by mongdang Aug 31, 2026 6/10
skill GitHub

interactive-ui-doc-skill: Click-to-Explain Documentation for WinForms Dialogs

Rebuilds a WinForms dialog 1:1 from its Designer.cs into an interactive HTML page with numbered annotations, click-to-explain and a guided walkthrough. Solves documenting legacy desktop UIs that have no screenshots. Works in Claude Code and Codex.

winformsdocumentationlegacyskills
by mingfeng6684 Aug 31, 2026 5/10
skill GitHub

seo-skills-by-gaznil: 81 Non-Overlapping SEO and Content Skills

Covers AI search (GEO/AEO/LLMO), technical SEO, ecommerce, hreflang, images, backlinks, local, Search Console, CRO and a full blog pipeline. Explicitly one skill per purpose with no overlaps, which keeps routing sane at that scale. Large but organized.

seogeocontentcollection
by gaznilmuzammil12-prog Aug 31, 2026 5/10
skill GitHub

su-multi-geo: Audit AI Search Visibility With a Separate Lane per Engine

Audits, implements and measures generative-engine optimization across ChatGPT, Gemini, Claude, Perplexity and Naver, keeping each engine in its own lane rather than averaging them. Per-engine separation matters because their retrieval behaviours differ sharply. Naver coverage is unusual.

geoseoai-searchskills
by kindsusu Aug 31, 2026 5/10
skill GitHub

how-to-syntax: Language Mentor Skills for Experienced Engineers

One SKILL.md per language, written for someone who already knows how to program and just needs the new language's idioms. Symlinks into Claude Code, Cursor, Copilot and Codex from a single source. Avoids the beginner-tutorial framing most language docs default to.

learninglanguagesskillssymlinks
by kadirosmanust Aug 31, 2026 6/10
skill GitHub

jss-skill: An AI Pipeline Orchestrating katana, waymore, jsluice and hae

Chains established JavaScript reconnaissance tools into one agent pipeline for authorized security testing, letting the tools handle breadth while the model handles depth. Intended for bug bounty and pentest work on targets you're permitted to test. Requires the underlying tools installed.

securityreconjavascriptbug-bounty
by ZeroTu1 Aug 31, 2026 6/10
skill GitHub

MicrosoftDocs/Agent-Skills: Official Microsoft and Azure Skills From MS Learn

Curated agent skills maintained by the Microsoft Docs team, giving coding assistants structured, current expertise drawn from Microsoft Learn documentation. First-party maintenance means it tracks Azure changes rather than going stale. A notable vendor entry into the skills ecosystem.

microsoftazureofficialdocumentation
by MicrosoftDocs Aug 31, 2026 8/10
skill GitHub

claude-skill-social-post: Learn Your Voice, Then Run a 14-Day Content Calendar

Learns your Facebook writing voice and auto-posts to FB, IG, Threads and X on a two-week calendar. The author documents both a validated viral first post and a Day 2 flop postmortem, which is more useful than the success story alone. Documentation in Traditional Chinese.

social-mediacontentautomationskills
by Hao0321 Aug 31, 2026 5/10
skill GitHub

agent-fieldbook: Source-Backed Skills From Official Claude and Codex Training

Converts official Claude and Codex training material into daily workflows, keeping each recommendation traceable to its source. Source-backing matters in a space full of confidently wrong folk advice. Practical rather than theoretical.

best-practicesskillstrainingsourced
by alessiomarcone Aug 31, 2026 6/10
skill GitHub

claude-skills-pro: 15 Engineering Skills With 5 MIT-Licensed Free Samples

Covers code review, testing, debugging, security and zero-downtime migrations. Five of the fifteen are free under MIT so you can evaluate the approach before paying. The migration skill is the least commonly covered.

skillscode-reviewmigrationsfreemium
by Hahaknight Aug 31, 2026 5/10
skill GitHub

awesome-skillkit: Scene-Packs for Publishing, AI Media and Office Productivity

Curated Agent Skills bundled by scenario: content publishing across 18 Chinese platforms, AI video/image/music generation, office productivity, dev basics and short-form memes. Scene packs are easier to adopt than a flat list of skills. Apache-2.0.

skillspublishingmediacollection
by Morningstar202604 Aug 31, 2026 5/10
skill GitHub

martech-verify: Dependency-Free Verification Skills for Marketing and RevOps

Runs against an export you already have and checks consistency across system boundaries, where most marketing data errors hide. No dependencies and no API access needed. Practical for anyone reconciling CRM and ad platform data.

martechrevopsverificationskills
by m7mdwb Aug 31, 2026 5/10
skill GitHub

decoder: Technical Concepts Explained for Product Managers

Drop a link or describe a situation and it researches live, explains using character analogies, then closes with one sharp question. The closing question is what makes it useful in a PM context rather than just a glossary. Works in any Claude Code session.

product-managementexplanationresearchskills
by Anmoll-W Aug 31, 2026 5/10
skill GitHub

lamarck-skill: Skills That Evolve From Real Usage Behind an Authorization Gate

Every installed skill accumulates evidence from real sessions and evolves when a gate opens, with the change governed, user-authorized and reversible. The authorization gate and reversibility are what make self-modification safe here. Bilingual documentation.

self-evolvingskillsgovernancereversible
by newdee Aug 31, 2026 6/10
skill GitHub

stipple-agent-skills: Verify Documents, Citations and Adverse Media

Outcome-focused skills covering document verification, citation checking, tender discovery and adverse media screening. Has a free tier and works across Claude Code, Codex, Cursor and Gemini CLI. Aimed at due-diligence style work.

verificationdue-diligencecitationsskills
by Sketchjar Aug 31, 2026 5/10
skill GitHub

agent-logbook: A Plain-Markdown Work Log With a Checker That Keeps It Honest

Records what an AI coding session actually did in plain markdown, with an automated checker validating the entries against reality. The checker is the point — an unverified log drifts into fiction quickly. Human-readable output.

loggingsessionsverificationmarkdown
by AlexLiu190625 Aug 31, 2026 6/10
skill GitHub

italian-investor: Tax-Aware Portfolio Analysis for Italian Investors

A Claude Skill covering ETF and BTP taxation, capital-loss carryforwards, rebalancing and succession, with verification against primary regulatory sources. The primary-source verification is what separates it from generic financial prompting. Documentation in Italian.

financetaxitalyskills
by eliazv Aug 31, 2026 5/10
skill GitHub

linkly-quote-cards: Turn Knowledge-Base Notes Into Numbered Zine Quote Cards

Generates zine-style numbered quote cards from notes using a Seedream backend, with halftone portraits and a verbatim CJK text check. The verbatim check catches the classic failure of image models mangling Chinese characters. Bilingual documentation.

designcardscjkskills
by logog782-cmyk Aug 31, 2026 5/10
skill GitHub

bridgenode-skill: Pay-Per-Request AI Inference for Agents via x402

An agent skill plus buyer-side examples for x402 pay-per-request inference, letting agents pay for calls without a subscription. Interesting as an early agent-payments integration. Requires the BridgeNode network.

x402paymentsinferenceskills
by bridgenode-ai Aug 31, 2026 5/10
skill GitHub

claude-devlog: Stamped Screenshots and Asks-to-Changes-to-Proof Reports

A Claude Code devlog skill that captures stamped screenshots of any program without stealing focus, then produces a personal asks to changes to proof report plus a dev-process record. Focus preservation matters when capturing during a live session. Documents both what you asked and what actually changed.

devlogscreenshotsreportingskills
by Detcader101 Aug 31, 2026 6/10
skill GitHub

droit-francais-skill: French Legal Research vs 14 LLM Failure Modes

A Claude Code skill implementing rigorous French law research methodology, built explicitly to counter fourteen identified LLM error modes. Enumerating the failure modes and designing against each is a strong approach. Documentation in French.

legalfranceresearchskills
by brissonjo-sudo Aug 31, 2026 6/10
skill GitHub

otel-as-code-plugin: Instrument Code, Then Generate the Terraform

Instruments Node.js or Python with OpenTelemetry and then generates Terraform for Grafana, Datadog, New Relic and Dash0. Covering both the instrumentation and the backend configuration is what makes it observability-as-code rather than just tracing. Works in Claude Code and Codex.

opentelemetryterraformobservabilityplugin
by radra23 Aug 31, 2026 7/10
skill GitHub

waa-agent-delegation: Safe Subagent Selection, Task Packets and Handoff

A cross-platform Agent Skill covering subagent selection, structured task packets, permissions, handoff and verification. Treating the task packet as a first-class artifact makes delegation auditable. Works beyond Claude Code.

delegationsubagentspermissionsskills
by clearlove7818 Aug 31, 2026 6/10
skill GitHub

interview-journey: Evidence-Driven Interview Prep for Any Role

Structures interview prep around evidence from your actual experience rather than rehearsed generic answers, for any role. Portable between ChatGPT and Claude. Straightforward and practical.

interviewpreparationcareerskills
by amirbena Aug 31, 2026 5/10
skill GitHub

kardebadas/claude-plugin: craft Writes the Brief, pipeline Ships It

Two personal skills invoked as superb:* — craft converts a vague product idea into a decision-rich brief, and pipeline takes a settled idea through to a finished branch. Splitting ideation from execution keeps each stage honest. Works in Codex and Claude Code.

productbriefpipelineskills
by kardebadas Aug 31, 2026 5/10
skill GitHub

awesome-progress-tracker: Markdown Memory That Survives Context Resets

Tracks progress in project-local markdown so Codex, Claude Code and MCP-compatible agents can resume across sessions, reboots and context resets. Keeping it in the repo means it travels with the work. Plain markdown, no service required.

progressmemorymarkdownresumable
by AndriiLavrekha Aug 31, 2026 6/10
skill GitHub

claude-cto-skill: A Gated Pipeline From Define Through Ship

Runs define, spec, build, review, QA and ship with an explicit stop at every gate, so nothing advances without a decision. Framed as a CTO reviewing each stage. Installs as a Claude Code skill.

pipelinegatesqaskills
by laltaffer Aug 31, 2026 6/10
skill GitHub

sega-master-system-skill-for-claude: Build Verified SMS ROMs with Claude

A Claude Skill that turns an idea or an existing game into a playable, verified Sega Master System .sms ROM, with Game Gear and SG-1000 targets too. Generates C compiled with SDCC against devkitSMS (SMSlib + PSGlib) and verifies the result rather than just emitting code. A concrete example of wrapping a full retro toolchain in a skill.

skillretrogamedevsegasdccdevkitSMS
by haroldo-ok Aug 30, 2026 7/10
skill GitHub

the-quorum: Five-Member Expert Council That Pressure-Tests Decisions

A skill that convenes five distinct expert personas to argue over a consequential decision before you commit to it, rather than returning a single agreeable answer. Each member attacks the proposal from a different angle so weak assumptions surface. Works with both Claude Code and Codex.

decision-makingpersonasreviewskill
by glichtenthal Aug 30, 2026 6/10
skill GitHub

briefing-room: Turn Messy Context Into a Brief You Can Think With

Takes scattered notes, threads, and half-formed requirements and compresses them into a structured brief suitable for reasoning over. Intended as the step before you hand a task to an agent, so the agent starts from an organized problem statement. Available for Claude Code and Codex.

context-engineeringplanningskillsummarization
by glichtenthal Aug 30, 2026 6/10
skill GitHub

test-drive: Stress-Test an Idea or Claim Before You Trust It

A skill that takes a claim, idea, or decision and probes it for failure modes before you act on it. Sits alongside the same author's briefing-room and the-quorum as a set of pre-commitment thinking tools. Works with Claude Code and Codex.

validationdecision-makingskillcritical-thinking
by glichtenthal Aug 30, 2026 6/10
skill GitHub

muji-style-skill: Quiet-Living Visual Design Skill for Agents

An original design skill encoding a restrained aesthetic: natural materials, functional typography, asymmetric whitespace, and honest everyday imagery. Gives an agent a coherent visual vocabulary instead of generic default styling. Useful when generating UI or marketing surfaces that should feel deliberately understated.

designvisual-styleskilltypography
by yanliudesign Aug 30, 2026 5/10
skill GitHub

sap-skills: Production-Ready SAP Development Plugins for AI Agents

A plugin collection covering BTP, CAP, Fiori, ABAP, HANA, Analytics Cloud, and Datasphere for use with AI coding assistants. Encodes SAP-specific conventions that general models handle poorly without guidance. Valuable for enterprise teams where SAP work dominates.

sapenterpriseskillsabapplugins
by secondsky Aug 30, 2026 6/10
skill GitHub

CNS-Skills: Scientific Manuscript Editing Agent Skill

An English-first academic writing skill for SCI manuscript revision, paper polishing, Chinese-to-English editing, peer review, citation and DOI audits, and figure/table QA. Targets the standards of top journals and conferences. Runs in Claude Code, Codex, and other Agent Skills clients.

academic-writingskillresearchediting
by niuyupeng Aug 30, 2026 6/10
skill GitHub

explain-like-12: Add a Plain-Language Explanation Under the Technical One

A Claude Code agent skill that appends a twelve-year-old-level explanation beneath the technical answer instead of replacing it. You keep the precise version and get an intuition check alongside it. Useful when working outside your own domain or handing output to non-specialists.

skillexplanationaccessibilitycommunication
by jkrepublic Aug 30, 2026 6/10
skill GitHub

Contexory/skills: Nine Skills That Declare When to Stay Quiet

A set of nine Claude Code skills for developer workflow where each skill specifies its non-activation conditions, not just its triggers. Directly addresses skills that fire too eagerly and pollute unrelated sessions. Worth reading as a pattern for skill authoring even if you do not install the pack.

skillsactivationworkflowskill-design
by Contexory Aug 30, 2026 7/10
skill GitHub

vimoxshah/skills: One Install, Every Harness

A collection of skills and agents packaged to install once and work across Claude Code, Codex, Cursor, and OpenCode. Avoids maintaining parallel copies per tool. Useful if your team is split across harnesses.

skillscross-toolportabilityagents
by vimoxshah Aug 30, 2026 6/10
skill GitHub

socialdatax-skills: Xiaohongshu and Douyin Content Research Skills

Skills for researching content on Xiaohongshu (RedNote) and Douyin through SocialDataX. Gives an agent structured access to Chinese social platform data for market and content analysis. Niche but well-scoped.

social-mediaresearchskillschina
by DevinChen2014 Aug 30, 2026 5/10
skill GitHub

second-opinion: Make Codex Argue With Claude Before You Accept an Answer

A Claude Code skill where Claude drafts an answer and the OpenAI Codex CLI challenges it, debating across up to three rounds in one persistent session with explicit verdicts and a CONCEDE/HOLD relay. You keep whichever answer survives. A structured adversarial check rather than a second opinion you have to read and reconcile yourself.

skillcodexadversarial-reviewverification
by guyaga Aug 30, 2026 7/10
skill GitHub

spec-trace: Trace a Symptom Back to the Spec Clause That Caused It

A Claude Code plugin for spec-kit projects that follows an observed bug backwards to the specification clause responsible. Distinguishes an implementation defect from a spec defect, which changes what you should fix. Useful on projects where specs are the source of truth.

spec-kitdebuggingtraceabilityplugin
by SunilJeong95 Aug 30, 2026 7/10
skill GitHub

n0an/skills: Agent Skills Collection for Four Harnesses

A personal collection of agent skills packaged for Claude Code, Gemini, Codex, and Cursor. Worth browsing for individual skills to lift rather than installing wholesale. Cross-harness by design.

skillscollectioncross-tool
by n0an Aug 30, 2026 5/10
skill GitHub

security-claude: Security Architecture Analysis Skill

Analyzes a codebase for security design flaws, threat modeling gaps, and architectural weaknesses rather than surface-level lint findings. Recommends fixes backed by evidence from the code instead of generic security advice. For architecture-level review passes.

securitythreat-modelingarchitectureskill
by rahozosman Aug 30, 2026 7/10
skill GitHub

dsh-outsource-skill: Delegate Sub-Tasks to DeepSeek Behind Review Gates

A Claude Code skill that hands coding sub-tasks to DeepSeek Harness via browser automation, then enforces strict review and merge gates before anything lands. Lets you offload bulk work to a cheaper model without accepting its output blindly. Browser-driven, so no API key for the target model is required.

delegationdeepseekcost-optimizationreview-gates
by naive000 Aug 30, 2026 6/10
skill GitHub

gallop: Route a Product Question to the Method It Deserves

Classifies an incoming product question and selects the appropriate analysis method, then executes that method with checks rather than answering ad hoc. Prevents applying a heavyweight framework to a trivial question and vice versa. Product-side counterpart to code-focused skills.

productmethod-selectionskillanalysis
by 0trm Aug 30, 2026 6/10
skill GitHub

multi-geo: Audit and Measure AI Search Visibility Per Engine

A Claude Code skill for generative engine optimization that keeps a separate lane for ChatGPT, Gemini, Claude, Perplexity, and Naver instead of treating AI search as one channel. Audits current visibility, implements changes, then measures the result. Relevant now that AI assistants are a real referral source.

geoseoai-searchskillmarketing
by kindsusu Aug 30, 2026 6/10
skill GitHub

polar-bear-org/claude-skills: Themed Packs for Workshops and Reviews

Themed Agent Skills packs for Claude Code and Claude.ai, installed via /plugin marketplace add polar-bear-org/claude-skills. Current packs run workshops that end in actual decisions, and a full annual performance review cycle without HR software. Non-coding skills that still target real recurring work.

skillsmarketplaceworkshopsperformance-review
by polar-bear-org Aug 30, 2026 6/10
skill GitHub

immo-agent-skills: 25+ German Real Estate Analysis Skills

Skills covering the German property market from property inspection through the Anlage V tax form. Structured prompts written to work with Claude, ChatGPT, and other LLMs. A domain-specific pack rather than a developer tool.

real-estategermanyskillsdomain-specific
by immoJUMP Aug 30, 2026 5/10
skill GitHub

prod-readiness: Seven Parallel Agents Auditing Production Readiness

A Claude Code plugin that fans out seven specialized agents across security, reliability, tests, DevOps, and launch blockers. Parallel specialists produce a broader audit than one generalist pass. Intended as a pre-launch gate.

auditproductionmulti-agentpluginsecurity
by Taimoorkhan1122 Aug 30, 2026 7/10
skill GitHub

grafana-llmops-forge: Generate Full LLM Observability for Any Grafana

Points at an existing Grafana instance and generates, deploys, and vision-verifies dashboards for AI and LLM observability, including FinOps by sovereignty, agent metrics, and EU AI Act reporting. Ships as a zero-dependency Agent Skill plus a CLI. Notable for verifying its own rendered output rather than assuming deployment succeeded.

grafanaobservabilityllmopsfinopsskill
by alebgl77 Aug 30, 2026 6/10
skill GitHub

awesome-data-engineering-skills: 36 Portable Data Engineering Skills

Covers dbt, Airflow, Dagster, Prefect, Spark, Snowflake, BigQuery, Databricks, Kafka, and Iceberg as portable SKILL.md Agent Skills. Encodes idempotency, backfill, and data-quality know-how that models routinely get wrong without guidance. Runs in Claude Code, Cursor, Codex, Copilot, and Gemini CLI.

data-engineeringskillsdbtairflowspark
by Unknown-333 Aug 30, 2026 7/10
skill GitHub

ship-gate: Interrogate a Tool Through Four Gates Before You Release It

A Claude Code agent skill that questions a tool before you hand it to someone else, across four gates: legal exposure, platform policy, the worst-case user, and silent failure. Aimed at the risks that surface after release rather than code defects. Complements technical review with adversarial product thinking.

releaserisk-assessmentskillpolicy
by jkrepublic Aug 30, 2026 6/10
skill GitHub

legadox: Hardening AI Work on Legacy Codebases

Computes an evidence-based impact radius for a proposed change, freezes current behavior with characterization tests, limits diff size, and requires human approval where breakage would be real. Built for Claude Code and OpenCode as the safety layer of the Expx method. Targets the specific danger of turning an agent loose on undocumented legacy code.

legacy-codecharacterization-testssafetyskill
by bittencourtthulio Aug 30, 2026 6/10
skill GitHub

skill--molt: Audit a Mac for Compromise, Then Shed Its Dead Software

Checks a Mac for signs of compromise and unwanted monitoring, covering orphaned root daemons, browser extensions with excessive reach, and stale configuration profiles, then removes the accumulated dead software and caches. Combines a security audit with cleanup in one pass. Practical for machines that have collected years of installs.

macossecurityauditcleanupskill
by camilocbarrera Aug 30, 2026 6/10
skill GitHub

Vivantel KMS: Knowledge Management Skills as Durable Traceable Artifacts

A Claude Code and Codex plugin marketplace of knowledge-management skills that capture decisions as durable artifacts, then keep them current, queryable, and attributable across sessions. Attribution and freshness are treated as first-class rather than assumed. For teams where decisions currently die in chat logs.

knowledge-managementdecisionsmarketplacetraceability
by vivantel Aug 30, 2026 6/10
skill GitHub

ai-coach: Coaching Harness With Team Memory and Injection Defense

A Claude Code harness bundling 8 plugins and 18 skills that add shared team memory, evidence-backed prompt coaching, prompt-injection defense, and onboarding docs. It advertises a small always-on footprint (~1,317 tokens) so the coaching layer stays loaded without eating the context window. Useful if you want team-wide prompt conventions enforced rather than left to each developer.

skillspluginsmemoryprompt-injectionteam
by MohammedMoataz Aug 30, 2026 7/10
skill GitHub

brand-voice-skill: Fill-in-the-Blank Skill for Writing in Your Brand Voice

A Claude skill with blanks you fill in to describe your brand's voice, after which the assistant writes in that voice across the formats marketing actually ships. It is a template rather than a pretrained style, so the tuning work is a one-time setup. Useful for teams generating recurring marketing copy.

skillwritingmarketingbrand-voicetemplate
by moihars Aug 30, 2026 6/10
skill GitHub

Postman-Skill: Safe Postman Cloud Management and API Execution

An agent skill that manages Postman cloud resources (collections, environments, workspaces) and executes API requests through them, with guardrails around destructive operations. Lets an agent drive existing Postman assets instead of hand-rolling curl. Relevant to anyone whose API contracts already live in Postman.

skillpostmanapitestingautomation
by soapgu Aug 30, 2026 6/10
skill GitHub

awesome-skills-zh: Curated Chinese-Language List of Claude and Agent Skills

A curated awesome-list of Claude Skills, Agent Skills, and LLM skill development resources, written in Chinese. It collects skill repos, guides, and tooling in one index. The main value is coverage of Chinese-language ecosystem projects that English lists tend to miss.

awesome-listskillschineseresourcescurated
by yzfly Aug 30, 2026 6/10
skill GitHub

event-sponsorship-map: Map Competitor Event Sponsorships and Rank Buys

An agent skill that researches which events, conferences, and communities your competitors sponsor and at what commitment level, then ranks what your brand should buy. Output is Markdown plus an xlsx, with every row linked to its evidence source. Niche to marketing teams, but the evidence-linked row pattern is worth stealing for other research skills.

skillresearchmarketingcompetitive-analysisxlsx
by aj-suresh Aug 30, 2026 5/10
skill GitHub

posthog-voice-skill: Write Developer Content in PostHog's Voice

A Claude skill that writes developer-facing content in PostHog's published house style, paired with a style linter that flags deviations. The linter is the interesting half — it makes the voice checkable rather than vibes-based. A concrete example of encoding a public style guide as a skill.

skillwritingstyle-guidelinterposthog
by zmjafary Aug 30, 2026 5/10
skill GitHub

next2d-development-assistant: AI Skill for the Next2D Framework

A skill supporting development on the Next2D Framework and Player, generating code that follows MVVM plus Clean Architecture plus Atomic Design, optimizing WebGL rendering, and helping implement animations. Narrow to Next2D users, but a good template for framework-specific skills that encode architectural conventions.

skillnext2dwebglanimationframework
by Next2D Aug 30, 2026 5/10
skill GitHub

motion-pages: Claude Code Skill for Award-Site Motion Pages

A skill that generates single-file animated landing pages — Three.js scenes, liquid-glass shaders, springy poster walls — in the style of awards-site showcase work. Output is screenshot-verified, so the skill checks its own rendering rather than trusting the code compiled. One prompt produces a self-contained page.

skillthreejsanimationfrontendwebgl
by jiangyurong609 Aug 30, 2026 7/10
skill GitHub

knowledge-delta-skills: Skills for Only What Frontier Models Do Not Already Know

A collection of SKILL.md Agent Skills built on an explicit editorial rule: include only expertise a frontier model does not already reliably know. That filter keeps the set small and avoids the common failure of skills that restate what the model already does well. Works with Claude Code, Codex, Cursor, and Gemini CLI.

skillsskill-mdcross-agentcuration
by sergeyizmailov Aug 30, 2026 7/10
skill GitHub

surf-agent-skill: Multi-Provider Web Search Skill with Auto-Fallback

A web search skill for coding agents backed by both Tavily and Parallel AI, installable with npm i -g surf-skill. It rotates across multiple API keys and falls back to the second provider when the first fails or is rate limited. Ships as both a CLI and a Node library, with batch search support.

skillweb-searchtavilynpmfallback
by frederico-kluser Aug 30, 2026 6/10
skill GitHub

x1-agent-skills: Financial Workflow Skills with a Hard Stop Before Money Moves

Open-source skills that let agents do real financial work with durable X1 account context. The notable design choice is a hard stop gate: the agent can research, analyze, and prepare, but any action that actually moves money requires explicit human approval. A useful reference for anyone building agent skills around irreversible operations.

skillsfinancehuman-in-the-loopsafety-gate
by x1wealth Aug 30, 2026 6/10
skill GitHub

small-cap-deepdive: Falsifiable Due Diligence Skill with Forced Disconfirmation

A Claude Code skill that enumerates a theme small-cap universe from SEC filings, then mechanically screens out going-concern, death-spiral financing, and material-weakness names before any analysis. What follows is due diligence structured to be falsifiable, with forced disconfirmation steps and base-rate priors. Explicitly a research discipline, not a stock picker.

skillsec-filingsresearchdue-diligencefinance
by DaizeDong Aug 30, 2026 6/10
skill GitHub

travel-agent-skill: Plan, Price, and Navigate a Trip from Claude Code

A set of Claude Code skills covering a trip end to end: searching real fares through ITA Matrix, keyless driving and transit routing, and an in-trip companion agent that reads your trip dossier while you are traveling. Shows how to chain planning skills into a document that a later agent consumes.

skillstravelita-matrixroutingplanning
by Filip-Kin Aug 30, 2026 6/10
skill GitHub

timerise/skills: Production-Extracted Next.js App Router Skill Modules

An index of Claude Code skills pulled out of a production Next.js App Router codebase rather than written as demos. Covers help center, digital signage, KSeF e-invoicing, and Stripe Connect billing modules. Useful if you want skills that encode how a feature was actually shipped.

skillsnextjsapp-routerstripeproduction
by timerise-ai Aug 30, 2026 6/10
skill GitHub

claude-cmo-skill: Marketing Copy Pipeline with an Anti-AI-Slop Review Gate

A gated marketing pipeline skill that grounds copy in research and then forces it through a review gate specifically designed to catch AI slop. It maintains a living catalog of overused tropes that the gate checks against, so the filter sharpens as you use it. The gating pattern generalizes well beyond marketing copy.

skillmarketingcopywritingquality-gatereview
by laltaffer Aug 30, 2026 6/10
skill GitHub

Claude-Skills-For-Business-Intelligence: BI Skill Where Every Number Reconciles

A free Claude Code skill packaged with a "certified BI" doctrine: every figure the model reports must reconcile back to the source file's own totals. Aimed at analysts who want Claude to produce spreadsheet-derived numbers that can be audited rather than plausible-looking summaries. Published alongside the commercial kymira.ai methodology.

skillbusiness-intelligencedata-analysisreporting
by dylnbaker15 Aug 29, 2026 6/10
skill GitHub

seo-landing: Agent Skill for Technical SEO Landing Pages

An agent skill that turns a coding agent into a technical SEO specialist for building landing pages. It targets 100/100 Google PageSpeed and Core Web Vitals optimization as explicit build constraints. Handy for anyone shipping marketing pages with Claude Code instead of hand-tuning performance.

skillseoweb-performancecore-web-vitals
by aleksandr-alhoff Aug 29, 2026 6/10
skill GitHub

tsudo/skills: A Library of Standalone Agent Skills

A collection of self-contained Agent Skills that work across Claude Code, Codex, and other agent runtimes. Each skill installs on its own — no framework, plugin manager, or shared runtime to adopt first. Good source if you want to cherry-pick capabilities rather than commit to a whole toolkit.

skillagent-skillsportablelibrary
by tsudo Aug 29, 2026 7/10
skill Reddit

codec: Paired Skills for Compressing and Expanding Claude's Output

Two complementary skills that control response length from opposite directions — one compresses answers into dense scannable notation, the other expands terse output into full explanation. Built by someone tired of typing 'just give me the conclusion' repeatedly. Addresses the two failure modes of response length as separate problems rather than one setting.

output-controlbrevityskills
by Ok-Challenge-7810 Aug 29, 2026 7/10
skill GitHub

keel: One AGENTS.md Instead of CLAUDE.md/CURSOR.md Sprawl

A tool-agnostic instruction file built on a single rule: the prose you write for a change never outweighs the code. Keeps one AGENTS.md rather than a per-tool file for every assistant you use. A reaction to instruction files that grow until they cost more attention than the change they describe.

agents-mdinstructionstool-agnostic
by theomgdev Aug 29, 2026 6/10
skill GitHub

rev-skills: 121 Reverse-Engineering Agent Skills

A large cross-platform skill collection covering malware analysis, software reversing, firmware and embedded work, protocol reversing, mobile apps, unpacking and deobfuscation, vulnerability research, managed code, forensics, and CTF. Chinese-language. One of the broader security-focused skill libraries published for agent runtimes.

reverse-engineeringsecurityctfskills
by dslsdzc Aug 29, 2026 7/10
skill GitHub

Umami Health Skill: Fridge, Recipes, Diet, Training and Habits in Local SQLite

Agent-skill port of the Umami health manager covering fridge inventory, recipes, diet, workouts, body metrics, goals, and habits, with all data stored in local SQLite. Chinese-language. A worked example of a stateful personal-domain skill that owns its own database.

healthsqlitepersonalskills
by renchenxuan Aug 29, 2026 5/10
skill GitHub

wdyb: Quiz Yourself on PR Diffs Hunk by Hunk

Claude Code skill that walks a GitHub PR diff one hunk at a time, asks you to interpret each change, and then checks your answer. Japanese-language. A code-reading practice loop rather than a review automation tool.

code-reviewlearninggithubpull-requests
by kaleidot725 Aug 29, 2026 6/10
skill GitHub

biofigure-self-evolve: A Self-Growing Bioinformatics Figure Library

Learns plot styles from papers, PDFs, articles, and screenshots, converts them into reusable R/Python recipes, and imitates them the next time you ask for a similar figure. The library grows with each source you feed it rather than shipping a fixed template set.

bioinformaticsplottingrpython
by Zessi-C Aug 29, 2026 6/10
skill GitHub

daily-job-brief: Turn Inbox and Calendar Into a Job-Search Tracker

Claude Code skill with optional nightly automation that reads your mail and calendar and produces a short forward-looking brief — interviews to prep, replies you owe, threads worth nudging. Keeps a living tracker so you don't reconstruct the state of a search by scrolling email.

job-searchemailcalendarautomation
by jessicahiggs Aug 29, 2026 6/10
skill GitHub

CA_MJane: Evidence-First Skills for PHP, Drupal and CMS Delivery

Developer skill set covering PHP, Drupal, HTML, CSS, JavaScript, CMS delivery, web performance, audits, and defensive security, built on an evidence-first posture. Fills a gap in skill libraries, which skew heavily toward JS/TS stacks.

phpdrupalcmsperformance
by creoaurea-devlab Aug 29, 2026 5/10
skill GitHub

house-skills-kit: Chinese Real-Estate Skill Generator Skeleton

Skeleton that generates brand-specific real-estate agent skills from one config, covering four role types across 29 business modules for both firms and individual practitioners. Apache-2.0. An example of the config-to-skill generation pattern applied to a vertical.

real-estatechineseskill-generation
by danfeistar Aug 29, 2026 5/10
skill GitHub

zzizily: 28 Personal-Automation Skills Across 10 Domain Plugins

Skill marketplace organised as ten domain plugins totalling 28 skills, targeting Claude Code, Codex, and Antigravity runtimes. Focused on personal automation rather than software engineering tasks.

marketplaceautomationmulti-runtime
by deuxksy Aug 29, 2026 5/10
skill GitHub

claude-flutter: Flutter and Dart Skills With Riverpod v3 and GoRouter

Agent skills for Flutter and Dart covering Riverpod v3, GoRouter, Melos monorepos, clean-architecture audits, and widget testing, plus 70 agents. Works across Claude Code, Cursor, and Codex. One of the more complete mobile-stack skill sets available.

flutterdartriverpodmobile
by iamantoniodinuzzo Aug 29, 2026 7/10
skill GitHub

astrona-skills: Symlink-Installed Skills That Stay Git-Tracked

A skill collection plus a `just` installer that symlinks skills into any skill-aware agent's folder, defaulting to ~/.claude/skills/. Because they're symlinks, edits stay live and the source stays under version control instead of drifting from a copied install.

skillsinstallersymlinkgit
by astrona-io Aug 29, 2026 5/10
skill GitHub

platform-skills: Kubernetes, Argo, Terraform and CI as an Agent Handbook

Platform engineering handbook spanning Kubernetes, OpenShift, Argo CD, Flux CD, AWS, Azure, Terraform, and GitHub Actions, with an optional Claude plugin layer for interactive guidance. Readable as docs on its own or installable as skills.

kubernetesterraformplatform-engineeringdevops
by nitinjain999 Aug 29, 2026 6/10
skill GitHub

blahblahblah-skill: Compress Any Long Claude Response Into a Scannable List

Rewrites a long response into an emoji-tagged list you can read in about five seconds. Post-hoc compression, so you keep the full answer and get a scannable version of it rather than constraining the model up front.

summarizationoutput-controlreadability
by Loriabient5377 Aug 29, 2026 5/10
skill GitHub

enterprise-skills: Department-Ready Claude Skills, Measured Before They Ship

Skills for engineering, IT, data, HR, finance, legal, marketing, sales, product, and operations, each evaluated before release. Agent-agnostic. The measurement claim is the differentiator among the many enterprise skill bundles.

enterpriseskillsevaluationbusiness
by alihusains Aug 29, 2026 6/10
skill GitHub

bbc-skill: Agent-Native CLI for Fetching Bilibili Video Comments

Zero-dependency CLI for pulling Bilibili comments so creators can analyse feedback on their own videos, exposed for Claude Code, Codex, and OpenClaw. An example of wrapping a platform API as an agent-native command rather than an MCP server.

bilibiliclicommentsanalysis
by Agents365-ai Aug 29, 2026 5/10
skill GitHub

cyberdeck-setup: Matrix-Green Dev Environment Setup Skill for Linux

Claude Code skill that configures a themed Linux terminal environment — Starship prompt, Nerd Font, terminal palette, status line, and modern CLI tools — with no sudo required. The no-sudo constraint makes it usable on locked-down or shared machines.

linuxterminalsetupstarship
by abhibansal60 Aug 29, 2026 6/10
skill GitHub

korean-privacy-terms: Generate Korean Privacy Policies and Terms of Service

Claude Code skill generating privacy policies and terms of service under Korean law, reflecting the April 2025 drafting guidelines and the March 2026 statutory amendments. Jurisdiction-specific legal drafting with a stated currency date, which matters more than usual here.

legalkoreanprivacycompliance
by kimlawtech Aug 29, 2026 6/10
skill GitHub

korean-contracts: Nine Korean Employment Contract Types Plus a PII MCP Server

Generates nine Korean contract types — permanent, part-time, flexible, daily, freelance, outsourcing, amendment, and salary agreements — reflecting 2026 minimum wage and recent Supreme Court precedent, bundled with an MCP server for personal-data protection.

legalkoreancontractsmcp
by kimlawtech Aug 29, 2026 6/10
skill GitHub

korean-patent-diagram: Patent Specs to KIPO-Compliant PNG Diagrams

Analyses a patent specification, picks the right diagram type — flowchart, block, state, graph, or process — and renders it to PNG at KIPO spec: 300 DPI, black and white, A4. Removes the manual redraw step in Korean patent filing.

patentkoreandiagramskipo
by kimlawtech Aug 29, 2026 6/10
skill GitHub

korean-jangbu-for: Card Statements and Bank CSVs to Korean Books

Bookkeeping skill for Korean startups, single-member corporations, freelancers, and sole proprietors: takes card statement PDFs and bank CSVs and produces financial statements plus a CSV for your accountant, with Level 2 sensitive-data masking applied.

accountingkoreanbookkeepingpii
by kimlawtech Aug 29, 2026 6/10
skill GitHub

korean-domain-agent: Six-Mode Korean LLM Agent Kit With Citation Guards

Korean-domain agent kit with automatic classification across six modes, a guard requiring citations to the national law information service, PII masking, and prompt caching. The citation guard is aimed squarely at legal hallucination.

koreanagent-kitcitationspii
by kimlawtech Aug 29, 2026 5/10
skill GitHub

work-design: Skills for the Decisions Made Before the Work Starts

Covers the moments where one deliberate decision prevents rework — vetting a tool before signing up, choosing what to delegate to an agent versus keep, carrying context between sessions, and catching an expensive request before it runs. No setup required.

decision-makingdelegationcontextskills
by theAnirudhKumar Aug 29, 2026 6/10
skill GitHub

usdctofiat-skills: Agent Skills for USDC Cash-Out on Base

Skills wrapping the USDCtoFiat offramp so an agent can run cash-out flows on Base. Narrow and vendor-specific, but a concrete example of exposing a financial API surface to an agent as skills.

cryptobasepaymentsskills
by ADWilkinson Aug 29, 2026 5/10
skill GitHub

acessibilidade-total: Audit Presentations Against ~75 Accessibility Rules

Claude Code skill that produces and audits accessible PPTX and PDF/UA presentations against roughly 75 checkable rules drawn from WCAG 2.2 AA via WCAG2ICT, ISO 14289, LBI, and e-MAG — alt text, reading order, contrast, sign language, and audio description. Portuguese-language.

accessibilitywcagpresentationspdf-ua
by RaulAraujoSilva Aug 29, 2026 7/10
skill GitHub

headcount: An Agent Organization Structured Like a Company

Over 125 skills organised into 15+ departments, each independently installable, so you adopt the marketing or finance department without taking the whole org. The company metaphor gives the collection a navigation structure that flat skill lists lack.

skillsorganizationdepartmentsmodular
by cbrock84 Aug 29, 2026 7/10
skill GitHub

Reusable Skill Modules Across Kiro, Cursor, Windsurf and Claude Code

A skill collection where each entry is a self-contained module teaching an agent to perform a complex task with context, structure, and best practices. Targets Kiro, Cursor, Windsurf, and Claude Code alike.

skillscross-agentmodules
by fabricioctelles Aug 29, 2026 5/10
skill GitHub

teach-me: Agent Skills for Durable, Evidence-Based Learning

Skills built on learning-science practice — spacing, retrieval, and evidence-based method — rather than having the model explain a topic once and move on. For using an agent to actually retain material.

learningeducationretentionskills
by drveles Aug 29, 2026 6/10
skill GitHub

VibeCodeProtocols: TDD Skill With a Mechanically Verified Red-Test Gate

Any model orchestrates under an internal contract while Sonnet 5 implements through role-persona subagents, with .vibe/ carrying memory across sessions. The hard gate is mechanical: no red test, no code, enforced by a verified receipt rather than a prompt instruction. Stack-agnostic with no external skill dependency.

tddgatessubagentsverification
by santischurmann Aug 29, 2026 7/10
skill GitHub

folder-caretaker: Keep Agent-Generated Files Structured and Findable

Skill for folder self-governance — it writes a rules file that keeps agent-generated content structured, searchable, and reusable going forward, or does a one-off logical cleanup of an existing folder. Chinese-language.

organizationfilesgovernance
by TEXXXXTURE Aug 29, 2026 5/10
skill GitHub

punkaze/skills: Author, Generate and Run Bruno API Collections

Skill marketplace whose headline entry is a Bruno skill for authoring, generating, and running .bru API collections from an agent. Good fit if your API testing already lives in Bruno rather than Postman.

brunoapi-testingskills
by punkaze Aug 29, 2026 5/10
skill GitHub

trading-guardian: Risk-Aware Trading Copilot on Binance Agent OS MCP

Trading copilot skill built on the Binance Agent OS MCP, framed around risk controls rather than signal generation. Narrow and vendor-bound, but a concrete example of putting guardrails between an agent and a live financial API.

tradingbinancemcprisk
by acevod Aug 29, 2026 5/10
skill GitHub

wireframe-prototyper-skill: Discovery to Figma-Transferable Prototypes

End-to-end design skill running structured discovery and competitor research, generating a WCAG-compliant design system, then building low-fidelity wireframes or high-fidelity prototypes with real navigation, exportable screens, and a design system you can carry into Figma.

designwireframesfigmawcag
by elifsue Aug 29, 2026 7/10
skill GitHub

skill-redaction-pedagogique: Plain-French Technical READMEs Without Dumbing Down

French writing skill for READMEs and reports: simple words with no loss of technical precision, terms defined at first use, guided reading of tables and figures, and every number given a declared status. A precise editorial standard rather than a 'write clearly' instruction.

writingfrenchdocumentationreadme
by Guilou001 Aug 29, 2026 5/10
skill GitHub

iOSskillsCollection: Nine Original iOS/Swift Skills Plus a Vetted Registry

Curated iOS and Swift agent skills — nine written by the author, plus a registry of community skills that were actually reviewed before inclusion. Works with Claude Code, Codex, Cursor, and OpenCode. The vetting is the value in a space full of unfiltered lists.

iosswiftskillscurated
by Vvlladd Aug 29, 2026 7/10
skill GitHub

archpresent: Dark-Themed Architecture Diagrams as Self-Contained HTML

Generates interactive, editable architecture diagrams from a project or idea, delivered as a single self-contained HTML file. Verifiable and editable after generation rather than a static image you have to redraw to change.

diagramsarchitecturehtmlvisualization
by lewes2 Aug 29, 2026 6/10
skill GitHub

Tersign skills: Counter-Signed, Dispute-Ready Evidence From Any Agent

Skills for producing, verifying, and submitting counter-signed evidence envelopes from Claude Code or any MCP-capable framework, formatted for external dispute venues including Internet Court, Kleros ERC-1497, and UMA. Niche, but a real answer to proving what an agent did.

attestationdisputesevidencemcp
by tersignhq Aug 29, 2026 5/10
skill GitHub

50k-website-builder: GSAP Motion System for Cinematic Marketing Sites

Claude and Cowork skill packaging a GSAP motion system, a library of signature scroll moves, a brand-to-build workflow, a working starter template, and in-browser QA, aimed at producing sites that read as expensively made. Written to be beginner friendly.

gsapanimationmarketingweb-design
by navinramharak-rgb Aug 29, 2026 6/10
skill GitHub

website-builder: Skill Suite for Fast, SEO-Ready Astro Sites

An open-source suite of agent skills that builds complete Astro websites from a prompt. It covers layout, accessibility, and SEO defaults so the generated site ships production-ready rather than as a scaffold. Works with Claude Code, Codex, and Antigravity.

astrowebseoskills
by karero Aug 29, 2026 6/10
skill GitHub

recursive-decomposition-skill: Handle Long-Context Tasks by Splitting Them

A Claude Code skill that breaks oversized tasks into recursively smaller subtasks so no single step blows the context window. The agent decomposes, solves the leaves, then reassembles results upward. Targets the failure mode where a task is too large to hold in one session.

contextdecompositionlong-contextskill
by massimodeluisa Aug 29, 2026 6/10
skill Reddit

One Prompt Line That Made Agents Stop Writing Run-On Summaries

After no amount of do/don't examples fixed verbose worklog and changelog output, this developer added a single line: 'Ask yourself: if each word cost $0.25, would I spend my budget on this sentence? If not, cut it.' Both the main agent and subagents snapped to tight, readable prose. A cheap edit for any CLAUDE.md or slash command that produces written summaries.

promptingclaude-mdslash-commandsverbosity
by callmejace Aug 29, 2026 7/10
skill GitHub

awesome-video-skills: Video-First Index of Open-Source Agent Skills

A curated index of agent skills for video production and visual support, organized around video workflows rather than general categories. Covers editing, generation, and visual asset tasks. A starting point if you are pointing an agent at video work.

videoskillsawesome-listmedia
by ella-wang-opus Aug 29, 2026 6/10
skill GitHub

legal-ai-skills: Installable Skills for Legal Tasks

A set of agent skills covering legal work — drafting, review, and document tasks — packaged for installation. Works across Claude, ChatGPT, and Codex rather than being tied to one harness. Narrow domain, but a rare example of skills built for a non-engineering profession.

legalskillsdocumentscross-agent
by Cancellationperiplocagraeca503 Aug 29, 2026 5/10
skill GitHub

agent-prompt-author: Diagnose Prompt Failures Before Rewriting Rules

A Claude Skill that runs five cheap diagnostic tests to identify why an agent prompt is misbehaving, so you fix the actual cause instead of piling on more rules. Ships with an eval harness that regression-tests the skill's own routing decisions. The self-testing part is the unusual bit.

promptingevalsskill-authoringdebugging
by amylyra Aug 29, 2026 8/10
skill GitHub

chunk-for-retention: Split Long Text Into Memorable Units

Chunks long-form text into macro-units sized around Sweller's Cognitive Load Theory, aiming for retention rather than token limits. Intended for studying and learning material, not for RAG ingestion. A different framing of the chunking problem than most tooling.

chunkinglearningtextcognitive-load
by K-Pourahmadian Aug 29, 2026 5/10
skill GitHub

bugzilla-skills: Claude Skills for Bugzilla Development

Four skills covering the Bugzilla maintainer workflow: bug triage, patch review, schema migration checks, and template review. Encodes project-specific conventions that a general agent would not know. A concrete example of skills scoped to one codebase's practices.

bugzillatriagecode-reviewperl
by topunix Aug 29, 2026 5/10
skill GitHub

dhh-vibe: The Rails Doctrine as an Opinionated Agent Skill

Translates DHH's Rails Doctrine — convention over configuration, majestic monolith, programmer happiness — into a single skill any agent can load. Pushes back on the sprawling, over-abstracted code agents tend to produce. One opinion, applied consistently.

railsconventionscode-styleskill
by bobbyryandra Aug 29, 2026 6/10
skill GitHub

purrlight-skills: Ten-Round Adversarial Critique Skill

Runs ten successive rounds of adversarial critique against a piece of work to surface blind spots a single review pass misses. Ships as both a Claude Code plugin and a claude.ai skill. Vietnamese-first, with English support.

critiquereviewadversarialvietnamese
by elisehanhnguyenus-cloud Aug 29, 2026 5/10
skill GitHub

anti-slop-ui-workflow: A Portuguese-Language Skill for De-Slopping Generated UIs

A skill for Claude Code, Codex and Cursor that runs an audit-then-polish pass ("Impeccable") over AI-generated interfaces, checking them against real-world design references and a concrete interface checklist rather than vague taste instructions. Includes Shoogle and shadcn conventions. Written in Portuguese, which makes it one of the few non-English design skills in the ecosystem.

skilldesignuishadcnportuguese
by Bren0o Aug 28, 2026 6/10
skill GitHub

Freestyle: A Skill That Detects Whether Your Cold Email Is Actually a Template

A Claude Skill that reads a cover letter, cold email or pitch and judges one thing: was it written for this specific recipient, or is it a generic template being performed at them. A narrow, opinionated check aimed at exactly the failure mode agent-drafted outreach falls into. Not a coding tool, but a clean example of a single-purpose evaluative skill.

skillwritingoutreachemailevaluation
by MichaelDoesMarketing Aug 28, 2026 6/10
skill GitHub

stop-design-slop: 284 Catalogued Tells of AI-Generated Web Design, With Fixes

An agent skill for Claude Code and Codex that hunts the visual signatures of AI-generated websites — the gradient-and-glassmorphism house style — and prescribes a specific fix for each. The catalogue runs to 284 researched tells. Works either as an audit pass over an existing site or as a constraint set while building a new one.

skilldesignfrontendauditcodex
by Juuzoe Aug 28, 2026 7/10
skill GitHub

majestic-abilities: Portable Agent Skills for Claude Code, Codex, Cursor and Pi

A skill collection written to run unchanged across four different agent harnesses rather than binding to Claude Code's format alone. The value is the portability: skills you write once do not have to be rewritten when you switch tools. Description is thin, so browse the repo to see which abilities are included.

skillsportablecodexcursorcross-tool
by majesticlabs-dev Aug 28, 2026 5/10
skill GitHub

airspeak: Lint Markdown Prose Against Simplified Technical English

Checks Markdown writing against ASD-STE100 Issue 9, the controlled-English standard from aerospace technical documentation, flagging vocabulary and constructions outside the approved set. Ships both as an omp extension and as a portable agent skill. Useful for keeping specs and docs readable when an agent is generating most of the prose.

skilllintingmarkdownwritingdocumentation
by donrami Aug 28, 2026 6/10
skill GitHub

Product-to-Prod: Product Management Skills With Every Claim Sourced or Flagged

A skills-and-plugin bundle covering the PM surface for agent-assisted work: evidence-tagged PRDs, specs, RICE prioritization, backlog and roadmap scoring, GTM launch plans and release verification. Its distinguishing rule is that every claim must carry a source or be explicitly labelled unsourced, which is a direct answer to agents inventing confident market numbers. Runs on Claude Code, Cowork and Codex.

product-managementprdprioritizationskillsroadmap
by naderelewa Aug 28, 2026 7/10
skill GitHub

claude-code-playbook (ArtVsMark): Every Rule Traced to a Real Failure

A rule set for Claude Code and GitHub pipelines where every rule documents the real incident it grew out of, the mechanism behind the failure, and where the rule does not apply. Russian and English. More useful than a generic best-practices list because the reasoning is preserved.

rulesincidentsgithubbest-practices
by ArtVsMark Aug 28, 2026 7/10
skill GitHub

Clarify-Intent: Make Claude Ask Before Acting on an Ambiguous Prompt

A skill that forces clarifying questions when an instruction is underspecified, instead of letting the model guess and hallucinate a direction. Small and targeted at the failure mode where a vague prompt produces confident wrong work.

clarificationpromptinghallucinationskill
by irfanannaafi19 Aug 28, 2026 6/10
skill Reddit

Managing Local Skills With the skillsOverride Session Setting

A developer with too many globally installed skills across Claude Code and Codex found that skillsOverride lets you scope which skills a session sees. Solves the problem where similar skills from different tools compete and the agent picks the wrong one.

skillsconfigurationsessionscoping
by jason3gb Aug 28, 2026 6/10
skill GitHub

adamlinscott/claude-skills: Planning, Building and Verification Gates

Open-source Claude Code skills that add explicit planning, building and verification gates to agentic coding. Aimed at workflows where the agent currently jumps straight from prompt to edit with nothing checking the result.

skillsplanningverificationgates
by adamlinscott Aug 28, 2026 6/10
skill GitHub

honest-audit: Make "No Issues Found" a Valid Audit Result

An anti-sycophancy guard for Claude Code that stops audits from inventing problems to look useful. Directly targets the failure where asking for a review guarantees you get findings whether or not any exist.

auditsycophancycode-reviewskill
by Dimerin1 Aug 28, 2026 7/10
skill GitHub

bestudios-skills: AI Video and Image Production Skills for Agents

Claude Skills packaging production workflows for agents, including ai-creative-studio which covers AI video and image production end to end. Useful as a worked example of encoding a real production pipeline as a skill.

videoimageproductionskills
by bestudios-io Aug 28, 2026 5/10
skill GitHub

ground-truth: Check What Your AI Claimed Against Your Git History

Points your AI assistant at your own git history, files and session logs and compares claimed progress against what the artifacts actually show. Local-only, and deliberately not a vibes-based self-assessment.

verificationgitsessionsevidence
by harshgoyal1 Aug 28, 2026 7/10
skill GitHub

pd-agent-skills: Product Development Skills With Brand-Neutral Renderers

Agent skills covering the product development loop — deciding what to build, producing the assets and marketing page that announce it, and testing the app it ships in. Combines brand-neutral rendering engines with written method maps, readable by any agent that reads a folder.

productmarketingtestingskills
by notdaran Aug 28, 2026 5/10
skill GitHub

DailyWork: Runnable PM Skills for Claude Code and Codex CLI

Skills a product manager actually runs during a work week: metric attribution, a PRD review panel, a cross-model GO/NO-GO gate, blind A/B testing, audience-tailored briefs, decision triage, session handoff, meeting notes and peer-feedback drafting. Presented as runnable engines rather than prompt snippets.

product-managementskillsreviewhandoff
by aaronartistzhang-afk Aug 28, 2026 5/10
skill GitHub

website-audit: Turn a URL Into a Technical Audit and a Client-Ready Quote

A Claude Code skill that audits any URL across security, application, performance, SEO and accessibility, then produces a price quote you can hand a client. Aimed at agencies and freelancers doing prospect audits.

auditsecurityperformanceaccessibility
by mohanedashraff Aug 28, 2026 6/10
skill GitHub

scroll_animated_webpages_skill: GSAP Scroll Sites With Playwright Verification

A Claude Code skill that builds scroll-animated websites end to end — a discovery wizard, a Scroll Score blueprint, a GSAP plus Lenis build, and real-browser verification through Playwright so the animation is checked rather than assumed.

gsapanimationplaywrightfrontend
by hemangjoshi37a Aug 28, 2026 6/10
skill GitHub

godfly-skills: 19 Protocol-Driven Skills Plus an A/B Gauntlet

Nineteen skills for Claude Code and Codex CLI including an adversarial reviewer, its evidence-grounded analysis spine and a production-ops discipline suite. Notably ships a gauntlet that A/B-tests any skill against a no-skill control — and reports that three of these skills lost to loading nothing.

skillsadversarial-reviewab-testingops
by CassioRoos Aug 28, 2026 6/10
skill GitHub

claude-memory-loop: One Small BRIEF.md Every Session Reads First

Installs a memory loop for Claude Code centered on a single small BRIEF.md that every session reads before doing anything, fed by a capture discipline for keeping it current. A deliberately minimal answer to cross-session amnesia.

memorysessionsbriefcontext
by Elliotoh-jin Aug 28, 2026 6/10
skill GitHub

stash (dd3ok): Load Only the One SKILL.md You Actually Need

Keeps your Agent Skills in a separate library and searches it by name or task, loading only the selected SKILL.md into context. A direct fix for the context cost of a large global skills directory.

skillscontextsearchlibrary
by dd3ok Aug 28, 2026 7/10
skill GitHub

discovery-os: Product Discovery Skills That Refuse to Invent Evidence

Seven skills that route a discovery question to whichever method your actual evidence can support, and explicitly refuse to invent a customer, a number or a confidence level. A useful pattern for any skill where fabrication is the main risk.

productdiscoveryevidenceskills
by riadchaban994-bot Aug 28, 2026 5/10
skill GitHub

CrowdStrike foundry-skills: Official Skills for Falcon Foundry Apps

CrowdStrike published skills for building Falcon Foundry apps — scaffolding, deployment and best practices for API integrations, collections, functions, UI extensions, UI pages and workflows. A notable example of a major security vendor shipping first-party agent skills.

crowdstrikesecurityskillsvendor
by CrowdStrike Aug 28, 2026 7/10
skill GitHub

claude-bible: Rules-as-Files Governance With a Declined-Decisions Journal

Makes Claude Code behave consistently across repos, sessions and people using rules stored as files with explicit precedence, a journal of decisions that were declined, and objection sparring. Sanitized from a live production system, MIT.

rulesgovernancedecisionsconsistency
by tonydzi Aug 28, 2026 6/10
skill GitHub

OliverCode: Commit Gates and Contracts That Load in Every Repo

A shared governance layer for Claude Code providing commit gates, contracts and skills that load automatically in whatever repo you are working in, so you do not re-install discipline per project.

governancecommit-gatesskillscontracts
by oliver-chase Aug 28, 2026 6/10
skill GitHub

one-star-risk: Re-Score Audit Findings by App Store Review Risk

A Claude Code skill that takes existing audit findings and re-ranks them by how likely each is to produce a one-star App Store review. Uses named, overridable triggers and a pluggable seam for grounding against real reviews.

app-storeauditprioritizationmobile
by Terryc21 Aug 28, 2026 5/10
skill GitHub

bug-prospector: Find the Bugs Pattern-Based Auditors Miss

Hunts for logic errors, broken assumptions, state machine gaps and semantic fragility — the classes of bug that rule-based and pattern-matching auditors do not catch because nothing about the code looks wrong.

bugsauditlogic-errorsreview
by Terryc21 Aug 28, 2026 6/10
skill GitHub

clearmode: A 43-Rule Anti-Slop Standard That Compiles to 18 Targets

Scores any document 0-100 against 43 rules across plain words, human voice, structure and information density. One JSON rule pack compiles to 18 targets including a Claude Code skill, AGENTS.md, a Cursor rule, a system prompt and a Vale style. Zero dependencies, runs offline.

writinglintingstandardsoffline
by eugeniughelbur Aug 28, 2026 6/10
skill GitHub

claude-plugins: Jujutsu (jj) Workflow Plugins with Git Hard-Wall

A set of Claude Code plugins that keep coding agents on Jujutsu instead of falling back to git, enforced by a hard wall. Covers project setup, parallel workspace orchestration, commit workflows, peer review, and race-safe query helpers. Relevant if you have moved a repo to jj and agents keep reaching for git commands.

jujutsujjpluginsvcsworkflow
by muloka Aug 28, 2026 7/10
skill GitHub

diagram-design: 38 Editorial Diagram Types as Self-Contained HTML and SVG

A skill library giving Claude Code, Codex, and Pi a catalogue of 38 editorial diagram styles that render as standalone HTML + SVG. Explicitly avoids Mermaid output and decorative shadows in favour of print-quality layouts. Handy for docs, architecture write-ups, and slides where Mermaid looks too generic.

diagramssvgdocumentationskill
by cathrynlavery Aug 28, 2026 7/10
skill GitHub

telegram-rich-content-skill: Telegram Publishing, Thumbnails, and Transcription

A skill for Claude Code and Codex covering Telegram rich message formatting, guarded bot publishing, YouTube thumbnail generation, and transcription. Aimed at people running a channel from their agent instead of a separate content tool.

telegrampublishingtranscriptionskill
by shromarketing Aug 28, 2026 5/10
skill Reddit

A Memory Rule That Stops Claude Assuming Complex Code Was Written on Purpose

A CLAUDE.md instruction for code review: treat anything committed from 2023 onward as possibly AI-generated regardless of the listed author, so unusual complexity is not automatically read as intentional. Addresses a real reviewer bias where the agent assumes hard-to-write code must exist for a reason.

code-reviewclaude-mdpromptpull-request
by Future_Addendum_8227 Aug 28, 2026 5/10
skill GitHub

ai-code-skils: Portable Precision-First Code Review and PR Skills

Code review and pull request skills written to work across Claude Code, Cursor, Codex, Copilot, Aider, or a plain chat window. Emphasizes precision over volume, aiming to cut the false positives that make agent reviews easy to ignore.

code-reviewpull-requestportableskill
by Barney241 Aug 28, 2026 5/10
skill GitHub

claude-codex-council: Pair Claude and Codex for Evidence-Based Deliberation

A Claude Code skill that runs Claude and OpenAI Codex as independent voices on architecture questions and root-cause investigations, requiring each to argue from evidence. Useful when a single model keeps confidently landing on the wrong diagnosis.

multi-modelarchitecturedebuggingdeliberation
by Marcussy34 Aug 28, 2026 7/10
skill GitHub

kb-template: Two-Tier, Git-Versioned Knowledge Base Kit for Agents

A plain-markdown knowledge base template that an agent maintains, versioned in git with a two-tier memory split between durable facts and working notes. No database or service dependency; MIT licensed.

knowledge-basememorymarkdowngit
by karrvel Aug 28, 2026 6/10
skill GitHub

ai-kit (yusufkaracaburun): The Agile Lifecycle as Claude Code and Cursor Primitives

One stack-agnostic kit shipping skills, subagents, slash commands, hooks, rules, and a Claude Code plugin manifest, organized around agile lifecycle stages. Supports exactly two hosts — Claude Code and Cursor — rather than claiming universal compatibility.

agileskillssubagentsplugin
by yusufkaracaburun Aug 28, 2026 6/10
skill GitHub

product-demo-video-skill: Truth-Linked Product Walkthroughs With Playwright and FFmpeg

An agent skill for Codex and Claude that produces product walkthroughs, launch films, and pitch videos, driving the real app with Playwright and assembling footage with FFmpeg. Motion is deterministic and shots are linked back to actual product behaviour rather than mocked up.

videoplaywrightffmpegdemo
by Afnanksalal Aug 28, 2026 6/10
skill Reddit

Auditing CLAUDE.md: Every Rule Must Point to Current Code, a Test, or an ADR

Argues that CLAUDE.md is easy to grow and hard to trust — months on, some rules describe deleted code and some workarounds have quietly become architecture. Proposes an audit where each instruction must cite live code, a test, or an ADR, repo invariants stay, and temporary warnings need an owner or an expiry condition.

claude-mdmaintenanceauditadr
by Gleb_SV Aug 28, 2026 6/10
skill GitHub

lingo (All3glory): A Shared Dictionary Your Agent Maintains While It Works

Keeps a live record of every named part of a project — modules, concepts, entities — updated by the agent as it works, so you and the agent mean the same thing by the same word. Addresses the drift where an agent invents its own vocabulary mid-project.

glossarynamingcontextdocumentation
by All3glory Aug 28, 2026 6/10
skill GitHub

god-prompt-mcp: Universal Coding System Prompt With TDD and Verification Gates

A portable system prompt and skill for Claude, ChatGPT, Cursor, and other coding agents, structured around test-driven development, explicit debugging protocols, and verification gates before work is called done. Aims to be host-agnostic rather than tied to one tool.

system-prompttddverificationportable
by AKzar1el Aug 28, 2026 5/10
skill GitHub

coherent-engineering: Capture Bottom-Up, Verify Deliberately, Answer Concisely

A Claude skill that structures reasoning into four moves — gather details bottom-up, interpret them in context, verify deliberately, then give one integrated answer — using the lightest process that still works. Aimed at avoiding both sloppy conclusions and unnecessary ceremony.

reasoningverificationprocessskill
by garcane Aug 28, 2026 5/10
skill GitHub

web-skill-atlas: Open Catalog of Skills and Prompts for Web Apps

A community atlas collecting AI skills, agent workflows, coding prompts and reusable instruction files aimed at modern web application development. Useful as a starting library when setting up skills for a frontend or full-stack project rather than writing each from scratch.

skillsweb-developmentcollectionprompts
by pneqnp-iswr Aug 27, 2026 6/10
skill GitHub

modern-python-guidance: Stop LLMs Writing 2019-Era Python

A guidance pack that corrects the outdated Python idioms models tend to reach for and pushes generated code toward current best practices. Drop it into a project so Claude Code writes modern typing, packaging and stdlib usage instead of legacy patterns learned from old training data.

pythoncode-qualityguidanceclaude-md
by yottayoshida Aug 27, 2026 6/10
skill GitHub

story-architect-skill: Truby's Anatomy of Story as an Agent Skill

Turns a single prompt into a structured story by first building a blueprint from John Truby's Anatomy of Story framework, then writing prose against it. The two-stage structure keeps long-form fiction coherent instead of drifting. Unofficial and unaffiliated.

writingfictioncreativeagent-skill
by NeuraCerebra-AI Aug 27, 2026 6/10
skill GitHub

fire-your-seo-agency: Self-Running SEO, AEO and GEO Audits

A Claude Code skill that audits and optimizes a site across SEO, AEO, GEO, LLMO and Naver NEO without an agency in the loop. Aimed at replacing recurring retainer work with an agent that runs the same checks on demand.

seomarketingauditagent-skill
by leopard627 Aug 27, 2026 6/10
skill GitHub

meteor/agent-skills: Official Agent Skills for Meteor 3

Meteor-maintained skills covering building, migrating, testing, securing and deploying Meteor 3 applications. Framework-authored rather than community-guessed, so the guidance matches what the Meteor team actually recommends.

meteorjavascriptofficialframeworkagent-skill
by meteor Aug 27, 2026 7/10
skill GitHub

telegram-mtpro-proxy-resolver: MTProxy Install and Repair Over SSH

A Claude Code skill that installs, diagnoses and repairs Telegram MTProxy on a remote host over SSH. Specifically catches the case where a proxy behind VPN or Docker advertises a private IP to Telegram — every health check passes green while clients hang on 'Connecting'.

telegramproxysshdevopsagent-skill
by guid-empty Aug 27, 2026 5/10
skill GitHub

linkedin-campaign-operator: Eight Skills for Running LinkedIn

A set of eight open-source Agent Skills that turn Claude Code or Codex into a LinkedIn operating system — campaign planning, content and outreach handled from the CLI. Useful if you'd rather script your social presence than click through the web UI.

linkedinmarketingsocial-mediaagent-skill
by sunny-chandel Aug 27, 2026 5/10
skill GitHub

archon: 83 Skills and 10 Agents Portable Across Five Platforms

A large MIT-licensed bundle of 83 skills and 10 agents with enforced guardrails, written once and deployable to five different AI platforms. Worth a look mainly for its portability layer — the same skill definitions run outside Claude Code without a rewrite.

skillsagentsportabilityguardrailsmit
by SufficientDaikon Aug 27, 2026 6/10
skill GitHub

Google Ads Audit Plugin Built From Nils Rooijmans' Public Writing

A Claude Code plugin packaging a Google Ads knowledge base and audit workflow derived from Nils Rooijmans' public blog and newsletter, with attribution. Unofficial, and written in Dutch. Narrow, but a clean example of turning a practitioner's published body of work into an agent skill.

google-adsmarketingauditplugindutch
by arnozaman Aug 27, 2026 5/10
skill GitHub

jarvis-os: Memory Hub That Loads From Any Directory

A persistent memory hub for Claude Code that stays available no matter which directory you launch from, bundled with a curated skill set and a guided local setup. Solves the annoyance of memory being scoped to a single project root.

memorypersistenceskillssetup
by ManceRayder42 Aug 27, 2026 6/10
skill GitHub

take-notes: YouTube Videos and Articles Into Study Notes

Converts a YouTube video or web article into didactic study notes rendered as a single self-contained HTML page. Works as an agent skill across Claude Code, Codex, Cursor, OpenCode and Gemini rather than being tied to one CLI.

noteslearningyoutubehtmlagent-skill
by davertor Aug 27, 2026 6/10
skill GitHub

Elenchus: Socratic Questioning Instead of an Instant Opinion

Rather than answering 'what do you think?' directly, this skill converts the question into multiple choice and then questions you the way Socrates would until your own view surfaces. Aimed at decision-making where you want the model to sharpen your thinking, not replace it.

socraticdecision-makingthinkingagent-skill
by jungogogogo Aug 27, 2026 6/10
skill GitHub

engram: Free-Recall Verification and FSRS-Scheduled Learning

A learning engine that builds first-principles curricula, verifies understanding through free recall with receipts rather than self-assessment, and schedules review with FSRS. Produces explorable artifacts so the material stays reviewable after the session ends.

learningspaced-repetitionfsrscurriculum
by nagisanzenin Aug 27, 2026 6/10
skill GitHub

ghostwriter: Rewrite Text in Your Voice, Not Claude's

Builds a style profile from writing you've actually done — sentence length, vocabulary you reach for and words you never use, how you open a message — then rewrites text to match. Ships a check pass that scores AI tells and a polish pass that strips them. Works with Claude Code, Codex CLI and any agent that reads skills off disk.

writingstylehumanizeragent-skill
by an2n Aug 27, 2026 7/10
skill GitHub

acartag7/skills: Adversarial Security Review With Executed PoCs

An installable Claude Code security-review skill that insists on executed proof-of-concept evidence rather than a list of plausible-sounding findings. The adversarial framing is aimed squarely at the false-positive problem in agent-generated security reports.

securitycode-reviewadversarialproof-of-concept
by acartag7 Aug 27, 2026 7/10
skill GitHub

awesome-sre-skills: Curated SRE Skills and MCP Servers

A curated list of SRE-focused agent skills, MCP servers and AI-SRE resources. A useful index if you're wiring an agent into incident response, observability or on-call workflows and don't know what already exists.

sredevopsmcpcollectionawesome-list
by anyshift-io Aug 27, 2026 6/10
skill GitHub

annie-skills: Teaching Agents to Drive the Annie CLI and Anyshift MCP

A public Apache-2.0 skill library that teaches AI agents how to use the Annie CLI and the Anyshift MCP server correctly. Vendor-specific, but a clean example of shipping usage knowledge for your own tool as skills rather than docs.

mcpclivendor-skillsapache-2.0
by anyshift-io Aug 27, 2026 5/10
skill GitHub

sokrates-skills: Source-Code Analysis With Verifiable Findings

Skills that let AI coding tools run Sokrates source-code analyses, explore the results interactively, and generate configuration. Findings are verifiable against the underlying scan rather than being model assertions about the codebase.

static-analysiscode-qualitysokratesagent-skill
by zeljkoobrenovic Aug 27, 2026 6/10
skill GitHub

thkt/dotclaude: 28 Skills, 28 Agents and Quality-Gate Hooks

A personal Claude Code configuration published in full — 28 skills, 28 agents, deterministic multi-agent workflows and hooks that act as quality gates. Worth reading as a reference for how a heavily-invested setup is actually structured.

dotfilesconfigurationskillshooksmulti-agent
by thkt Aug 27, 2026 6/10
skill GitHub

awesome-stock-quant-skills: Trading and Stock-Picking Agent Skills

A Chinese-language index of agent skills for stock analysis, quantitative trading and stock screening, collecting projects from GitHub with compliance notes on reposted material. Narrow domain, but well organized for it.

financequanttradingcollectionchinese
by Serennity007 Aug 27, 2026 5/10
skill GitHub

cover-anatomy-skill: Reverse-Engineer a Viral Cover Into a Recipe

Takes a viral cover image and produces an annotated anatomy report card explaining what makes it work, plus a reusable recipe. Renders deterministic HTML and uses no crawler, so results are reproducible.

designvisualanalysishtmlagent-skill
by jahidashok714-svg Aug 27, 2026 5/10
skill GitHub

record-a-skill: Turn a Working Session Into an Installable SKILL.md

After a workflow finally works, say 'save this as a skill' and it captures the session into an installable SKILL.md. Inverts the usual authoring order — you discover the procedure by doing it, then record it, rather than writing the skill up front. Works with Claude Code, Cursor and Codex.

skillsauthoringsessionsmeta
by rezamini Aug 27, 2026 8/10
skill GitHub

claude-product-skills: The Figma Work That Isn't Drawing Screens

Claude Code skills covering the surrounding half of design work — handoff, specs, naming, and the product documents that sit beside the file — rather than generating the screen itself. Aimed at product designers whose real time sink is everything around the canvas.

figmadesignproductdocumentationagent-skill
by byjunyoung Aug 27, 2026 6/10
skill GitHub

claude-dere: Anime-Archetype Output Styles for Claude Code

A set of output styles that keep the answers and line numbers identical while changing the persona delivering them, drawn from anime character archetypes. Purely cosmetic, and a compact example of how far output styles can be pushed.

output-stylespersonafuncustomization
by Luscha Aug 27, 2026 5/10
skill GitHub

wechat-sticker-submit: One Photo to a Submittable Sticker Pack

A Claude Code skill that scripts the whole WeChat sticker pipeline from a single front-facing character image — generation, slicing, automated pre-checks, copy validation and the final submission checklist. Every step is scripted rather than manual.

wechatstickersimage-generationpipelinechinese
by webkubor Aug 27, 2026 5/10
skill GitHub

Proxmox Technical Writing Style Skill

An unofficial skill encoding the Proxmox documentation house style so generated docs match the project's existing voice and conventions. Narrow, but a good template for anyone maintaining docs against an established style guide.

documentationwriting-styleproxmoxagent-skill
by msoltanov Aug 27, 2026 5/10
skill Reddit

EpicInfographics: Pull Data and Animate Infographics From Claude Code

A skill built because the author found Claude Code's native infographic output lacking — it pulls the data, generates the graphics and animates the result. Author is actively asking for feedback on the output quality.

infographicsdatavizanimationagent-skill
by b0nz Aug 27, 2026 6/10
skill GitHub

AsyrafHussin/agent-skills: Laravel, PHP, React and TypeScript

A skill collection for AI coding agents covering Laravel, PHP, React and TypeScript along with testing, security and general code quality. Framework-specific guidance rather than generic best-practice text.

laravelphpreacttypescripttesting
by AsyrafHussin Aug 27, 2026 6/10
skill GitHub

skill-reviewer: Candid Skill Reviews With file:line Citations

Reviews Claude Code skills and says plainly what's wrong, citing file and line for each point and ranking the actions to take. Explicitly avoids the padding that makes most generated reviews hard to act on.

code-reviewskillsqualitymeta
by Terryc21 Aug 27, 2026 7/10
skill Reddit

Grounded Engineering: Practice Cards Distilled From Real Repos

Studies mature public engineering and agent repositories, records the observed patterns with source links and confidence, then distils them into small practice cards you can review and apply. An npm CLI generates the resulting managed guidance directly into CLAUDE.md.

claude-mdbest-practicescliguidanceopen-source
by MadJagStudios Aug 27, 2026 6/10
skill GitHub

pennylane-api-toolkit: Claude Skills and a Pitfalls Catalogue

A PowerShell library plus Claude skills for the multi-company Pennylane Company API v2, shipped with a catalogue of the API's known pitfalls. The pitfalls catalogue is the interesting part — encoded failure modes an agent would otherwise rediscover the hard way.

apipowershellaccountingagent-skill
by Xileades Aug 27, 2026 5/10
skill GitHub

repo-glowup: Audit Your Repo's First Impression and Rewrite the README

Looks at your repository the way a first-time visitor would, points out what fails to land, and rewrites the README accordingly. Targets the gap between a project being good and a project looking good on arrival.

readmedocumentationrepo-hygieneagent-skill
by erdalacundakonuk Aug 27, 2026 6/10
skill GitHub

idea-to-video-skill: One Sentence to a Detailed Video

Expands a single sentence into a detailed video, but asks clarifying questions before generating rather than guessing at the intent. The upfront questioning is what separates it from the usual one-shot generators.

videogenerationagent-skill
by minhhoangho Aug 27, 2026 5/10
skill GitHub

skills-for-course-creators: Agent Skills for Educators and L&D

A curated directory of Agent Skills for course creators, instructional designers and L&D teams, covering course assets, research, role-play practice, training analysis, visuals and delivery workflows.

educationinstructional-designcollectionagent-skill
by minicoursegenerator Aug 27, 2026 5/10
skill GitHub

super-mkt: Direct-Response Copywriting as a Portable Skill

A direct-response copywriting skill that runs in Claude Code, Claude.ai, Cursor, ChatGPT or any LLM. Encodes the classic response-driven structure rather than generic marketing prose.

copywritingmarketingportableagent-skill
by Bilusca Aug 27, 2026 5/10
skill GitHub

humanizer-de: 72 German AI-Writing Tells, Linted Deterministically

Audits German text against 72 catalogued AI-writing patterns using deterministic linters and rewrites that preserve the facts. Explicitly refuses to bend facts or use detector-bypass tricks, which sets it apart from most humanizer tools.

writinggermanhumanizerlinting
by marmbiz Aug 27, 2026 6/10
skill GitHub

seo-writers: Evidence-Safe SEO Planning, Writing and Auditing

An open-beta plugin for Codex and Claude Code covering SEO planning, writing, editing, auditing and visual production, with an evidence-safe stance that avoids inventing supporting claims. Broader than the usual single-purpose SEO skill.

seocontentwritingpluginaudit
by flexim-io Aug 27, 2026 5/10
skill GitHub

agent-config: One Rules File Plus Four-Layer Memory Across Claude, Codex, Cursor

A portable AI-agent setup that keeps a single canonical rules file working across Claude Code, Codex, and Cursor instead of maintaining three divergent configs. It ships skills, hooks, and a four-layer memory system split into rules, knowledge, structure, and history. Useful if you switch agents often and want one source of truth for behavior.

configmemoryportabilitymulti-agent
by AuroraBackcountry Aug 27, 2026 6/10
skill GitHub

skillsmith: Interview-Driven Generator That Drafts and Packages Claude Skills

skillsmith turns any process or document into a Claude Skill by interviewing you about it, then drafting, validating, and packaging the result. It runs as a CLI or natively inside Claude products. Lowers the barrier for people who know what they want a skill to do but not how SKILL.md should be structured.

skillsgeneratorcliauthoring
by marcosmodly Aug 27, 2026 8/10
skill GitHub

github-launch-kit: Agent Skill Writing Your README, llms.txt, and Repo Topics

An agent skill focused on GitHub discoverability: it generates your README, llms.txt, repo topics, and About line so both search engines and LLMs can parse what your project does. Works with Claude Code, Codex, Cursor, and Zed. The author explicitly makes no ranking promises.

readmeseollms-txtdocumentation
by NeuraCerebra-AI Aug 27, 2026 6/10
skill GitHub

ast10-agent-skills: OWASP Agentic Skills Top 10 as Eleven Eval-Backed Detectors

A community implementation of the OWASP Agentic Skills Top 10 (AST01-AST10) turned into eleven installable detector skills, each backed by evals. It is explicitly unofficial and carries no OWASP endorsement. Useful if you want a concrete checklist for auditing the skills you install.

securityowaspskillsauditing
by jhkchan Aug 27, 2026 7/10
skill GitHub

qaskills: Curated Directory of Testing-Specific Skills for Coding Agents

A curated directory of QA and testing skills built for AI coding agents including Claude Code, Cursor, and Copilot. It collects testing-specific capabilities in one browsable place rather than leaving you to find them repo by repo. A reasonable starting point if your agent workflow is weak on test authoring.

qatestingskillsdirectory
by PramodDutta Aug 27, 2026 7/10
skill GitHub

crazy-skills: Two-Tier Catalog of Curated OpenCode-Native Skills

A curated skill collection pulling from superpowers, VoltAgent, addyosmani, alireza, and others, adapted to be OpenCode-native. It uses a two-tier catalog: 18 core skills always loaded, 35+ extended skills pulled in on demand. The tiering is aimed at keeping context cost down while retaining breadth.

skillsopencodecatalogcuration
by viasrijan Aug 27, 2026 6/10
skill GitHub

soundtouch-decloud: Skill Reviving Bose Speakers After the Cloud Shutdown

A Claude Code skill that brings Bose SoundTouch speakers back to life after Bose shut down the cloud service they depended on. It stands up a self-hosted replacement, recovers each stations direct stream URL, and verifies every preset actually plays. A good concrete example of using an agent skill for hardware reverse-engineering rather than coding.

hardwareself-hostedreverse-engineeringiot
by bitranox Aug 27, 2026 6/10
skill GitHub

styleshift: Claude Skills That Switch Conversations Into Named Writing Styles

A set of Claude skills that flip a conversation into a named creative writing voice: Yoda, Shakespearean sonnet, stage play, Dr. Seuss, haiku, limerick, Homeric epic, hard-boiled noir, and Hemingway. Each mode carries precise structural rules so the output stays well-formed rather than vaguely themed. Activated by slash command, exited with /normal.

writingstylesslash-commandscreative
by LkwdBrian Aug 27, 2026 6/10
skill GitHub

gap-skills: One Adaptive Skill Covering Intent Through Verified Release

A single adaptive skill that spans the whole delivery path, from stating intent to shipping a verified release, rather than splitting the work across many narrow skills. The pitch is trustworthy AI software delivery with checks built into each stage. Worth evaluating if you prefer one broad skill over a large catalog.

skillsdeliveryverificationsdlc
by leoncuhk Aug 27, 2026 5/10
skill GitHub

coding-standards-Skill: One Engineering Standard for C, Rust, and Go Agents

Packages a cross-language engineering coding standard as an AI skill, targeting C, Rust, and Go. Instead of restating style rules in every prompt, the agent loads the standard and applies it consistently. Useful for systems codebases where conventions matter more than the agent guesses.

standardscrustgo
by 29anan29 Aug 27, 2026 6/10
skill GitHub

psi-writing-skills: Prose That Does Not Read as Machine-Generated

Claude Code skills for writing and revising non-fiction prose, aimed specifically at removing the tells that mark text as AI-generated. Covers both English and German. From a university research group, so the guidance leans academic rather than marketing-flavored.

writingproseeditinggerman
by UBA-PSI Aug 27, 2026 7/10
skill GitHub

council: A 25-Expert Advisory Panel That Roasts Your Hard Decisions

A Claude Code skill that convenes a 25-member panel of famous experts to critique a difficult decision rather than agree with it. The explicit design goal is adversarial feedback instead of a yes-man advisory board. Documentation is in Korean.

advisoryadversarialdecision-makingpanel
by airoasting Aug 27, 2026 6/10
skill GitHub

Turn One Raw Facecam Take Into a Finished Short-Form Ad

A Claude Code skill plus written playbook that takes a single unedited facecam recording and produces a finished short-form motion-graphics ad, rendered through HyperFrames. The playbook encodes the editing decisions — pacing, captions, graphic beats — so the agent isn't improvising the format each run. Aimed at creators who want repeatable ad output rather than one-off edits.

skillvideocreativeautomation
by gquthier Aug 27, 2026 6/10
skill GitHub

flint: Two Drop-In Files That Make Claude Code Write and Talk Less

A CLAUDE.md fragment plus a tuning prompt that trim Claude Code's verbosity — both in the prose it emits and in the volume of code it writes. There is nothing to install: you paste the fragment into your existing config, and the prompt rewrites the rules you already have to match. A cheap experiment if your sessions feel padded.

claude-mdpromptingverbosityconfig
by V-Songbird Aug 27, 2026 6/10
skill GitHub

dev-agent-skills: Git, GitHub and Skill-Authoring Skills Plugin

A Claude Code skills plugin covering everyday Git and GitHub workflows plus the meta-task of authoring new skills. Bundling skill authoring alongside the Git skills means the plugin can help extend itself as your conventions evolve. A reasonable starting pack if you haven't built up a personal skills library yet.

skillsgitgithubplugin
by fvadicamo Aug 27, 2026 6/10
skill GitHub

skill-library-revamp: Audit Your Skills Library for Bloat and Duplicates

A read-only audit that reports on the health of your Claude Code skills library — what each skill costs in context, where descriptions overlap, and which entries are duplicates or dead weight. It names the offenders rather than just producing a score, so the cleanup is actionable. Worth running once a skills directory grows past the point you can hold in your head.

skillsauditcontextcleanup
by Mr-heka Aug 27, 2026 7/10
skill GitHub

meeting-design: Design the Meeting Before You Run It

An agent skill that plans a meeting as a decision process: it names the decision being made, picks the decision rule, cuts the invite list, and prepares for deadlock in advance. Ships fill-in agenda templates and needs no terminal, so non-engineers on the team can use it too. Off the usual coding-tools path but a clean example of skills applied to process work.

skillmeetingsprocesstemplates
by theAnirudhKumar Aug 27, 2026 5/10
skill GitHub

qa-ai-skills: Agent Skills for Requirements Review and Test Design

A collection of agent skills aimed at QA work — requirements review, test design, and test automation scenarios — written from practical use rather than as a generic template set. Documentation is primarily in Chinese. Useful if you want the agent participating in test planning instead of only writing test code after the fact.

skillsqatestingautomation
by signjing Aug 27, 2026 6/10
skill GitHub

data-migration: Prove a Migration Actually Landed on the Destination

A verification skill built on the observation that matching row counts and a clean migration run are perfectly compatible with a completely wrong result. It checks the destination data itself rather than trusting the migration job's exit status. Pure stdlib Python with no dependencies, so it drops into most environments unchanged.

skilldatamigrationverificationpython
by shaheershoaib Aug 27, 2026 6/10
skill GitHub

millieskills: Research-Driven Universal Skills Across the Dev Lifecycle

A broad skills collection spanning UI/UX, code repair, security, testing, architecture, backends and APIs, databases, mobile, DevOps, docs, debugging, refactoring, optimization, planning, verification, and auditing. The skills are written to work across major coding agents rather than being Claude Code specific. Large surface area, so cherry-pick rather than installing wholesale.

skillscross-agentarchitecturetesting
by cassielxyz Aug 27, 2026 6/10
skill GitHub

actual-skill-openclaw: ADR-Powered CLAUDE.md and AGENTS.md Generator

A CLI skill for ClawdHub/OpenClaw that generates CLAUDE.md and AGENTS.md files from architecture decision records. Grounding agent instructions in ADRs means the guidance reflects decisions the team actually made rather than aspirational rules someone typed once. Fits projects already maintaining ADRs.

skillclaude-mdadropenclaw
by actual-software Aug 27, 2026 6/10
skill GitHub

strategy-skills: Strategy, SEO/GEO and Analytics Skills for Claude Code

A skills pack covering business strategy work, SEO and generative engine optimization, and analytics, published by the Emotion Machine team. Extends Claude Code past implementation into the planning and measurement side of shipping a product. Narrow audience, but a useful reference if you're writing skills for non-engineering domains.

skillsstrategyseoanalytics
by sarbak Aug 27, 2026 5/10
skill GitHub

ll-sec: Security Audit Skill for AI-Generated Web Apps

A read-only Claude Code skill that audits any web application for security issues and produces an HTML report written to be readable by the system's owner, not just by engineers. Targeted specifically at code generated by AI, where the usual review pass may never have happened. Documentation is in Portuguese.

skillsecurityauditweb
by rootLdr Aug 27, 2026 6/10
skill GitHub

paperthrice: Agent Skills for Reading Research Papers Properly

Encodes Keshav's three-pass method for reading papers as agent skills, alongside reproduction specs, paragraph-by-paragraph translation, and durable note-taking. The three-pass structure means the agent triages before committing to a deep read, rather than summarizing everything at the same shallow depth. Aimed at people who read papers seriously and want notes that survive past the session.

skillsresearchpapersnotes
by hirovel Aug 27, 2026 6/10
skill GitHub

h-dubitans/skills: Agentic Skills That Teach Your LLM to Doubt

A small skills collection built around getting a model to question its own claims rather than assert confidently and move on. The framing is epistemic: make uncertainty explicit as part of the workflow instead of a caveat at the end. Sparse documentation, but the premise is a useful counterweight to agents that never hedge.

skillsepistemicsverificationuncertainty
by h-dubitans Aug 27, 2026 5/10
skill GitHub

ai-video-prompting: Field-Tested Playbooks for Veo 3.1, Seedance and Wan 3.0

Prompting skills and playbooks for AI video generation across Google Veo 3.1, Gemini Omni Flash, ByteDance Seedance, and Alibaba Wan 3.0. Sources are cited, and the material covers cost models, debugging content-filter rejections, and keeping continuity across multiple clips. More operational detail than the usual prompt list.

skillsvideopromptinggenerative
by raphaelbgr Aug 27, 2026 6/10
skill GitHub

evenhub-g2-skill: Ground Rules for Building Even Realities G2 Glasses Apps

An agent skill packaging hard-won conventions for developing Even Realities G2 / EvenHub smart-glasses applications. It front-loads platform gotchas so the agent does not rediscover them on every project. Narrow audience, but a good example of encoding device-specific tribal knowledge as a skill.

skillsmart-glasseseven-realitiesdomain-knowledge
by goodrahstar Aug 26, 2026 5/10
skill GitHub

mosofin-finance-skills: Read-Only Accounting Skills via MCP Gateway

A skills pack covering month-end close, bank reconciliation, journal entries, GL coding, financial statements, AR aging and three-way match, running against real books through the MosoFin MCP gateway. Every output is a proposal for a human to post, never a direct write, which is a sensible safety design for financial data. Distributed through the mosofin-plugins marketplace and requires a paid subscription.

skillaccountingfinancemcppluginread-only
by mosofin Aug 26, 2026 5/10
skill GitHub

customer-success-skills: Renewal Risk, QBRs, and Onboarding Plans as Skills

A set of AI skills for customer success teams covering renewal risk assessment, business reviews, onboarding plans, post-call follow-ups and email critique. No setup or external service required. A straightforward example of packaging a non-engineering job function as skills.

skillcustomer-successbusinessno-setup
by CSPulse Aug 26, 2026 5/10
skill GitHub

unternehmer-skills: 23 German-Language Skills for Small Businesses

A Claude Code plugin bundling 23 German-language skills aimed at freelancers and small businesses, marketed as an AI-employee starter kit. Notable mainly as evidence that the skills ecosystem is developing outside English. Useful if you operate in German and want business tasks covered rather than coding tasks.

skillgermanpluginbusinesslocalization
by fabio-baumgartner Aug 26, 2026 5/10
skill GitHub

vaultwatch: AI Knowledge Base Audited Against Reality Before Each Session

A Karpathy-style knowledge base paired with two auditor agents that re-measure its claims against the running system before every session, so stale documentation gets caught instead of silently misleading the agent. Ships as an installable Claude Code skill alongside an explanatory article. Directly attacks the problem where memory files anchor an agent to facts that stopped being true weeks ago.

skillknowledge-baseauditdocumentationverification
by yvalenta Aug 26, 2026 6/10
skill GitHub

claude-code-goal-mode: /goal Skill With Hooks That Enforce Bounded Work Cycles

A self-driving /goal skill that takes one objective, breaks it into falsifiable deliverables, and does one bounded unit of work per cycle. Shell hooks enforce the rules mechanically, on the premise that prose instructions do not hold over long autonomous runs. A useful pattern for anyone whose agent drifts halfway through a multi-hour task.

skillhooksautonomygoalslong-running
by TimothyVang Aug 26, 2026 7/10
skill GitHub

brians-agent-skills: PR Quality and TypeScript Testing Judgment as Skills

A set of agent skills that encode engineering judgment rather than syntax rules, covering pull-request quality review and TypeScript unit, mutation, and property-based testing. Written to be portable across Cursor, Claude Code, and Codex. Useful if your agents write tests that pass but do not actually test anything.

skillstestingtypescriptcode-reviewmutation-testing
by elearningplugins Aug 26, 2026 6/10
skill Reddit

Plugin That Makes Claude Code Messages Plainer and Easier to Scan

A first-release plugin that reshapes Claude Code's replies to be cognitively easier to read and scan, aimed at users who find the default answer style dense. The author reports noticeably nicer messages on their own project and pairs it with the newer concise output style. Early and feedback-wanted, but a small fix for a common complaint.

pluginoutput-stylereadabilityux
by t10ko Aug 26, 2026 6/10
skill GitHub

social-media-research-skills: Agent Skills for Cross-Platform Social Research

A skill pack for social media research from a coding agent: finding outlier posts, mining comments, competitor teardowns, ad libraries, and trends across TikTok, Instagram, YouTube, Reddit, X, and LinkedIn. Backed by the ScrapeCreators API and works with Claude Code, Cursor, Codex, and Gemini CLI. Note that the data layer is a paid third-party service.

skillsresearchsocial-mediascrapingmarketing
by ScrapeCreators Aug 26, 2026 6/10
skill Reddit

A CLAUDE.md Prompt That Cuts Opus 5's Narration Without Cutting Its Work

A shared CLAUDE.md snippet that treats prose to the user as the scarce resource and tool calls as free: spend freely on reading, grepping, re-checking APIs, and running tests; spend almost nothing on narrating, restating, summarizing, or offering unrequested alternatives. It explicitly forbids truncating the work or skipping verification to save words. Written after the author noticed Opus 5 becoming terse and productive once told context was low.

claude-mdpromptingopus-5verbosityconfiguration
by pornthrowaway42069l Aug 26, 2026 7/10
skill GitHub

render-visual-skill: Render Programmable Images and Animations From an Agent

A skill and plugin that lets an agent produce visuals programmatically — both static images and animations — instead of describing what a diagram would look like. Useful for generating charts, illustrations, and motion output as part of a coding session.

skillpluginvisualsanimationrendering
by imshaikot Aug 26, 2026 6/10
skill GitHub

claude-skill-timesheet: Rebuild a Weekly Timesheet From Git History

A Claude Code skill that reconstructs your weekly timesheet by reading git history across every repository you configure, inferring hours from the gaps between commit timestamps. A pragmatic fix for retroactive time tracking when you forgot to log anything. Estimates are heuristic, so treat the output as a starting draft.

skillgittimesheetautomationreporting
by lucas-lima-s Aug 26, 2026 6/10
skill GitHub

onbelay: Guardrails and Workflow Skills to Keep Agents On Target

Combines guardrails for coding agents with workflow skills intended to keep them working on the problem you actually posed. The pairing matters — constraints alone stop bad actions but do not prevent an agent solving the wrong thing. Aimed at long sessions where scope quietly shifts.

guardrailsskillsworkflowscopesafety
by sid-thephysicskid Aug 26, 2026 6/10
skill GitHub

devtronic-plugin: Marketplace With 35 Skills, 15 Agents, and Workflow Hooks

A Claude Code plugin marketplace bundling 35 skills, 15 subagents, and workflow hooks for structured AI-assisted development. Broad enough to serve as a starting kit rather than a single-purpose add-on. As with any large third-party bundle, worth reading the hooks and permissions before installing.

marketplacepluginskillssubagentshooks
by r-bart Aug 26, 2026 6/10
skill GitHub

unslop: Strip AI Writing Tells at the Surface and Narrative Layers

A model-agnostic skill that removes AI writing tells on two levels: surface phrasing, using the Wikipedia Signs of AI writing list, and narrative structure, using the StoryScope framework from arXiv:2604.03136. The two-layer approach is the interesting part, since most de-slop tools only catch stock phrases and miss structural giveaways.

skillwritingeditingai-detectionprose
by badmuriss Aug 26, 2026 7/10
skill GitHub

playbook: Agent Skills for PRDs, Story Maps, ADRs, and Sliced Issues

Skills covering everything upstream of implementation — lean canvas, PRD, story map, context maps, ADRs, and INVEST-sliced issues — while deliberately leaving the build stage to you. A useful counterweight to tooling that jumps straight to code. Good fit if your agents produce working code for underspecified problems.

skillsproductprdadrplanningrequirements
by clnnn Aug 26, 2026 6/10
skill GitHub

data-scientist: 10 Data-Science Skills From Framing to Production Analytics

A family of ten skills covering the data-science lifecycle for agents: problem framing, exploration, data prep, metric design, experiments, model auditing, dashboards, reporting, and production analytics. Structured as discrete stages rather than one catch-all analysis skill. Useful if you want an agent to follow a defensible method instead of jumping to a model.

skillsdata-scienceanalyticsexperimentsreporting
by DAlanMtz Aug 26, 2026 6/10
skill GitHub

uxi: UX Research and UI Design Skill With WCAG 2.2 Checks and Linters

A UX and UI skill for Claude Code that runs surface-class-aware audits, WCAG 2.2 accessibility checks, visual craft review, research methods, and deceptive-pattern screening, backed by runnable lint tools rather than opinion alone. The deceptive-pattern screening is an unusual inclusion. Good for teams shipping UI without a designer in the loop.

skilluxuiaccessibilitywcagdesign-review
by ahammadnafiz Aug 26, 2026 7/10
skill GitHub

prompt-engineer-skill: Prompt Engineering as a Procedure, Not a Document

Treats prompt engineering as a routine with steps: it routes to the appropriate artifact, sizes the eval set to the expected volume, and ships both a linter and a benchmark. The emphasis on measurement separates it from prompt-tip collections. Useful if you are maintaining prompts in production and need to know when a change helped.

skillprompt-engineeringevalslinterbenchmark
by AdrianAdem Aug 26, 2026 6/10
skill GitHub

seo-ops: 26 Deterministic SEO Foundation Checks as an Agent Skill

Give it a URL and it returns a crawler's-eye pass/fail report backed by evidence, running 26 structural SEO checks with no LLM involved in the verdicts. Determinism is the point — the same page always produces the same result, unlike a model asked to eyeball SEO. Packaged as an Agent Skill so it drops into an existing workflow.

skillseodeterministicauditweb
by tigerless-labs Aug 26, 2026 7/10
skill GitHub

novel-idea-hunter: Evidence-First Opportunity Discovery for Coding Agents

A skill for finding project opportunities that requires evidence for each idea rather than generating plausible-sounding suggestions, with explicit anti-slop constraints. Works with Claude Code and Codex. Useful if brainstorming sessions with an agent tend to produce confident but unfounded ideas.

skillideationresearchevidencecodex
by lokicik Aug 26, 2026 5/10
skill GitHub

claude-md-doctor: Audit CLAUDE.md and Backtest Every Rule Against Your Sessions

Checks a CLAUDE.md or AGENTS.md for size problems, dead file references, and claims that have drifted from reality, then does the part nobody else does: backtests each rule against your own session history to show which rules actually get followed, which get ignored, and which never come up. The report cites its evidence. Directly targets the common problem of instruction files that keep growing while quietly losing effect.

claude-mdauditagents-mdsession-historyconfiguration
by agent-clinic Aug 26, 2026 8/10
skill Reddit

A Community Blacklist of Claude Phrasing for Your AGENTS.md

A working list of banned words and phrasing patterns one user keeps in AGENTS.md to stop the model producing invented jargon and compressed buzzwords. The thread collects additions from other people hitting the same problem. Copy-pasteable if you want plainer output.

claude-mdwritingprompting
by endgamer42 Aug 26, 2026 5/10
skill Reddit

Pairing Caveman and Ponytail Skills for Terse Opus 5 Output

A short report on stacking two published skills — caveman and ponytail — to cut Opus 5 responses down to a few readable lines. Includes links to both on skills.sh and a screenshot of the result. Worth a look if verbose agent output is slowing your review loop.

skillsoutput-styletokens
by zyakita Aug 26, 2026 5/10
skill Reddit

A Backend Performance Review Skill That Runs the Code Instead of Reading It

The author built an Agent Skill for backend performance review, then blind-tested it against their own manual review of the same public repo. The agent found a Python 2 except clause in fastapi/full-stack-fastapi-template that made the module unimportable — something reading alone had missed. A concrete argument for execution-based review skills.

skillscode-reviewperformancetesting
by Alarmed_Offer_3213 Aug 26, 2026 7/10
skill Reddit

CLAUDE.md Rules to Work Around Opus 5 Behaviors

Concrete CLAUDE.md rules addressing specific Opus 5 habits, starting with its reluctance to spawn subagents by default — which lets the main context fill with detail it does not need. Includes a delegation section spelling out self-contained briefs and read-only exploration that returns conclusions, not file contents.

claude-mdsubagentsdelegationcontext
by ychamel Aug 26, 2026 7/10
skill GitHub

agent-troubleshoot-skill: A Self-Learning Troubleshooting Case Base

A troubleshooting knowledge base packaged as a skill for Codex, Claude Code, and opencode, which accumulates cases as the agent hits and resolves them. Bilingual Chinese/English. Aimed at teams that keep debugging the same class of failure across projects.

troubleshootingknowledge-baseskills
by cjc505 Aug 26, 2026 6/10
skill GitHub

thl-open: A Claude Code Audit Suite for AI-Search Visibility

A GEO/AI-search audit toolkit built around two original tools — agent-readiness-scan and audit-report-kit — plus the method connecting them. For checking whether your site is legible to AI search and agent crawlers.

seogeoauditai-search
by techhorizonlabs Aug 26, 2026 5/10
skill GitHub

css-pro-tips: A Baseline-Aware Modern CSS Skill for Coding Agents

One SKILL.md teaching agents modern CSS with Baseline browser-support awareness, so suggestions account for what actually ships. Works across Claude Code, Codex, Cursor, Pi, OpenCode, and Kiro.

cssfrontendbaselineskills
by PyModel Aug 26, 2026 6/10
skill GitHub

visual-artifacts: Turn a Project Into a Diagram-Driven HTML Explainer

A Claude Code skill that generates a shareable HTML explainer with Technical, User, and Business tabs from any project or idea. The output is meant to be readable by both humans and agents, so it doubles as project context.

documentationdiagramshtmlskills
by svag2003 Aug 26, 2026 6/10
skill GitHub

lattice: Composable Skills That Install Engineering Discipline in Any Agent

Skills covering design, implementation, review, and team standards that compose rather than replace each other. The pitch is better process rather than better prompts — the constraint lives in the workflow, not in one large instruction block.

skillsprocessreviewstandards
by techygarg Aug 26, 2026 6/10
skill GitHub

Agent Guards: Context-Budget Auditing and Unverified-Claim Flagging

Two skills for long-lived agents — context-budget audits per-turn token weight and fails CI when context bloats, and claim-audit flags factual claims the agent has not verified. Standalone tools, CI-ready, compatible with Claude Code, Codex, and OpenCode.

contexttokensciverification
by trac3r00 Aug 26, 2026 6/10
skill GitHub

ZeroSlop: Find and Strip AI Slop Without Changing the Facts

An open-source skill that detects filler patterns in writing and removes them while leaving the factual content intact, scoring the draft before and after so you can see what changed. Useful for anything an agent drafted that a human has to sign.

writingeditingai-slopskills
by manavmishra Aug 26, 2026 6/10
skill GitHub

sql-query-optimizer: Teach Agents to Read EXPLAIN Plans and Rewrite Queries

A skill covering query diagnosis and rewriting across PostgreSQL, MySQL, SQLite, and SQL Server, including EXPLAIN plan interpretation and index strategy. Gives the agent a method instead of leaving it to pattern-match on the query text.

sqlperformancedatabaseskills
by myclaude-sh Aug 26, 2026 6/10
skill GitHub

agent-rule-compliance-auditor: Diagnose Why Agents Ignore Your CLAUDE.md

A skill that audits CLAUDE.md, cursor rules, and project config files for the structural flaws that cause rule non-compliance — ambiguity, conflicts, and placement problems — rather than just restating the rules louder. Answers the recurring "it keeps ignoring my instructions" complaint.

claude-mdrulesauditcompliance
by myclaude-sh Aug 26, 2026 7/10
skill GitHub

trend-opportunity-radar: Evidence-Backed Social Trend Research as a Skill

An open-source agent skill for social listening, competitor-user research, content opportunity spotting, and product-demand validation, with the emphasis on citing evidence rather than asserting trends.

researchsocial-listeningmarketskills
by datou202307-design Aug 26, 2026 5/10
skill GitHub

claude-skill-humanizer: Strip AI Writing Tells With a Self-Check Loop

Sixteen named pattern categories, a 70-term banned vocabulary list, and a built-in self-check pass that re-reads its own output. Italian and English. More prescriptive than most humanizer skills because the patterns are enumerated rather than described.

writingeditingitalianskills
by giudegio-ai Aug 26, 2026 6/10
skill GitHub

slip-skill: Send a Note From Your AI to Someone's Phone

A skill for pushing a short message from an agent to a phone, with no account required. Simple enough to wire into a long-running session as a completion ping.

notificationsmobileskills
by sudo5zzb Aug 26, 2026 5/10
skill GitHub

icp-jtbd-skills: Website to ICP to JTBD Matrix to Value Prop Canvas

Three chained agent skills producing markdown and xlsx outputs, with a proof audit that blocks unverified claims from reaching the positioning. The audit gate is what separates this from a prompt chain.

marketingpositioningchained-skillsaudit
by aj-suresh Aug 26, 2026 5/10
skill GitHub

postking-skills: Teach an Agent to Run Your Content Marketing

An open-source skill for PostKing covering post generation, multi-week content planning, blog articles, and landing pages. Installable in Hermes, Claude, and Codex.

content-marketingskillspublishing
by bitsandtea Aug 26, 2026 5/10
skill GitHub

wiki-knowledge-agent: Turn Pasted Text and Links Into a Verified Wiki

Takes chat-pasted content and builds a searchable knowledge base with ad detection, translation, and summarization, kept local-first and RAG-ready. Zero dependencies, works across Hermes, Claude, Codex, and Cursor.

knowledge-baseragtranslationskills
by atukunare Aug 26, 2026 5/10
skill GitHub

thinking-partner: Keep Real Alternatives Open on Ambiguous Questions

A skill for framing under-specified problems and holding several genuine options open, converging only when evidence or stated values justify a decision — instead of the model picking an answer on turn one.

reasoningdecision-makingskills
by m1nga Aug 26, 2026 5/10
skill GitHub

agent-ops-doctrine: An Operating Doctrine for Long-Lived Claude Code Projects

Covers delegation, self-auditing, loops, and incident journals, bundled with 22 reusable skills for audit, workflow, documentation, and state handoff. Russian-language. Written for projects that outlive any single session.

operationsdelegationskillsrussian
by VibeEngineering-LLC Aug 26, 2026 5/10
skill GitHub

vraj-ai/skills: A Four-Stage Pipeline Where No Agent Reviews Its Own Work

Runs software work as a factory rather than a conversation, with separation of duties across four stages, plus vskills, a zero-dependency installer. Done is a locked command that exits 0 — the claim is checkable, not asserted.

pipelinereviewseparation-of-dutiesskills
by vraj-ai Aug 26, 2026 6/10
skill GitHub

agent-skill-creator: Build Tested Skills and Govern Their Whole Lifecycle

Covers evidence-backed skill creation plus discovery, updates, rollback, and quarantine through a user-defined marketplace, with distribution to 17 platforms. Quarantine and rollback are what most skill tooling lacks.

skillslifecyclemarketplacegovernance
by FrancyJGLisboa Aug 26, 2026 6/10
skill GitHub

landing-moment: Build Landing Pages That Do Not Read as Templates

A Claude Code plugin that derives one authored moment from the page's own argument, enforces a mechanical craft floor, and runs a cliche detector over the copy. Targets the sameness of AI-generated marketing pages.

landing-pagesdesigncopywritingplugin
by MartinOlivero Aug 26, 2026 5/10
skill GitHub

panel: Fan One High-Stakes Question Out to Five Non-Claude Models

A Claude Code skill that sends a single hard question to five models outside the Claude family in parallel, then reconciles their answers. Diversity across model families is the point — five Claudes would share the same blind spots.

multi-modelconsensusskillsreview
by heiyuneo Aug 26, 2026 6/10
skill GitHub

planning-router: routes a request to the smallest decision-changing method

A Codex and Claude Code skill that reads your problem statement and picks which of 17 analysis methods actually applies, instead of running a fixed heavyweight planning template every time. Each method is evidence-gated with explicit stop conditions so the agent stops as soon as more analysis would not change the decision. Zero dependencies.

skillplanningdecision-makingcodex
by nnfct Aug 26, 2026 7/10
skill GitHub

context-forge (lparfieniuk): deterministic context engineering plugin

A Claude Code and Cursor plugin that replaces ad-hoc grep-and-read exploration with a fixed structure: 18 rules, 20 skills, and 11 enforcement hooks. The pitch is structure over search — spend tokens on a known layout rather than brute-forcing the codebase each session. Aimed at teams that keep re-paying the same discovery cost.

plugincontext-engineeringhookscursor
by lparfieniuk Aug 26, 2026 6/10
skill GitHub

ai-iconflow: platform-ready icon families from one semantic SVG master

A skill that takes a single semantic SVG master and generates a reviewed icon family for every target — favicon, PWA, Tauri, Electron, and system tray. Its design rule is that distinctiveness comes from specificity, and it verifies each output stays legible at 16px. Removes a fiddly manual export step from app projects.

skilldesigniconssvgtaurielectron
by snowyukitty Aug 26, 2026 6/10
skill GitHub

qstack: a personal stack of agent skills for planning, execution, and lessons

One developer's curated skill set covering reviewable planning, disciplined execution, and capturing durable engineering lessons back into the repo. The lessons layer is the interesting part — it treats what went wrong as a persistent artifact rather than something lost at session end. Worth reading as a template for your own stack.

skillsplanningexecutionlessons-learned
by hani-q Aug 26, 2026 5/10
skill GitHub

sci-paper: scientific paper writing, source-traced review, and de-AI rewriting

A Claude Code plugin with 8 skills and 24 tools for academic manuscript work, calibrated against ApJ, MNRAS, PRD, and JCAP-class corpora. Enforces non-waivable integrity blockers, a zero-target lexicon for AI tells, and explicit measurement states so a missing calibration never silently reads as a clean result. Serious tooling for physics and astronomy writing.

pluginacademicwritingresearchintegrity
by skymanbp Aug 26, 2026 7/10
skill GitHub

claude-skills-for-sales: account research and sales execution skills

A skill set for enterprise sales workflows — account research, prospect qualification, and execution steps — derived from real GTM practice rather than generic prompts. Example of Claude Code skills applied outside software engineering. Useful template if you're packaging domain expertise as skills.

skillssalesresearchgtm
by hannahstone15 Aug 26, 2026 6/10
skill GitHub

tree-ring-memory-skill: recall, capture, audit, consolidation, and forgetting

A root-level Claude Code skill implementing a full local-first memory lifecycle, including the part most memory systems skip: forgetting. Adds audit and consolidation workflows so accumulated memories get reviewed and merged rather than growing without bound. Pairs naturally with staleness-focused memory tools.

skillmemorylocal-firstconsolidation
by TerminallyLazy Aug 26, 2026 6/10
skill GitHub

rabbit-writes: skills to make AI writing sound less like AI

A set of skills targeting the tells that mark generated prose — predictable structure, hedge stacking, and the usual vocabulary giveaways. Applies as a rewriting pass over drafts rather than a prompt prefix. Handy for docs, READMEs, and anything customer-facing that a model drafted.

skillwritingeditingprose
by whit3rabbit Aug 26, 2026 6/10
skill GitHub

cognitive-audit-skills: evidence-backed audit of how you actually use AI agents

Points an agent at your full Claude, Codex, and Cursor history and produces an audit of your real working patterns — counts, dates, and counterexamples rather than impressions. Deliberately built to surface evidence that contradicts your self-narrative. A more rigorous cousin of the built-in insights command.

skillsauditanalyticshistoryself-review
by YannisKiefer Aug 26, 2026 7/10
skill Reddit

claude-translator: open-source Claude Code skill for website localization

Takes an existing static site and generates localized versions while preserving SEO and site structure — handling translation extraction, batching, localized pages, hreflang, canonicals, sitemaps, RTL languages, and a verification pass. Open source and requires no ConveyThis account despite being built by them. Covers the tedious SEO plumbing most ad-hoc translation attempts get wrong.

skilllocalizationi18nseostatic-site
by alexburan Aug 26, 2026 7/10
skill GitHub

native-design-md: reverse-engineer a DESIGN.md from SwiftUI and Compose source

Reads native iOS (SwiftUI) and Android (Jetpack Compose) source and extracts the implicit design system into a DESIGN.md — colors, spacing, type scale, component patterns. No build, no simulator, no dependencies; it works purely from source. Gives an agent a stable design contract to code against on mobile projects.

skilldesign-systemswiftuijetpack-composemobile
by seunghan91 Aug 26, 2026 6/10
skill GitHub

wagner-skills + doc-this: engineering skills and a legacy-codebase spec pipeline

A Claude Code plugin marketplace pairing 8 general engineering skills with doc-this, a 14-skill pipeline that walks a legacy codebase and produces traceable, ATDD-ready specifications. The reverse-engineering pipeline is the standout — it targets the case where the code is the only surviving documentation. Installable as a marketplace.

marketplaceskillslegacy-codespecsatdd
by wagneripjr Aug 26, 2026 6/10
skill GitHub

jl-stack: Claude Code plugin marketplace for Go/MySQL/AWS and React/Next.js

A Spanish-language plugin marketplace with two stack-specific bundles: backend@jl-stack covering Go, MySQL, Docker, and AWS, and frontend@jl-stack covering React/Next.js, shadcn, performance, and OWASP. Stack-scoped skills rather than a generic collection. Useful if your stack matches.

marketplacepluginsgonextjsowaspspanish
by JoseLuis21 Aug 26, 2026 5/10
skill GitHub

NASA-Punk UI skill: golden-age aerospace design for AI coding agents

A UI design skill enforcing a NASApunk aesthetic — golden-age NASA palette, report-figure style charts — with a zero-overlap auditor that catches layout collisions before you see them. Portable across 9 agent stacks rather than Claude Code only. Documented in both Chinese and English.

skillui-designaestheticchartsaudit
by duanth Aug 26, 2026 6/10
skill Reddit

Global directives: what CLAUDE.md rules people found genuinely worth keeping

A discussion thread collecting the global and project-level directives practitioners consider mandatory, plus how they structure them — verbose versus short, greppable versus prose. The shared examples include a notable rule that auto-memory is evidence and provenance, not higher authority than the current source. Good source material for auditing your own CLAUDE.md.

claude-mddirectivesconfigurationmemorydiscussion
by allemaar Aug 26, 2026 6/10
skill GitHub

claudesec: security-as-a-service toolkit for Claude Code development

A toolkit bringing security review into the AI-assisted development loop rather than bolting it on at the end. Covers secure-development practices as agent-executable checks. Fits alongside runtime guardrail tools, which address a different layer.

securitytoolkitsecure-developmentreview
by Twodragon0 Aug 26, 2026 6/10
skill Reddit

40 defensive security-audit skills distilled from a session with Ox Alpha

A skill pack covering defensive security auditing, written by distilling an extended session with a less refusal-prone model into reusable skills. Originates from a real frustration: sandboxing and isolation work kept triggering refusals. The author is upfront about not being a security expert, so treat these as a starting point to review rather than authoritative.

skillssecurityauditdefensivesandboxing
by Sakhund Aug 26, 2026 7/10
skill GitHub

ARIS-Anything: five-step research loop generalized beyond academia

Takes the ARIS loop — plan, draft, adversarial review, iterate, persist — and applies it outside academic research to investment due diligence, legal work, market analysis, self-directed learning, journalism, and engineering post-mortems. The adversarial review step is what distinguishes it from generic research prompting. Bilingual documentation.

skillresearchadversarial-reviewdue-diligenceworkflow
by wanshuiyin Aug 26, 2026 6/10
skill GitHub

Anti-Autoresearch: reviewer-side integrity forensics for AI-generated papers

Checks an autoresearch paper for self-consistency and fabrication across 61 signals — 46 verdict-bearing integrity hack-patterns in families A through H, 13 zero-weight AI writing-style impressions, and 2 advisory — producing a deterministic verdict. Explicitly not an opaque AI-text classifier: every signal is inspectable. Designed as the dual of ARIS, for the reviewer's side of the table.

skillresearch-integrityreviewforensicsacademic
by wanshuiyin Aug 26, 2026 6/10
skill GitHub

solnest-seo-aeo: audit whether AI answer engines can find and cite your site

Audits a site for classic search SEO, then separately checks answer-engine optimization — whether ChatGPT, Claude, Perplexity, Gemini, and Google AI Overviews can actually crawl, parse, and cite the content. The AEO half is the newer and less covered problem. An MIT-licensed fork of claude-seo.

skillseoaeoauditanswer-engines
by Solnest-AI Aug 26, 2026 6/10
skill GitHub

scrollcraft: scroll-driven site builder with a fingerprint gate against sameness

Builds premium scroll-driven websites against a real design standard: eight mutually exclusive page grammars, a required signature move per build, a headless-browser verification pass, and a fingerprint gate that prevents two of your sites from sharing a skeleton. The anti-sameness gate is the notable mechanism — most generation skills happily produce the same layout forever.

skillweb-designscrollverificationplugin
by samdoom-coder Aug 26, 2026 6/10
skill GitHub

Banco de SKILLS Empresas 5.0: 20 Spanish-Language Claude Skills for LatAm Business

A bank of 20 Claude skills written in Spanish and organized across six business areas, built for the regulatory and cultural context of Latin America. It is part of the XPROF Empresas 5.0 program. One of the few substantial non-English business skill collections in the ecosystem.

skillsspanishbusinesslatam
by Comunidad-XPROF Aug 25, 2026 6/10
skill GitHub

stackwise-skills: End-to-End Development Skills With Verification Built In

A skill collection covering frontend, backend, mobile, infrastructure, and QA with framework-specific guidance for each. Every workflow includes a verification step rather than ending at "written." The verification emphasis is what distinguishes it from the many generic skill packs.

skillsverificationfullstackqa
by Aarvion-AI Aug 25, 2026 6/10
skill GitHub

sol-simplify: One File That Stops Agents Building Bureaucracy Around Their Work

A single Markdown file that instructs coding agents to skip the self-imposed ceremony — status files, plan documents, progress trackers — and just do the work. The author benchmarked it on gpt-5.6-sol and reports zero ceremony across twelve trials in five scenarios. Small, testable, and easy to drop into any project.

promptsimplicitybenchmarkinstructions
by MongLong0214 Aug 25, 2026 6/10
skill GitHub

CRE-AI-Skills: 14 Skills for Commercial Real Estate Due Diligence

Fourteen skills covering commercial real estate work: due diligence, underwriting, lease and loan review, title and survey analysis, and market research. They need no API keys and run against Claude, ChatGPT, or any LLM. A concrete example of domain-expert skills rather than developer tooling.

skillsreal-estatefinancedue-diligence
by cre-ai-skills Aug 25, 2026 6/10
skill GitHub

mindmap-skill: Turn Documents and Ideas Into a Connected Knowledge Atlas

A Claude skill that converts documents, articles, and brainstorms into interactive mind maps and then links them into a personal knowledge atlas. It goes past layout with contradiction detection, gap analysis, and source attribution, plus seven export formats and adaptive layouts. Notably more ambitious than typical diagram-generation skills.

skillmindmapknowledgevisualization
by 0x-man Aug 25, 2026 7/10
skill GitHub

claude-code-vision-skill: Add Visual Analysis to Text-Only Model Backends

Gives Claude Code multimodal vision capability when running on a text-only LLM backend, for screenshot, UI, and chart analysis. Paired with a browser harness it can perform automated frontend layout checks. Aimed at users running Claude Code against alternative models that lack native image input.

skillvisionscreenshotsui-testing
by xiincs Aug 25, 2026 6/10
skill GitHub

seo-checklist: A Deterministic 217-Check SEO Audit for Claude Code

An SEO audit skill built around a fixed registry of 217 checks, where every item gets an explicit status and coverage is reported separately from the score. The separation is the point: a thin audit that only ran 30 checks cannot masquerade as a passing site. A good template for making any agent audit honest about what it actually inspected.

skillseoauditdeterministic
by thegreatsao Aug 25, 2026 7/10
skill GitHub

parcoach: Open Educational Resources and PBL Lesson-Plan Skills

A Chinese-language project-based-learning resource set for teachers and parents, bundled with one-click-installable AI skills that generate PBL lesson plans. Combines curated open educational material with the tooling to produce new plans from it. A domain example of skills built for educators rather than developers.

skillseducationchineselesson-plans
by excellence-wh Aug 25, 2026 5/10
skill GitHub

uplevel: Find the Engineering Controls Your Repo Is Missing

A Claude Code skill that audits a repository for absent safeguards — CI that never triggers on pull requests, a check target that silently rewrites files, a migration with no gate in front of it — and returns a numbered plan. It changes nothing until you choose an item. The "diagnose, then wait" contract is what makes it safe to run on a real repo.

skillciauditengineering-practices
by rlx Aug 25, 2026 7/10
skill GitHub

thorough-check-skills: Evidence-Based Verification of a Code Change

A Claude Code skill that exhaustively verifies a code or config change: every change site, boundary conditions, file integrity, and the upstream and downstream call chain. It refuses to report "all OK" without command output backing the claim. Directly targets the failure mode where an agent declares success it never checked.

skillverificationreviewevidence
by zhujian0409 Aug 25, 2026 7/10
skill Reddit

Skills That Adapt the Response to How Depleted You Are

A small skill set that changes the shape of an assistant's answer based on your current state — so saying you are overloaded does not get you a twelve-step productivity plan, and saying you are foggy does not get you five things to remember. Includes modes such as overloaded-mode for shrinking the response instead of expanding it. An unusual and practical take on skills as tone and format control.

skillsuxpromptingaccessibility
by Sad_Construction2179 Aug 25, 2026 6/10
skill GitHub

ip-skills-cn: Seven Chinese-Context Image and IP Generation Skills

Seven agent skills tuned for Chinese cultural contexts: guofeng IP characters, WeChat sticker packs, app icons, Xiaohongshu covers, WeChat article headers, blind-box figurines, and the twenty-four solar terms. Derived from and crediting s1dashu's ip-as-logo-skill. A good illustration of skills adapted to a specific market's visual conventions.

skillsdesignchineseimage-generation
by Dwade8128 Aug 25, 2026 5/10
skill GitHub

advanced-skill-finder: Search the Skill Ecosystem and Install On Demand

An agent skill that searches the open skill ecosystem for what you need, then asks whether to install it permanently or load it just for this session. The load-once option keeps your permanent skill set from bloating with one-time needs. A sensible answer to skill discovery now that the ecosystem is large.

skilldiscoveryinstallationmeta
by ipavelm Aug 25, 2026 7/10
skill GitHub

design-token-builder: Generate W3C DTCG Tokens and a Matching Figma Library

A Claude skill that produces design tokens in the W3C DTCG format, renders an HTML preview, and builds the corresponding Figma Variables library. It closes the loop between a token definition and something designers can actually use. Standards-compliant output rather than an ad-hoc token format.

skilldesign-tokensfigmadtcg
by Blingkusano Aug 25, 2026 6/10
skill GitHub

claude-trading-skill: Technical Analysis for Forex and Crypto via MCP

A Claude skill that performs automated technical analysis on Forex and crypto markets by pulling data through the Simsar and CCXT MCP servers. Explicitly a work in progress and open to contributions. Interesting as an example of a skill built on top of live-data MCP servers rather than static knowledge.

skilltradingmcpccxt
by avatGit Aug 25, 2026 5/10
skill GitHub

study-method: Learn Programming and Math by Building, With Cross-Session Memory

A Portuguese-language agent skill for studying programming and mathematics through coding: it keeps memory between sessions, issues TDD challenges validated by mutation testing, and maintains a master document that teaches an LLM to reconstruct the whole system. Mutation testing as the validity check for practice exercises is a nice touch. Aimed at deliberate practice rather than passive tutoring.

skilleducationtddmemoryportuguese
by frederico-kluser Aug 25, 2026 5/10
skill GitHub

yandex-direct-agent: Claude Code Skills for Yandex Direct Campaigns

Russian-language Claude Code skills for setting up and analyzing Yandex Direct advertising campaigns. Covers campaign configuration and analytics workflows. A useful pattern for anyone building skills around a regional ad platform's API.

skillsadvertisingyandexrussian
by visualklik Aug 25, 2026 5/10
skill GitHub

waa-independent-evaluation: Evidence-Based Independent Evaluation Across Harnesses

A cross-platform agent skill that runs an independent, evidence-backed evaluation of work, portable across Codex, Claude Code, and Agy CLI. The independence framing matters — it is designed to assess work it did not produce. Part of the growing pattern of using a separate agent pass as a check on the first one.

skillevaluationreviewcross-agent
by clearlove7818 Aug 25, 2026 6/10
skill GitHub

awesome-claude-codex-skills: A Browsable, Daily-Updated Skills Directory

A live directory of Claude and Codex agent skills organized by category, refreshed daily, with the ability to combine skills into bundles. It is browsable rather than a static README list. Useful as a discovery surface now that skill repos number in the thousands.

skillsdirectorydiscoverycuration
by skymined Aug 25, 2026 7/10
skill GitHub

patterns: Path-Scoped Knowledge Packages for AI Coding Agents

Curated bundles of memories, rules, and skills that are scoped to specific paths in your repository, so an agent working in one directory gets the knowledge relevant to it. Works with Claude Code, Cursor, Codex, Copilot, Windsurf, and any MCP client. First-party and free.

knowledgerulesskillspath-scopedmcp
by pathrule Aug 25, 2026 6/10
skill Reddit

Decision Kit: Claude Code Skills for Thinking Through Half-Baked Ideas

A designer-built skill collection that takes a fuzzy idea and surfaces the actual decisions, tradeoffs, and options before any execution starts — usually rendering them visually so they are quick to digest. It is aimed at the pre-implementation phase where most agent workflows jump straight to code. A useful counterweight to plan-and-build defaults.

skillsdesignplanningdecisions
by jontomato Aug 25, 2026 6/10
skill GitHub

caveman-dvizh-skills: 17 Agent Skills for Engineering Discipline and Research

Seventeen skills written to the open SKILL.md Agent Skills standard, covering engineering discipline, research, safely killing processes, and thinking with the ability to back out of a decision. Russian-language, installable into Claude Code, OpenCode, Codex, Gemini, or any harness. The safe-process-kill and rollback-thinking skills address real agent failure modes.

skillsrussiandisciplineresearch
by aidvizhhub Aug 25, 2026 5/10
skill GitHub

v12x-skills: Security-Audit Skills That Refute Every Finding Before Reporting

In-depth security-audit skills for Claude Code built on the v12x method: run deterministic tools first, then actively try to refute every finding, and return a verdict rather than a score. The refutation step is aimed squarely at the false-positive flood that makes most agent security audits unusable. A strong pattern to borrow for any audit skill.

skillsecurityauditverification
by V12X Aug 25, 2026 7/10
skill GitHub

sync-before-work: Safely Sync Git Branches Before the Agent Starts

A cross-agent skill that brings your git branches up to date before any AI coding work begins, so the agent is not building on a stale base. Emphasis on doing it safely rather than blindly pulling. Small but prevents a genuinely common and annoying class of merge pain.

skillgitsynccross-agent
by vaibhavarora14 Aug 25, 2026 6/10
skill GitHub

10x-interface: Eleven Skills for Agents That Design and Ship Interfaces

Eleven Claude Code skills spanning intent, architecture, craft, interaction, adaptation, state, experimentation, forensics, critique, review, and shipping — the full arc of building an interface. It treats critique and forensics as first-class steps rather than afterthoughts. One of the more thoroughly decomposed UI skill sets available.

skillsuidesignfrontendreview
by Dragoon0x Aug 25, 2026 6/10
skill GitHub

code-design-skills: Clean Code, Idiomatic Go, and Gang of Four Patterns

Claude Code skills encoding Clean Code practice for Python, TypeScript, and Java, idiomatic Go conventions, and the Gang of Four design patterns. Gives the agent an explicit standard to write against instead of inferring one from the codebase. Handy for teams that already hold these as house style.

skillsclean-codedesign-patternsgotypescript
by CasLubbers Aug 25, 2026 6/10
skill GitHub

construction-drawing-analyzer: Automate Sheet Splitting and Takeoff Prep

A Claude skill backed by Python scripts that analyzes construction drawings — splitting sheets, extracting polygons, and classifying drawing types — for general contractors, estimators, and project managers. The scripts do the deterministic geometry while the skill handles interpretation. A solid template for skills over technical document formats.

skillconstructionpdfpython
by hamzaabduljabbar Aug 25, 2026 6/10
skill GitHub

saas-spec-generator: Turn a Product Idea Into an Executable SaaS Spec

Converts a rough product idea into a specification detailed enough for a coding agent to execute directly. Works with Claude Code, Codex, OpenCode, Cursor, Gemini CLI, and any Agent Skills client. Targets the gap where "build me a SaaS" is too vague to act on.

skillspecplanningsaas
by Megaleios Aug 25, 2026 6/10
skill GitHub

springboot-skills-marketplace: Spring Boot Skills for Claude Code and Codex

A marketplace of Spring Boot skills usable from both Claude Code and Codex. Gives the agent framework-specific conventions instead of generic Java advice. Useful for JVM teams where Spring idiom matters as much as correctness.

skillsspring-bootjavamarketplace
by a-pavithraa Aug 25, 2026 6/10
skill GitHub

fabling: Skills That Make Opus 5 Behave Like Fable 5

A set of Claude skills intended to shift Opus 5's working style toward Fable 5's. Aimed at people who prefer one model's behavior but want or need to run the other. An unusual use of skills as behavioral tuning rather than added capability.

skillsopusfablebehavior
by gncdev Aug 25, 2026 6/10
skill GitHub

copydesk: A Cross-Harness Prose Gate for AI Agents

A quality gate for the prose agents produce — READMEs, docs, commit messages, release notes — that works across harnesses rather than being tied to one. Applies editorial standards where most tooling only gates code. Useful if agent-written text ships to users.

writingquality-gatecross-agentdocs
by carlosboeing Aug 25, 2026 5/10
skill GitHub

youtube-absorb: Give Claude a YouTube Link, Get Back a Verifiable Report

A Claude Code skill that watches a YouTube video on your behalf and returns a report with judgments you can check, installable with a single line. Korean and English documentation. Saves the time cost of videos that turn out not to be worth watching.

skillyoutubesummarizationkorean
by promotoa Aug 25, 2026 6/10
skill GitHub

lawyeah: Open Agent Skills for Chinese Mainland Legal Practice

A skill library for lawyers practicing in mainland China, covering case handling and contract work. Published as open Agent Skills so the legal reasoning is inspectable rather than hidden in a product. One of the more substantial jurisdiction-specific legal skill sets published so far.

skillslegalchinesecontracts
by Lawyeah-Tech Aug 25, 2026 6/10
skill GitHub

das-auto: Autonomous Handoff With a Blast-Radius Ledger

A Claude Code skill for the moment you step away from the machine: it takes over autonomously while maintaining a ledger of everything within its blast radius and adhering to a defined report contract. Also plays a Volkswagen jingle, which tells you the tone. The blast-radius ledger is the genuinely useful idea underneath the joke.

skillautonomyhandoffsafety
by sterlixlol Aug 25, 2026 6/10
skill GitHub

nix-skills: Agent Skills for the Nix Ecosystem

Skills covering NixOS and Nixpkgs so an agent can work with Nix expressions and system configuration correctly. Nix is exactly the kind of ecosystem where models guess badly without explicit guidance. Valuable for a community that is underserved by general-purpose coding assistance.

skillsnixnixosinfrastructure
by atvari-eu Aug 25, 2026 6/10
skill GitHub

playwright-suite-skills: 13 Skills and 4 Subagents for Playwright Test Suites

A pack covering the real lifecycle of a Playwright suite: scaffolding specs, hardening brittle locators, triaging a red suite, reviewing a test diff, and scoping the work before any of it begins. The scoping-first step is unusual and prevents the agent from rewriting the whole suite. One of the more complete testing skill sets available.

skillsplaywrighttestingsubagents
by AndreiBanu1 Aug 25, 2026 7/10
skill GitHub

ai-skills: A Brainstorm to Review Pipeline for Cursor and Claude Code

Reusable agent skills implementing a five-stage pipeline — brainstorm, interview, plan, execute, review — that works in both Cursor and Claude Code. The interview stage between brainstorming and planning is what keeps the plan grounded in your actual intent. A clean, portable structure for feature work.

skillsplanningreviewcursor
by ayberkcansever Aug 25, 2026 5/10
skill GitHub

chartroom: 27 Skills and a Dependency-Free SVG Chart Kit for Strict CSP

Live data artifacts, interactive apps, and advanced financial charts for Claude Code, built as 27 skills plus an SVG chart kit with no dependencies. It exists because in a strict-CSP environment no charting library can load at all. A well-constrained solution to a real enterprise limitation.

skillschartssvgcspartifacts
by Lukehle Aug 25, 2026 6/10
skill GitHub

security-agent-skills: Portable Security-Testing Methodology as Agent Skills

Encodes real security-testing methodology as tool-agnostic agent skills: white-box bug hunting, AI agent and LLM red-teaming, supply-chain risk assessment, and appsec depth. Works in Claude Code or any agent runtime. The LLM red-teaming coverage is notable — most security skill packs stop at conventional appsec.

skillssecurityred-teamingappsecsupply-chain
by UnboundCompute Aug 25, 2026 7/10
skill GitHub

ainalyst: A BABOK v3 Assistant for Business Analysis Work

An AI assistant that helps business analysts — or whoever on the project is filling that role — work to the BABOK v3 methodology. It encodes a recognized professional standard rather than generic requirements advice. A Russian-language version is maintained on a separate branch.

skillbusiness-analysisbabokrequirements
by chaussky Aug 25, 2026 5/10
skill Reddit

mvn-lite/npm-lite/go-lite: Build Wrappers That Cut Agent Test Output 99%

Deterministic wrappers around Maven, npm, and Go that collapse successful build/test output to a single line while keeping full logs in .agent-logs/ and returning bounded diagnostics on failure. Measured reductions run from 2KB down to 25 bytes on a Vitest run and 136KB down to 12 bytes on a Tape run. Ships with a lite-tools Agent Skill (SKILL.md) that teaches Claude Code when to prefer the quieter commands.

skillcontext-windowbuild-toolsmavennpmtesting
by fykup Aug 25, 2026 8/10
skill GitHub

catstack: One Install for Your Skills Across Claude, Cursor, and Codex

Keeps a personal skill library in one repository and installs it into Claude Code, Cursor, and Codex from that single source of truth. Removes the usual drift of maintaining near-identical skill files per tool. Worth a look if you switch between harnesses and keep re-copying the same instructions.

skillscross-toolcursorcodexdotfiles
by EdbertChan Aug 25, 2026 6/10
skill GitHub

html-email-editor-skill: Production HTML Email for the Benchmark Editor

A free Claude skill from Benchmark Email that generates HTML email markup targeted at their editor's constraints. Handles the usual cross-client table layout pain so you are not hand-writing email HTML. Vendor-specific, so its value depends on whether you use Benchmark Email.

skillemailhtmlmarketing
by Benchmark-Email Aug 25, 2026 5/10
skill GitHub

data-engineering-knowledge-capture: Second brain for data platforms

A knowledge-capture plugin that gives agents structured context about a data platform: standard schemas, lineage, streams and jobs, medallion layers, semantic layer and glossary. Extends the PKC and OKF frameworks and runs on Claude, Grok, Codex and OpenCode.

data-engineeringknowledge-baselineageplugin
by SpillwaveSolutions Aug 25, 2026 5/10
skill GitHub

anki-english-vocab: Turn English word lists into Anki decks with audio

An agent skill that batch-converts English word lists into .apkg Anki decks complete with IPA transcription, pronunciation audio and a styled card template. Supports idempotent incremental updates so you can keep adding to a large deck without rebuilding it.

ankivocabularylanguage-learningskill
by userAlex110 Aug 25, 2026 5/10
skill GitHub

modern-frontend-architecture: Agent-first house standard for web frontends

A Claude Code skill encoding one opinionated standard for modern web frontends — stack choice, data fetching, state, styling, security, logging, i18n and deploy. Written to be read by an agent rather than a human, so the agent picks consistent patterns instead of improvising per file.

frontendarchitecturestandardsskill
by Amir-Abushanab Aug 25, 2026 6/10
skill GitHub

agent-seo-skill: Audit and fix how AI crawlers and agents read your site

Audits how AI crawlers, answer engines and agents discover, read, cite and act on a website, then fixes what it finds in the codebase. Combines a live probe of the deployed site with source-level changes, scored across six pillars. Aimed at the shift from ranking for humans to being usable by agents.

seoaeocrawlersaudit
by codydeny Aug 25, 2026 6/10
skill GitHub

repo-scaffold-plugin: Scaffold repos to production GitHub standards

An Agent Skills plugin for Codex and Claude Code that scaffolds a new repository to the conventions of a well-maintained public GitHub project — licensing, CI, issue templates, contribution docs and the rest. Removes the tedious setup pass most new repos skip.

scaffoldinggithubpluginconventions
by MinhThang1009 Aug 25, 2026 5/10
skill GitHub

meta-graph-api-integration: Meta Ads and Instagram Graph API as skills

A packaged set of agent skills for integrating Meta's Graph API into a React and Supabase app: OAuth, ad sync, campaign creation, audiences, pixels and CAPI, Instagram publishing and DM automation. Domain-specific, but complete enough to skip a long integration slog.

metagraph-apiinstagramintegration
by bittencourtthulio Aug 25, 2026 5/10
skill GitHub

janefskills: Security skills suite with proof-before-done enforcement

Four security skills for Claude Code — auth hardening, vulnerability audit, threat modeling and secrets detection — built on a four-layer detection approach. The design point is proof-before-done: the skill has to demonstrate a finding rather than assert it, cutting the overclaiming common in AI security passes.

securityauditthreat-modelingsecrets
by AL-JANEF Aug 25, 2026 6/10
skill GitHub

app-store-aso: App Store ASO skill with autosuggest and metadata scripts

A field-tested App Store Optimization methodology packaged as a Claude Code skill, with free scripts for autosuggest scraping, App Store Connect analysis and metadata validation. Russian-language core but works in any locale.

asoapp-storemarketingskill
by Muxxik Aug 25, 2026 5/10
skill GitHub

axiomize: Turn an idea into a rigorous mathematical model

An agent skill that takes an informal idea and works it into a formal model: decomposition, parameter tables, modeling from multiple perspectives, and validation code to check the result. Useful when you want the assumptions made explicit rather than buried in a prompt.

modelingmathematicsanalysisskill
by Furox-Art Aug 25, 2026 6/10
skill GitHub

prawo-pl-eli: Polish and EU law from official ELI and CELLAR APIs

Agent skills for Claude Code and Codex that pull Polish and EU legal texts from official sources — the Sejm ELI API and CELLAR/EUR-Lex. Handles consolidated texts, single articles, amendments and CELEX identifiers, so citations come from the authoritative text rather than model recall.

legalpolandeu-lawapi
by jamarpl21 Aug 25, 2026 5/10
skill GitHub

agentic-skills-rules: Semgrep rules for SKILL.md vs OWASP Agentic Top 10

Semgrep and Opengrep rules that scan agent skill files (SKILL.md) against the OWASP Agentic Skills Top 10. Lets you run skill review in CI with an existing static-analysis tool instead of reading every third-party skill by hand.

securitysemgrepowaspskills
by computersarebad Aug 25, 2026 7/10
skill GitHub

arabic-font-merge: Merge font weights and fix Arabic italics

A Claude skill and CLI that merges multiple font weights into one installable file, repairs Arabic rendering in italic styles, and adds the Saudi Riyal, UAE Dirham and Omani Rial symbols. Narrow, but it solves a real typography problem that is tedious to do by hand.

fontsarabictypographycli
by Mulhamx4 Aug 25, 2026 5/10
skill GitHub

google-docs-style: Google developer documentation style as a plugin

Packages the Google developer documentation style guide as a cross-agent plugin — a skill, a formatter and hooks — for Claude Code, Codex, Cursor and Grok Build. Gives agent-written docs a consistent house style enforced at write time rather than in review.

documentationstyle-guideformatterhooks
by SpillwaveSolutions Aug 25, 2026 6/10
skill GitHub

cowork-plugin: Phone notifications and human-in-the-loop for Cowork

A Pushary skill plus setup guide and plugin manifest that sends phone notifications from Claude Cowork and lets you approve or redirect work from your phone. Closes the gap where a long-running session stalls waiting for a human who is away from the desk.

coworknotificationshuman-in-the-loopmobile
by Pushary Aug 25, 2026 5/10
skill Reddit

Poka-Yoke: Skills that make agent mistakes structurally impossible

A set of Claude Code skills built on the observation that CLAUDE.md rules get followed about 80% of the time and firmer wording does not fix the rest. Named after Shigeo Shingo's mistake-proofing method, it restructures tasks so the failure cannot occur rather than instructing the agent to avoid it.

poka-yokereliabilityclaude-mdskills
by rainmanjam Aug 25, 2026 7/10
skill GitHub

balakit: Cross-agent rules and skills in one npx install

An opinionated set of rules and skills installed with a single npx command into Cursor, Claude Code, Codex, OpenCode and Copilot. Useful if you switch harnesses and want the same baseline behavior in each rather than maintaining five config trees.

cross-agentrulesskillsnpx
by balacodeio Aug 25, 2026 5/10
skill GitHub

execution-drift-skills: Reconcile reported status against Jira and GitHub

Agent skills that check claimed project status against the actual evidence in Jira, GitHub, Slack and the PRD, surfacing where reported progress and real progress have diverged. A useful pattern given how readily both people and agents report work as done.

project-managementjiragithubverification
by Pulseboard-ai Aug 25, 2026 6/10
skill GitHub

claude-code-tune-kit: Context meter, destructive-command hooks, doctor

A Spanish-language tuning kit for out-of-the-box Claude Code: a context traffic light, a concise output mode, four hooks that block destructive commands and secret leaks, and cc-doctor.sh, which audits your installation and reports what is missing.

configurationhooksauditspanish
by Carlos-Dominguez-faber Aug 25, 2026 6/10
skill GitHub

Claudecode-deepseek-OCR: Tesseract OCR skill for setups without vision

A Claude Code skill that OCRs images and PDFs through Tesseract, defaulting to German, English and Simplified Chinese with extensible language packs. Written specifically to give vision capability back to Claude Code when it is running on a DeepSeek backend that lacks it.

ocrtesseractdeepseekpdf
by syLionchen Aug 25, 2026 5/10
skill GitHub

liteagents: Subagent, skill and command kit for four harnesses

A kit of subagents, skills and commands packaged for Claude Code, OpenCode, Ampcode and Droid. Broad rather than deep, useful as a starting library if you are setting up a new harness from scratch.

subagentsskillscommandscross-agent
by hamr0 Aug 25, 2026 5/10
skill GitHub

unique-skill: Generate product visuals on the stack the job calls for

A Claude Code plugin that generates visuals matched to the product they belong to and builds them on whatever stack that particular job actually needs, rather than defaulting to one output format for every request.

visualsdesignplugingeneration
by matheusPavaneli Aug 25, 2026 5/10
skill GitHub

Coding-Agent-Rules-for-Data-Science: Reproducible R and Python rules

Point an AI coding agent at this NCEAS repo and it installs a personalized ruleset for reproducible, analysis-first data science in R and Python, oriented toward environmental, ecological and geospatial work. Institutional rather than hobby-grade, which shows in the reproducibility focus.

data-sciencereproducibilityrpython
by NCEAS-AI Aug 25, 2026 7/10
skill GitHub

doc-wiki: Verifiable offline technical docs generated from real source

A Claude Code skill that generates module, system and guide documentation from actual source code, with the output verifiable against that source and usable offline. Targets the failure mode where generated docs describe an architecture the code does not have.

documentationwikiverificationoffline
by GeziP Aug 25, 2026 6/10
skill GitHub

agent-skills: Open skills for the skills.sh ecosystem

A broad open collection of agent skills covering browser automation, docs, mail, media, security, networking and orchestration, published for the skills.sh ecosystem. Useful as a browsing ground when you want to see what a category of skill typically does.

skillscollectionopen-sourceskills-sh
by DrOlu Aug 25, 2026 5/10
skill GitHub

claude-institution: Indexed CLAUDE.md Plus On-Demand Rules for Weaker Models

Distills a strong model's behaviour into an indexed CLAUDE.md with rules and skills loaded on demand, forming an executable specification. The target is sessions running on weaker or cheaper models that need the guidance made explicit.

claude-mdrulesskillscontext
by curtischoutw Aug 24, 2026 6/10
skill GitHub

education-video-skills: Skills for Narrated Training Videos and PDFs

A Japanese-language Claude Skill set for designing and producing training material end to end: narrated educational videos, distributable PDF handouts, and the overall program structure. Aimed at people building corporate training content with an agent.

videoeducationtrainingjapanese
by daito-dot Aug 24, 2026 5/10
skill GitHub

geo-skills: 29 Agent Skills for AI-Search Visibility Audits

A free collection of 29 GEO/AI-search Agent Skills plus an installable CLI, covering site audits, citability checks, AI crawler behaviour, prompt packs, and owner maps. Works with Claude Code and Codex, MIT licensed.

seogeoskillsaudit
by TheSmokeDev Aug 24, 2026 6/10
skill GitHub

ux-ui-agent-skills: Design Architect Skills With DTCG Tokens and WCAG 2.2 Checks

A skill pack that turns Claude into a senior design reviewer: DTCG design tokens, 42 components, WCAG 2.2 accessibility checks, framework-agnostic code output, and references for 138 design systems. Skills are runnable, not just prose guidance.

designuxaccessibilitydesign-tokens
by plugin87 Aug 24, 2026 7/10
skill GitHub

chanlun-engine-skill: Deterministic Chan Theory Engine, LLM Interprets

Splits a technical-analysis workflow cleanly: deterministic scripts compute Chan Theory structures (fractals, strokes, segments, pivots, divergences, buy/sell points) while the LLM only interprets the output. Runs as an Agent Skill across Claude Code and MCP-capable clients; explicitly not stock advice.

tradinganalysisdeterministicchinese
by adsorgcn Aug 24, 2026 5/10
skill GitHub

engineer-flow: Engineering Skill With Memory and Specialist Delegation

An engineering skill bundling persistent memory, MCP and tool orchestration, dynamic skill discovery, context-aware routing to specialists, automated validation, and security verification steps. Aims to be the single entry point for a multi-stage engineering task.

memoryorchestrationmcpvalidation
by soden46 Aug 24, 2026 5/10
skill GitHub

mckinsey-people-brain: MBB-Style HR Consultant Persona Skill

A Claude Skill encoding a strategy-consulting HR advisor persona with roughly a decade of practice behind it, focused on talent, organisation design, and AI-driven transformation. Chinese-language.

personahrconsultingchinese
by TongyiDai Aug 24, 2026 5/10
skill GitHub

stock-analysis: Investment Research Skill With Source Rules Enforced in Code

A personal investment research system combining a Claude Code skill with a data pipeline, where sourcing rules and a ban on trade signals are enforced by code rather than prompt text. Pulls from SEC EDGAR, FRED, ECB, and Toss Securities. Korean-language.

financeresearchkoreanpipeline
by MinSeok1o28 Aug 24, 2026 5/10
skill GitHub

maxhub-api-skills: Agent Skills for Pulling Data From 21 Social Platforms

Skills that let an AI assistant fetch data from 21 major platforms including Douyin, TikTok, Bilibili, and Xiaohongshu through one consistent interface. Documentation is multilingual across Chinese, English, Japanese, and Korean.

socialdataapimultilingual
by XieWxx Aug 24, 2026 6/10
skill Reddit

verify-polish-company: Skill for Polish Company Checks via Free Gov API

Packages routine Polish company due diligence as a skill: look up a company by NIP, KRS, or REGON, check VAT status and registered bank accounts against the Ministry of Finance White List, and validate EU VAT numbers via VIES. Runs on a free public REST API with no key or signup.

compliancepolandvatapi
by bambi696 Aug 24, 2026 6/10
skill GitHub

analyzing-by-region: A Skill With Measured Coverage Gains, Failures Included

Analysing a subject region by region instead of as a whole raised measured coverage from 0.46 to 0.69 across code, plans, and physical designs. The repo publishes the full evidence behind the number, including the cases where the approach did not help.

analysisevalscoverageevidence
by stilletto Aug 24, 2026 7/10
skill GitHub

seedance-prompt-forge: Prompt Optimizer and Agent Skill for Seedance 2.5

Writes, audits, and repairs Seedance 2.5 prompts across text-to-video, reference-video, editing, extension, and multimodal modes for Dreamina. Packaged as an Agent Skill so the optimization runs inside your normal session.

videopromptsseedanceskills
by silentbuilds Aug 24, 2026 5/10
skill GitHub

scoville-scribe: Better Writing Without Quietly Changing the Facts

An anti-slop writing skill built around the constraint that improving prose must not alter the underlying claims. Targets the common failure where an editing pass smooths text and silently rewrites meaning.

writingeditinganti-slop
by benjaminstelzer Aug 24, 2026 5/10
skill GitHub

pharma-brand-manager-skills: Rx and OTC Brand Skills for RU/UA Markets

Claude Code skills covering pharmaceutical brand management with separate Rx and CHC/OTC personas for the Russian and Ukrainian markets. Includes task checklists, document templates, and notes on local advertising-law compliance.

pharmamarketingcomplianceskills
by mznaevskaya-dotcom Aug 24, 2026 5/10
skill GitHub

software-video-skill: Software Videos as Code, Rendered to MP4 With ffmpeg

Builds demos, launch videos, tutorials, and release notes from an HTML deck, AI voiceover, and real screen recordings, rendering the result to MP4 with ffmpeg. The video is defined as code, so it can be regenerated when the product changes.

videoffmpegdemosskills
by kritikmodi Aug 24, 2026 6/10
skill GitHub

flutter-skills: Focused Agent Skills for Flutter and Dart App Delivery

A set of narrowly scoped Agent Skills covering Flutter and Dart app delivery end to end, rather than one large catch-all instruction file. Aimed at keeping each skill small enough to load only when relevant.

flutterdartmobileskills
by thiennc-tesoglobal Aug 24, 2026 6/10
skill GitHub

investor-harness: Cross-Harness Skill Suite for Public-Market Research

Thirteen skills for secondary-market investment research, with adapters for Claude Code, Codex, and OpenCode plus scaffolding for an analyst workspace. Published as an open prompt stack rather than a product.

financeresearchskillscross-tool
by joansongjr Aug 24, 2026 5/10
skill GitHub

personal-assistant-memory-routing: Privacy-First Memory Routing Skill

An Agent Skill that routes personal-assistant memory across multiple providers while keeping private data local. It decides which store handles each fact instead of pushing everything to one vendor. Works with both Claude Code and Codex.

memoryskillprivacycodex
by Euraika-Labs Aug 24, 2026 6/10
skill GitHub

sub-agents-skills: Route Sub-Agent Tasks to Codex, Grok, Gemini, or Kimi

Packages cross-LLM sub-agent orchestration as an Agent Skill, so any compatible tool can hand a task off to another model's CLI. Supported targets include Codex, Claude Code, Grok, GLM, Kimi, Cursor, Gemini, and OpenCode. Useful when you want a second model's take without leaving your current session.

sub-agentsorchestrationskillmulti-model
by shinpr Aug 24, 2026 7/10
skill GitHub

pain-point-mining-agent: Mine Transcripts Into Ranked Product Pain Points

A Claude Code and Codex skill that reads chat transcripts and support tickets and turns them into a ranked list of product pain points. It also proposes PRD updates and flags gaps in end-to-end test coverage. Aimed at product work rather than pure coding.

skillproductresearchtesting
by tombelieber Aug 24, 2026 6/10
skill GitHub

chatgpt-share-dump: Turn ChatGPT Share Links Into Local Archives

A CLI plus agent skill that converts a shared ChatGPT conversation link into a local, agent-readable archive. Useful for pulling prior ChatGPT work into a Claude Code session as context instead of copy-pasting it.

skillclichatgptarchive
by tombelieber Aug 24, 2026 6/10
skill GitHub

claude-skills-for-business-intelligence: BI Numbers That Reconcile to Source

A free Claude Code skill for business intelligence work, packaged with a doctrine requiring every figure to reconcile against the source file's own totals. The aim is to stop agents from producing plausible-looking numbers that do not add up. From kymira.ai.

skillbusiness-intelligencedataverification
by dylnbaker15 Aug 24, 2026 6/10
skill GitHub

Dataviz-Coding-Agent: Verified Interactive Data Visualization as a Skill

A Claude Skill that takes raw data to a working interactive visualization through a five-stage workflow with five layers of verification. The guardrails exist to keep vibe-coded charts from silently misrepresenting the data.

skilldatavizverificationworkflow
by hsuan1012 Aug 24, 2026 7/10
skill GitHub

ya-skills: Skill Catalog and yk CLI for Installing Skills Into Repos

A catalog of reusable skills for Claude Code and Codex, plus a `yk` CLI that installs them into a repo. It also runs bundled workflow tools including PBench, transcript processing, and A-share market data.

skillscatalogcliinstaller
by Yaphet2015 Aug 24, 2026 6/10
skill GitHub

logicprobe: Fourteen Logic Probes Against Design Docs and Refactor Plans

Verifies the claims in design documents and refactoring plans using seven structural and seven adversarial logic-primitive probes. Rather than reviewing code, it checks whether the plan's reasoning holds up. Runs on Claude Code, Codex, Cursor, Kimi, OpenCode, ZCode, and DeepSeek Harness.

verificationplanningreviewmulti-model
by AmethystLuna Aug 24, 2026 7/10
skill GitHub

aeo-geo-audit: Make Your Site Citable by ChatGPT and Perplexity

A Claude Code skill that audits a site for how well AI answer engines can crawl, extract, and cite it, then applies the fixes. Built Shopify-first but works on any stack. Targets ChatGPT, Perplexity, and Google AI Overviews.

seoaeoauditshopify
by snapdevio Aug 24, 2026 7/10
skill GitHub

BenArunskiUtils: Text-to-Speech and Explain-Yourself Skills

Two public Claude Code skills with standalone CLI versions: `tts` turns a document into spoken-word audio, and `explain-yourself` walks through code the way you would actually want it explained.

skillsttsexplanationutilities
by ArunskiOrg Aug 24, 2026 6/10
skill GitHub

community-scripts-agent-skill: Proxmox Helper Script Rules as a Skill

Packages the Community Scripts / Proxmox VE Helper Scripts contribution guidelines into an agent skill. Loading it means your assistant already knows the project's formatting, structure, and review conventions before it writes a script. A clean example of turning a project's CONTRIBUTING doc into something an agent actually follows.

skillproxmoxcontributinghomelab
by aroldobossoni Aug 23, 2026 5/10
skill Reddit

cleanupPeriodDays: Claude Code Purges Conversations After 30 Days

A reminder that `.claude/settings.json` has a `cleanupPeriodDays` key defaulting to 30 days, after which past conversations are purged. If you work on long-running projects and expect to resume a thread months later, raise the value or export the transcript. The poster learned this by returning to half-finished research that was already gone.

settingsconfigurationsessionsretention
by cleverhoods Aug 23, 2026 6/10
skill GitHub

agentic-validation-skills: Self-Healing Test Automation Skills

A skill collection covering agentic test automation end to end: test case authoring, context and intent capture, self-healing selectors, failure classification, guardrails, and progressive context disclosure. Each concern is a separate skill so you can load only what a given task needs. Aimed at teams pointing agents at flaky end-to-end suites.

skilltestingqaautomationself-healing
by vivekkrishna Aug 23, 2026 7/10
skill GitHub

hermes-skills: Paste One Prompt, Get Only the Skills You Approve

A library of reusable procedures that make an assistant handle recurring work the same way every time. Installation is conversational: paste a single prompt, it recommends a handful of relevant skills, and installs only the ones you approve. Works with both Claude and Hermes.

skilllibraryproceduresinstaller
by TechNickAI Aug 23, 2026 7/10
skill GitHub

image2editable: Turn Images, PDFs, and Flat PPTX Into Editable Slides

A skill and CLI for Claude Code and Codex that converts images, PDFs, image-based PPTX files, and mixed decks into genuinely editable PowerPoint presentations. Aimed at the common case where you receive a deck as flattened pictures and need to change the text. Available both as an agent skill and a standalone command.

skillpptxpdfdocumentscli
by DSY-Xueai Aug 23, 2026 7/10
skill Reddit

Design Rules as SKILL.md So AI Sites Stop Looking Identical

Argues the generic purple-gradient SaaS look comes from the model defaulting to the statistical average of landing pages, not from a model weakness. The fix is a strict set of design rules written as SKILL.md or .cursorrules that force actual design decisions. Practical for anyone shipping AI-built frontends.

designskillfrontendprompting
by AudienceNo2554 Aug 23, 2026 6/10
skill GitHub

deck-to-html: Turn a PDF or PowerPoint Deck Into One Interactive HTML File

A Claude Skill that converts a deck into a single self-contained HTML presentation with native animated SVG charts, sequenced entrances, and live-embedded demos. Exports back to PDF when you need the static form. Practical for anyone who presents from the browser.

skillpresentationhtmlsvg
by hunkim Aug 23, 2026 7/10
skill GitHub

claude-wol-remote-access: Wake and Manage Machines From Your Phone

A Claude Code skill that builds a phone-reachable panel for waking, monitoring, and powering machines over Tailscale using Wake-on-LAN. The skill generates the panel rather than shipping a fixed app. Handy for anyone running a home lab behind a sleeping workstation.

skillwake-on-lantailscaleremote
by REMvisual Aug 23, 2026 6/10
skill Reddit

A Claude Skill for Shipping Apps That Pass Compliance and Trust Checks

Open-sourced skill built with legal input that pushes Claude toward production-ready output — PII handling, GDPR, env key protection, and geographic regulation. The author's complaint is that vibe-coded apps ship failing these checks by default. Pairs a skill with a hosted service.

skillcompliancegdprsecurity
by Uditakhourii Aug 23, 2026 6/10
skill GitHub

claude-skills: Claude Code Skills Distilled From Real Salesforce Delivery

Skills drawn from production Salesforce work, including User-object mixed DML and Files querying, plus three platform-agnostic working methods. The Salesforce specifics are narrow but the working methods generalize. MIT licensed.

skillsalesforceapexmit
by rob-alexa Aug 23, 2026 6/10
skill GitHub

agents-frontend-rules: Drop-In AGENTS.md Rules Against Frontend AI Slop

A rules file covering distinctive UI, WCAG 2.2 accessibility, SEO, Core Web Vitals, form handling, and human-sounding copy. Works with Cursor, Claude Code, and Codex through AGENTS.md and Cursor rules. Concrete constraints rather than general style advice.

frontendaccessibilityseoagents-md
by romanveselovski Aug 23, 2026 7/10
skill GitHub

sega-32x-skill-for-claude: Build and Verify Real Sega 32X Cartridge ROMs

Takes a game idea or port target through to a playable .32x ROM, covering build, optimization, and testing. The notable part is that it knows how to prove the ROM actually runs instead of stopping at a successful compile. A good example of a skill that encodes verification, not just generation.

skillretrogamedevverification
by haroldo-ok Aug 23, 2026 7/10
skill GitHub

store-screenshots: Turn Raw Screenshots Into App Store Marketing Images

An agent skill for Claude Code and Codex that frames raw screenshots in iPhone, iPad, Galaxy, Fold, and Flip devices, generates app-matched backgrounds and marketing copy, and exports at exact App Store and Google Play sizes. Removes a tedious pre-launch chore. Korean and English.

skillscreenshotsapp-storemarketing
by LeeHueeng Aug 23, 2026 6/10
skill GitHub

AGENTS.md-Best-Practices: Universal Prompts That Follow the Open Spec

A set of best practices for writing AGENTS.md files that comply with the open specification and work across tools. Focuses on prompt structure that survives being read by different agents. Reference material rather than an installable package.

agents-mdpromptingspecreference
by JularDepick Aug 23, 2026 6/10
skill GitHub

professional-skills: Anti-Slop Editing and Technical Writing for Agents

Two writing skills — anti-slop editing that strips AI tells, and technical content writing. Ships as a Claude Code and Codex plugin installable through skills.sh. Useful for anyone whose agent output goes in front of readers.

skillwritingeditingplugin
by Kaos599 Aug 23, 2026 6/10
skill GitHub

git-loopy-skills: Agent skills for an idea-to-ship engineering workflow

A skill collection implementing the git-loopy workflow, covering the loop from idea through implementation to shipping. Modeled on the mattpocock/skills layout, so the skills are meant to be dropped in and composed rather than used as a monolithic framework. Useful if you want an opinionated, ready-made engineering loop instead of assembling your own.

skillworkflowgitengineering-process
by bradcstevens Aug 23, 2026 6/10
skill Reddit

NeoynGPT Video-to-Code: Give your agent a video as visual reference

An agent skill that lets you hand a coding agent a YouTube link or screen recording instead of describing a UI interaction in words. It analyzes the video itself — not a transcript — so animations, transitions, layout, and interaction timing become usable context while the agent works on your codebase. Installs via npm and works with Claude Code, Cursor, Codex, and Antigravity CLI.

skillvideouimultimodalfrontend
by PumpkinNarrow6339 Aug 23, 2026 7/10
skill GitHub

mediagen: Image and video generation skill + MCP server for Claude Code

A Claude Code skill that wraps Gemini, OpenAI and Kie AI image/video generation behind a single CLI and MCP server. One interface means you can swap providers without rewriting prompts or plumbing. It also stamps generated media with EU AI Act content markings, which matters if you ship AI media in the EU.

skillmcpimage-generationvideo-generationeu-ai-act
by Cripacx Aug 23, 2026 7/10
skill GitHub

KR_PATENT_SKILL: Claude skills for Korean patent attorney practice

A skill collection covering the Korean patent attorney workflow end to end — from the inventor interview through drafting a Korean-format patent specification to exporting docx. Encodes domain conventions that a general model does not reliably produce on its own. Narrow but deep if you work in KR patent practice.

skillpatentkoreanlegaldocx
by lsj4232 Aug 23, 2026 5/10
skill GitHub

ai-first-product-skills: Product Management Craft as Installable Skills

A set of Agent Skills that encode product-management practice for Claude Code: customer discovery, metrics definition, PRD writing, and visual design, plus higher-level CPO and "Frontier CTO" personas. Instead of re-prompting the same product framing each time, you install the skill and invoke it. Aimed at PMs and founders using Claude Code beyond pure coding.

skillsproduct-managementprddiscoveryagent-skills
by pedroromeroluna Aug 23, 2026 6/10
skill GitHub

prompt-optimizer: Cross-Model Claude/GPT Review Loop for Prompts

A Claude Code skill that takes any prompt and runs it through an iterative review loop between Claude and GPT, with each model critiquing the other's revisions. It returns an optimized version of the prompt rather than a list of suggestions. Useful if you write agent or system prompts and want a second model's perspective baked into the workflow.

prompt-engineeringskillgptcross-model
by yorilavi Aug 23, 2026 6/10
skill GitHub

wentro: Turn a Finished Trip into a Shareable Itinerary Map

A Claude Code skill that converts a trip description into an itinerary map using real OSRM routes over an OpenStreetMap basemap. It outputs both an interactive page and a PNG for sharing. Triggers on phrases like "itinerary map", "travel recap", or the Chinese 行程图.

skillmapsosmtravelvisualization
by ShawNova Aug 23, 2026 5/10
skill GitHub

which-skills: Route Tasks to Skills the Model Cannot See

Addresses the problem that only a fraction of your installed skills are visible in the model's context at any time — the author reports 78 of theirs are invisible. It acts as a router that matches an incoming task to the right skill even when that skill was never surfaced. Worth a look if your skills directory has outgrown what Claude Code auto-loads.

skillroutingcontext-managementdiscovery
by advegaf Aug 23, 2026 7/10
skill GitHub

kavach: Zero-Input Security Audit Skill with SARIF Output

A Claude Code skill backed by a Python core that audits any codebase with no configuration required. It hunts leaked API keys, IDOR, billing bypass, prompt injection, and vulnerable or malicious dependencies, then produces a VAPT-grade report. Output is available as SARIF or JSON so it can feed CI security dashboards.

securityskillsarifauditstatic-analysis
by adhuniklabs Aug 23, 2026 8/10
skill GitHub

Legal-Agent-Skills: Contract Review and Legal Research Skill Packs

Two skill packs for AI coding agents covering contract review and legal research. They are agent-agnostic rather than Claude Code specific, so they work anywhere the skill format is supported. Relevant if you are building domain skills outside of software engineering and want a reference structure.

skilllegaldomain-skillscontract-review
by code-lawyer Aug 23, 2026 6/10
skill GitHub

surface: Skills for UI That Reads as Considered Rather Than Generated

A set of agent skills aimed at the tell-tale sameness of AI-produced product work. One half targets building UI with deliberate design decisions instead of default component-library output; the other unslops the marketing and docs prose written about it. Useful if your generated frontends all look like the same template.

uidesignskillwritingfrontend
by XavierAgostino Aug 23, 2026 7/10
skill GitHub

agent-creator-skill: Build LLM Agents from Patterns in Real Codebases

A skill for scaffolding production-grade LLM agents using patterns distilled from studying real agent codebases rather than from tutorials. It encodes the structural decisions — tool design, control flow, error handling — that working agents converge on. Aimed at people writing new agents who want a defensible starting architecture.

skillagent-designpatternsllm
by alfredzhang98 Aug 23, 2026 7/10
skill GitHub

product-tour: Generate First-Run Product Tours with driver.js

A Claude Code skill that builds an onboarding tour for a web app using driver.js — spotlights, tooltips, and a pointing hand. It wires up exactly-once state so returning users are not shown the tour again. Handles the persistence detail that most hand-rolled tours get wrong.

skillonboardingfrontenddriver-jsux
by nt11111 Aug 23, 2026 6/10
skill GitHub

clodcast: Turn Saved Articles into a Produced Spotify Podcast Episode

A daily-digest skill that takes a list of saved articles and produces a full podcast episode narrated with Qwen3-TTS, published through the save-to-spotify CLI. The output is a finished episode, not a script to record yourself. A concrete example of chaining a skill on top of an existing CLI tool.

skillttspodcastspotifyautomation
by schmug Aug 23, 2026 6/10
skill GitHub

information-security-for-vibecoded-apps: Autonomous AppSec Skill Module

An AppSec prompt and skill module that walks a coding agent through hardening a vibe-coded prototype into production-grade software. Covers the usual gaps such prototypes ship with: auth, secrets, input validation, and dependency risk. Targets Antigravity, Cursor, and Copilot, but the prompt structure ports to Claude Code.

securityappsecskillhardening
by softwareasg-tools Aug 22, 2026 6/10
skill GitHub

midnight-seo-skills: Claude Code Skill Suite for Portfolio SEO Ops

A set of Claude Code skills covering SEO operations across a portfolio of sites: technical audits, topical maps, link acquisition, local pack strategy, GA4 telemetry, and rapid indexing. Each area is its own skill so you invoke only the part you need. Useful if you run SEO work as a repeatable agent workflow rather than ad hoc prompts.

seoskillsauditga4
by abouchard11 Aug 22, 2026 6/10
skill Reddit

sitrep-panel: Live Status Page for Long Claude Code Sessions

A small skill that keeps a local web page updated while Claude Code works — current activity, a screenshot where useful, and a running log. The author built it to avoid watching terminal output scroll by while juggling several sessions. MIT licensed and deliberately minimal.

monitoringskillsessionsdashboard
by Disastrous_Exam9484 Aug 22, 2026 6/10
skill GitHub

ink-wash-flat-poster: Agent Skill for Minimalist Ink-Wash Poster Illustration

An agent skill that reconstructs a photo or theme into a flat ink-wash poster illustration — off-white textured paper feel, large areas of negative space. Documentation is primarily in Chinese. A narrow creative skill, useful mainly as an example of encoding a consistent visual style into an agent skill.

skilldesignillustrationposter
by shanhai256 Aug 22, 2026 5/10
skill GitHub

CCSwitch-operations: Portable Skill for Managing Prompts, Skills and MCP Servers

A portable operations skill for CC Switch that runs under both Claude Code and Codex, covering safe management of prompts, skills, MCP servers, and provider configs. It encodes the routine maintenance steps so an agent can edit your setup without corrupting it. Documentation is bilingual (English and Chinese).

skillcc-switchmcpconfigurationcodex
by RuriLothlorien Aug 22, 2026 6/10
skill GitHub

autistic: Depth-First Systems Reasoning Mode for Coding Agents

A reasoning skill that puts an agent into monotropic, depth-first analysis of a single system rather than broad divergent ideation. It is pitched as the complement to brainstorming-style prompts, for when you need one thread followed all the way down. Niche, but a clear framing of a real trade-off in agent prompting.

skillreasoningpromptingsystems-analysis
by khhvmc5g6f-eng Aug 22, 2026 5/10
skill GitHub

drawn-to: Taste Library and Design-Direction Interview for Coding Agents

A design taste library of 57 references, 12 constants, and 8 style families, paired with a weighted interview that locks in a direction before the agent writes any UI code. It gives the agent something concrete to aim at instead of defaulting to generic styling. Useful when every agent-generated frontend comes out looking the same.

skilldesignuifrontendtaste
by Stianlars1 Aug 22, 2026 7/10
skill GitHub

employment-contract-review: SKILL.md for German Employment Contract Risk Review

An agent-harness skill (SKILL.md) that runs automated risk review over German employment contracts, producing bilingual DE/EN, evidence-first findings tied back to contract clauses. MIT licensed and explicitly not legal advice. A concrete example of packaging domain expertise as a reusable Claude Code skill.

skilldocument-reviewlegalbilingualgerman
by donrami Aug 22, 2026 5/10
skill GitHub

turkce-humanizer: Strip AI Writing Signatures From Turkish Text

A Claude skill that rewrites AI-generated Turkish into natural, human-sounding Turkish by removing the telltale patterns of machine writing. Aimed at Turkish speakers who draft with Claude and want output that does not read as generated.

skillturkishwritinghumanizer
by bushrabeg Aug 22, 2026 5/10
skill GitHub

agent-expression: Seven Portable Skills for Clearer Text and Code

A set of seven portable agent skills covering product copy, prompts, prose, and code clarity. Each is written to drop into any SKILL.md-compatible agent, so the same editing standards apply across Claude Code, Codex, and the rest.

skillswritingpromptsportable
by itsMay21 Aug 22, 2026 6/10
skill GitHub

intent-debugger: Turn Vague Ideas Into Aligned Requirements

A skill that interrogates a fuzzy feature idea until it becomes a concrete, agreed requirement, running before any design or implementation begins. It targets the most expensive agent failure mode: building the wrong thing very quickly.

requirementsplanningskill
by bydtesla1609 Aug 22, 2026 6/10
skill GitHub

DDC Skills for Construction: 221 Skills for BIM and Estimating

A library of 221 agent skills for construction work — BIM model analysis, cost estimation, scheduling, and document control — packaged for Claude Code. One of the larger domain-specific skill collections outside software engineering.

skillsconstructionbimdomain
by datadrivenconstruction Aug 22, 2026 7/10
skill GitHub

agent-loc-guard: Cross-Agent Line-of-Code Guard for Codex and CC

A skill that caps how much code an agent may add or change in a single pass, working across both Codex and Claude Code. A simple lever against the sprawling diff nobody can actually review.

skillguardrailsdiffreview
by stef-k Aug 22, 2026 6/10
skill GitHub

CkSKILLS: 14 Security-Testing Skills for Vulnerability Research

A Chinese-language skill system for security response center bug hunting, pairing a system-level prompt with fourteen specialised security testing knowledge bases. Built for Claude Code and Codex.

securityskillsvulnerability-researchchinese
by zhaji2333 Aug 22, 2026 6/10
skill GitHub

keymap-ai: Turn Your Agent Into a ZMK and QMK Firmware Expert

An agent skill that audits ZMK and QMK keymaps, tunes home row mods, makes trackballs layer-aware, generates keymap diagrams in CI, and adds alternative layouts like Graphite and Colemak-DH. It covers the failure modes the firmware docs leave out.

skillkeyboardfirmwarezmkqmk
by johncattrall Aug 22, 2026 7/10
skill GitHub

Claude for .NET: Drop-In Config With Hooks, Subagents and TLA+

A complete Claude Code configuration for .NET and fullstack projects: deterministic hooks, a spec-driven pipeline, subagents, skills, and formal verification using Allium and TLA+. Unusually far toward the formal end for an agent setup.

dotnetconfigformal-verificationhooks
by johanolofsson72 Aug 22, 2026 7/10
skill GitHub

lean-max: Skill Claiming 94% Token Reduction, Benchmark Included

A skill that trims coding token usage by as much as 94% while holding output quality, and ships the reproducible benchmark it used to measure that. The included measurement is what separates it from the usual claim.

tokensskillefficiencybenchmark
by Sarveshmehta1504 Aug 22, 2026 7/10
skill GitHub

scrapbook-photo-collage-skill: Tactile Collages From Your Images

A portable agent skill that assembles scrapbook-style photo collages with a tactile, physical look, keeping faithful control over each source image. Works with any agent supporting the Agent Skills format.

skilldesignimagescollage
by ShaineDemo Aug 22, 2026 5/10
skill Reddit

MIT-Licensed Agent Skills Built to Stop Rather Than Fake an Output

Four skills built around one rule: if the real output is not achievable, stop and ask instead of emitting a placeholder. They cover backend provisioning with real credentials, a security scanner that fixes rather than reports, a frontend builder, and a relevance router, with CI validating each on push.

skillsmitno-placeholdersci
by MonitorFlat4465 Aug 22, 2026 7/10
skill GitHub

agent-skills: Question, Research, Structure, Plan, Implement, Hand Off

A skill set laying out one engineering loop — question the ask, research, structure, plan, implement, then hand off — as discrete steps an agent moves through. Aimed at real project work rather than demos.

skillsworkflowplanninghandoff
by racastellanosm Aug 22, 2026 5/10
skill GitHub

s2-forge: Agent Skills for Auditable Social Science Research

Curated agent skills for social science research where validity, transparency, and auditability matter more than speed. Each skill is written so the resulting analysis can be checked by someone else.

skillsresearchsocial-sciencereproducibility
by yifeifrank Aug 22, 2026 6/10
skill Reddit

Reference Facts Buried in Skills: Why CLAUDE.md Does Not Sync

A landlord running twenty custom skills across two laptops and a phone found that reference facts — which unit a tenant is in — had accumulated inside individual skills, so Claude only knew them when that skill fired, and put a tenant in the wrong unit. The thread covers where shared facts should live given CLAUDE.md is per-machine and per-folder.

claude-mdmemoryskillsdiscussion
by Little_Thought_8911 Aug 22, 2026 6/10
skill Reddit

Is the Superpowers Skill Set Still Worth It a Year On?

A long-time Superpowers user asks whether its brainstorming, TDD, and subagent skills still earn their token cost now that Claude Code has absorbed many of the same capabilities. Relevant to anyone carrying a large legacy skill set.

skillssuperpowerstokensdiscussion
by YUL438 Aug 22, 2026 5/10
skill GitHub

skillshop-agents: 131 Evidence-Backed Skills With file:line Proof

A library of 131 developer skills pairing deterministic PowerShell collectors with LLM judges, producing read-only audits where every claim carries file and line proof. The collector-plus-judge split keeps the evidence out of the model's imagination.

skillsauditpowershellevidence
by skillshop-ostyles Aug 22, 2026 7/10
skill Reddit

Teaching Claude to Write Like Zweig: Density Then Ruthless Cutting

Two Claude Code skills modeled on Stefan Zweig's method — one front-loads density into the first draft, the other runs a refinement loop making real cuts, then hands the result to a fresh-reader subagent allowed only to ask what is confusing and what is missing. The writeup shows before-and-after passes and the skills are on GitHub.

writingskillssubagentsediting
by WhatHasKHANGotToSay Aug 22, 2026 7/10
skill GitHub

agent-skills-registry: One-Command Reproducible Skill Registry

A registry that installs a pinned set of skills for OpenAI Codex and Claude Code with a single reproducible command. Aimed at teams that need every machine running the same skill versions.

skillsregistryreproducibleinstall
by wzy8996 Aug 22, 2026 6/10
skill GitHub

korean-report-skills: Fix the Off-Key Feel of Claude's Korean Docs

Agent skills that repair the sentence-level expression and document design of Korean text Claude produces, for when the output is technically correct but reads wrong to a native speaker. Aimed at reports and formal documents.

skillskoreanwritingdocuments
by JangHyun-bin Aug 22, 2026 6/10
skill GitHub

appllama-skills: Mobile App Skills Verified Against Top-Grossing Apps

Skills for building production mobile apps, each verified in a simulator and benchmarked against how top-grossing apps handle the same problem. The verification step is what distinguishes it from a prompt collection.

skillsmobileiosverification
by pianoteachervandegraaffgenerator47 Aug 22, 2026 6/10
skill GitHub

contador-sat-skill: Mexican SAT Tax Declarations and Invoicing

An extensible Spanish-language skill for handling SAT tax declarations and invoicing for individuals in Mexico. An example of agent skills reaching into country-specific compliance work.

skilltaxmexicocompliance
by angelroma Aug 22, 2026 6/10
skill GitHub

agentic_book_processor: Turn Academic PDF Books Into Obsidian Wikis

A pipeline of Claude Code skills that ingests academic PDFs and emits a didactic Obsidian wiki instead of a flat dump of extracted text. Each stage is a separate skill, so the chain also runs under Open Code and other agentic assistants. Aimed at people building study vaults from dense source material.

skillobsidianpdfpipelineresearch
by superoptimo Aug 22, 2026 7/10
skill GitHub

claude-video-editing-skill: Real Video Editing via the Shorz MCP Server

An Agent Skill that gives Claude Code, Claude Desktop, and Cursor access to actual video editing — auto-edit, clipping, subtitles, avatars, and publishing — by driving the free Shorz desktop app's MCP server and its 160+ tools. The skill layer supplies the editing know-how; the MCP server does the rendering work locally.

skillmcpvideosubtitlesshorz
by Vossy Aug 22, 2026 7/10
skill GitHub

benjaminematton/claude-skills: Working Skill Set With No Build Step

A personal but curated set of Claude Code skills that installs by cloning straight into ~/.claude/skills. Flat namespace, no build or package step, so it doubles as a readable reference for how to structure your own skills directory.

skillcollectiondotfiles
by benjaminematton Aug 22, 2026 5/10
skill GitHub

aiprogrammer: Skills, Guard Hooks, and Profiles for a Free MCP Dev Shell

A bundle of Claude Code skills paired with guard hooks and plugin profiles for the free Programmer-Wander MCP dev shell. The guard hooks are the interesting part — they gate what the agent is allowed to do inside the shell rather than trusting prompt instructions alone.

skillhooksmcpguardrails
by AIWander Aug 22, 2026 5/10
skill GitHub

claw-hwp: Read, Create, and Edit Korean HWP Documents Without Hancom

An open-source skill that lets Claude Code or Codex work with .hwp and .hwpx files directly, no Hancom Office install required. Covers reading, generating, and editing, which matters for Korean government and academic document workflows where HWP is mandatory.

skillkoreanhwpdocumentscodex
by DoHyun468 Aug 22, 2026 6/10
skill GitHub

365Skill: Library for Discovering, Validating, and Sharing Agent Skills

An experimental repo that treats Agent Skills as reusable packages — with discovery, a validation step, and a sharing convention. The validation angle is the differentiator versus the many plain skill-collection repos.

skillregistryvalidationsharing
by laojin1900 Aug 22, 2026 6/10
skill GitHub

auditoria-as-is-to-be: Read-Only Web Audit That Designs the Replacement API

A Spanish-language skill for Claude Code and Codex that audits a live web system strictly read-only: it documents every screen as it exists (AS-IS) and then designs the API that would replace it (TO-BE). No writes are ever executed, so it is safe to point at production.

skillauditapi-designlegacyspanish
by Espiritu16 Aug 22, 2026 6/10
skill GitHub

dialogue-tutor: Conversational Tutor Skill That Explains Every Equation Step

A Chinese-language coaching skill that takes a single problem and explains the formula behind it from first principles, emitting browser-readable HTML. Each equals sign gets its own line with a written justification for why that step holds.

skilleducationmathhtmlchinese
by jinshanbaihai Aug 22, 2026 5/10
skill GitHub

humanize-pro: Strip AI Tells, Then Fit the Text to Its Channel

A two-stage writing skill: first it removes the usual AI giveaways (em dashes, 'delve', rule-of-three cadence), then it reshapes the result for a specific channel — LinkedIn, X, cold email, Slack, exec memo, blog, or landing page. The channel-fitting pass is what separates it from the many generic humanizer skills.

skillwritinghumanizermarketing
by msdanyg Aug 22, 2026 5/10
skill GitHub

sharpen: Turn a Messy Request Into a Prompt the Agent Gets Right First Time

A markdown skill that rewrites a vague ask into a prompt precise enough for a coding agent to execute correctly on the first attempt. Works with Claude Code, Cursor, or any agent that reads markdown, so it is not tied to one harness.

skillpromptingcursorrequirements
by sazzadurrahmaan Aug 22, 2026 6/10
skill GitHub

free-claude-skills: Marketing Skill Pack with Anti-Slop Quality Gates

A free collection of Claude Code skills covering SEO, content strategy, keyword research, landing pages, and social captions. Notably it ships anti-slop quality gates rather than just generation prompts, so output gets checked before it ships. Relevant to anyone using Claude Code outside pure engineering work.

skillsmarketingseocontentquality-gates
by rdoser13 Aug 21, 2026 6/10
skill GitHub

legal-br: Brazilian Digital Law and LGPD Agent for Claude Code

A Portuguese-language legal agent for Claude Code covering Brazilian digital law, LGPD data protection, and consumer law. It works from a local library of official sources rather than model recall, and escalates to a human lawyer when a question exceeds what it should answer. A concrete example of a regulated-domain agent with a built-in handoff path.

legallgpdbrazilcompliancedomain-agent
by manfredjr Aug 21, 2026 5/10
skill GitHub

agent-seo-kit: Four Claude Code Skills for SEO and Answer-Engine Optimization

A skill pack covering keyword intake, monitoring how AI answer engines cite you, an evidence-driven writing driver, and citation-sourced backlink outreach. The four skills share one data layer behind a single Monid API key. Worth a look for the GEO angle — tracking AI answer-engine visibility rather than only classic search rank.

skillsseogeoanswer-enginescontent
by Jasper0122 Aug 21, 2026 6/10
skill GitHub

fullsend: Greenfield Builds with Parallel Agents and Blind Spec Tests

A skill for standing up greenfield code quickly by fanning work out to parallel agents. Its distinguishing idea is blind spec tests — tests written against the specification by an agent that has not seen the implementation, so they cannot be shaped to fit the code. A useful pattern for keeping fast parallel generation honest.

skillparallel-agentsgreenfieldtestingspec
by jgoetzmann Aug 21, 2026 7/10
skill Reddit

Repo Mirroring the Claude Code System Prompt, Bundled Agents, and Skills

A continuously updated repository that keeps a copy of the Claude Code system prompt alongside the bundled subagent definitions, built-in skills, and a wider collection of Claude Code prompts. It is a reference for understanding what the harness already tells the model before your CLAUDE.md is read. Handy when writing agents or skills that need to avoid duplicating built-in behavior.

system-promptreferenceagentsskillsprompts
by frubberism Aug 21, 2026 7/10
skill GitHub

orin-dx/agent-plugins: Plugin and Skill Marketplace Spanning Antigravity, Claude Code, Cursor

A cross-harness marketplace of agent plugins and skills that targets Antigravity (AGY), Claude Code, and Cursor from one catalog. The pitch is write the skill once and install it into whichever agent you happen to be using. Worth a look if you split work across more than one coding agent.

marketplacepluginsskillscursorcross-harness
by orin-dx Aug 21, 2026 6/10
skill GitHub

claude-site-media: Skill That Fills Missing Site Images and Video via Gemini

A Claude Code skill that scans a website for missing images and video, then generates them with Gemini models (Nano Banana Pro for stills, Veo 3.1 for motion). Prompts are anchored to the actual copy of each page block, so the generated media matches the section it sits in. Documentation is in Portuguese.

skillgeminiimage-generationvideoweb-design
by christian-jorge Aug 21, 2026 6/10
skill GitHub

academy-coach: Learn Anthropic Products via the Claude Academy Curriculum

A Claude Code plugin that turns the Claude Academy curriculum into hands-on lessons inside your editor. It walks through Anthropic product material and then reviews your actual sessions against Academy best practices. Aimed at people who want structured onboarding rather than trial-and-error learning.

pluginlearningbest-practicesonboarding
by MrMarudi Aug 21, 2026 6/10
skill GitHub

prompt-injection-audit: Red-Team Your Own Agents for Injection and Tool Poisoning

An Agent Skill that attacks your AI system the way an adversary would, probing for prompt injection and tool poisoning across your prompts and MCP tool surface. Output is a prioritized findings report with concrete fixes rather than a raw vulnerability dump. Relevant to anyone shipping agents that read untrusted content.

securityprompt-injectionred-teamauditmcp
by Itachi3355 Aug 21, 2026 7/10
skill GitHub

verify-ai-output: Trust Report That Classifies Every Claim

An Agent Skill that audits AI-generated content for reliability, producing a structured Trust Report that classifies each claim and flags the ones at risk of being hallucinated. Intended as a review pass over drafts, research summaries, or generated documentation before you rely on them.

verificationhallucinationreviewquality
by Itachi3355 Aug 21, 2026 6/10
skill Reddit

Plain English Output Style: A Fix for Opus 5's Verbose, Abstract Answers

A custom Claude Code output style aimed at Opus 5's tendency toward dense, metaphor-laden explanations, replacing lines like 'the retry path short-circuits on the tombstone marker' with 'deleted records are now skipped during retry.' Drop the gist file into ~/.claude/output-styles/plain-english.md and select it via /config, then start a fresh session. The author is actively soliciting refinements.

output-styleopus-5verbosityconfiggist
by gthing Aug 21, 2026 7/10
skill GitHub

dsh-ponytail: Chinese Port of ponytail With Six Lazy-Senior Skills

A complete DSH port of DietrichGebert/ponytail that adapts its 'lazy senior engineer' operating mode into six Chinese-language Claude Code skills. The port deliberately ships no empty tool stubs. Useful mainly to Chinese-speaking teams who want the ponytail workflow without translating it themselves.

chineseskillsponytailportlocalization
by Wenaixi Aug 21, 2026 5/10
skill GitHub

MBA Thesis Writing Guidance: An Agent Skill for Chinese MBA/EMBA Papers

A standard Agent Skill that guides Chinese MBA and EMBA thesis work through a topic-selection gate, the conventional five-chapter structure, a theory menu spanning eight research directions, and methodology norms. It is explicitly guidance rather than ghostwriting. The author recommends installing it at project level.

chineseacademicagent-skillwritingthesis
by stephenlzc Aug 21, 2026 5/10
skill GitHub

curb-skill: Buy or Sell Something Nearby in One Unauthenticated HTTP Call

curb.sale exposes local physical-goods listings to agents through a single unauthenticated HTTP call — no account, no API key, no signup. An optional Claude Code plugin wraps it, but the API works without installing anything. An unusual example of designing a real-world marketplace API for agent consumption rather than human forms.

marketplacehttp-apipluginagentsno-auth
by curb-sale Aug 21, 2026 5/10
skill Reddit

Liquid Glass Skill for Claude Code: CSS and SVG Displacement Filters

A Claude Code skill that implements glassy "Liquid Glass" styling in web apps. It packages the CSS, the SVG displacement filter setup, and the handful of rules that decide whether the effect actually reads as glass rather than a blurred rectangle. Useful if you keep re-explaining the same visual treatment to the model every session.

skillcssuidesignsvg
by rfusername Aug 21, 2026 7/10
skill GitHub

brse-toolkit: Japanese-Vietnamese Bridge SE Skills for Spec and Code Analysis

A skill toolkit for bridge software engineers working between Japanese and Vietnamese teams. Covers translation, specification and code analysis, Excel validation, output verification, report generation, and project-aware memory. Niche, but a solid example of encoding a whole job role into agent skills.

skilltranslationjapanesevietnamesespecs
by jame-hv Aug 21, 2026 5/10
skill GitHub

iso-24495: Plain Language Skills and Claude Code Plugin

Implements the ISO 24495 plain language standard as a set of agent skills plus a Claude Code plugin. Gives you a citable standard to point at when asking the model to simplify documentation or user-facing copy, instead of vague "make it clearer" instructions.

skillpluginwritingplain-languageiso
by GaZmagik Aug 21, 2026 6/10
skill GitHub

ethical-hacker-squad: Offensive-Security Subagents With a Cited Procedure Corpus

A squad of ethical offensive-security subagents for Claude Code that audits, hardens, and verifies projects you are authorized to test. The knowledge corpus holds 122 procedures across 7 role packs, each with per-stack detection patterns, false-positive criteria, and traceability back to the relevant standard.

securitysubagentsauditpentestskills
by CristianAjavi Aug 21, 2026 7/10
skill GitHub

awesome-strategy-skills: Agent Skills for Market, Product, GTM, and Pricing

A curated collection of AI agent skills covering market analysis, product strategy, go-to-market, pricing, growth, and executive strategy. Useful if you want the model to work through a structured strategy framework instead of improvising business advice.

skillsstrategyproductgtmcollection
by petrichorprojects Aug 21, 2026 5/10
skill GitHub

cn-dev-skills: AI Coding Skills Tuned for Chinese Development Environments

A skill pack addressing the environment problems Chinese developers hit constantly: npm registry mirrors, API routing, WeChat mini-program development, and deployment to domestic cloud providers. Fixes the assumptions most agent tooling makes about network access.

skillschinanpmwechatdeployment
by 2005selene2005-a11y Aug 21, 2026 5/10
skill GitHub

typo3-typoscript-ref-skill: TypoScript, TSconfig, and Fluid Reference for Agents

A reference lookup skill giving AI agents accurate TYPO3 TypoScript, TSconfig, and Fluid syntax instead of hallucinated approximations. Narrow scope, but reference-lookup skills like this are exactly where models fail most predictably on older or less-documented frameworks.

skilltypo3typoscriptreferencecms
by netresearch Aug 21, 2026 5/10
skill GitHub

claude-code-skills: Opinionated Skills for Fighting AI Slop in Code and Copy

Seven opinionated agent skills aimed at the characteristic sloppiness of AI output: stop-slop, red-pen, clarify, distill, quieter, polish, and harden. Each targets a specific failure — padding, hedging, over-explanation, unhardened code — rather than offering generic "improve this" prompting.

skillswritingcode-qualityreviewediting
by wpgaurav Aug 21, 2026 7/10
skill GitHub

ios-source-learning: iOS Source Navigation Layer for AI Agents

A module-by-module source map of Apple internals (objc runtime, CoreFoundation, libdispatch, Foundation) plus common third-party libraries such as AFNetworking, JSONModel, and SDWebImage, with behavior specs and version management scripts. Gives agents a navigable structure over code they would otherwise grep blindly.

iosobjcsourcenavigationchinese
by XiyouMobile3G-iOS Aug 21, 2026 5/10
skill GitHub

cli-delegate: Spawn Grok, Cursor, Claude, or Codex From Any Coding CLI

A host-neutral skill that lets one coding CLI spawn another agent as a child process and resume that same child session later. The pitch is billing: spend a second subscription you already pay for instead of another subagent on the same bill.

skilldelegationmulti-agentclicost
by isCopyman Aug 21, 2026 7/10
skill GitHub

claude-code-skills-1c: 116 Skills for 1C Development Without Configurator or EDT

A large skill pack (116 skills, 35 rules) letting Claude Code assemble 1C sources — metadata, forms, extensions, roles, SKD, data processors — from compact JSON, parse them back, verify results against an export, and check BSP calls against an API reference. Works without Configurator or EDT. Documentation is in Russian.

skills1crussiancodegenenterprise
by Desko77 Aug 21, 2026 5/10
skill GitHub

RunAPI Gemini Skill: Call the Gemini API From Claude Code and 50+ Agents

A portable skill that wraps the Gemini API for use from Claude Code, Codex, Gemini CLI, Cursor, and other agent harnesses. Handy when you want a second model available inside a Claude Code session without wiring up an MCP server.

skillgeminiapimulti-modelportable
by runapi-ai Aug 21, 2026 5/10
skill GitHub

ghbhiee/skills: PDF Translation, PDF-to-Markdown, and File-Share Agent Skills

A set of portable agent skills for Claude Code, Codex, OpenClaw, and Hermes covering temporary file-share links, layout-preserving PDF translation, PDF-to-Markdown extraction, and book search. The layout-preserving translation is the standout — most PDF translation pipelines destroy the original formatting.

skillspdftranslationmarkdownportable
by ghbhiee Aug 21, 2026 5/10
skill GitHub

ux-ui-skills: Structured Skills for UX Audits and Design System Reviews

Agent skills that give structure to UX and UI work: interface audits, dashboard redesigns, design system reviews, and AI product design. Provides a checklist the model actually follows rather than open-ended design opinions.

skillsuxuidesign-systemaudit
by Gonadotrophic-tangent41 Aug 21, 2026 5/10
skill GitHub

rubber-duck: Socratic Debugging Skill That Refuses to Hand You the Answer

A skill that flips the usual dynamic — instead of producing a fix, the agent asks questions until you find it yourself. Genuinely useful when you are learning a codebase and want to keep the understanding rather than the patch.

skilldebuggingsocraticlearning
by centsandcode Aug 21, 2026 6/10
skill GitHub

industry-market-research: Sourced, Recomputable Market Research Reports

A market research skill for Claude Code, Codex, and WorkBuddy that produces Markdown or PDF reports with cited sources, recomputable figures, and infographics of the core metrics. The recomputable part matters — it is what separates a research report from confident-sounding invention. Documentation is in Chinese.

skillresearchmarketreportschinese
by cxtx Aug 21, 2026 5/10
skill GitHub

agent-tutor: AI Tutor Skill That Writes Into Your Obsidian Vault

An agent-agnostic tutoring skill that writes lessons and notes directly into an Obsidian vault, working with Claude Code, Codex, Cursor, Windsurf, and 70+ other agents. Persisting to a vault rather than a chat window means the material survives the session.

skillobsidianlearningnotesportable
by Mohamed-El-Sharqawy Aug 21, 2026 6/10
skill GitHub

oracle-designer-cdapi-skill: Drive Oracle Designer 6i-10g From an AI Agent

A Claude Code skill that drives Oracle Designer (6i, 9i, 10g) through its CDAPI/CIO PL/SQL API — entities, tables, and forms — with no GUI involved. Ships proven SQL templates. A striking example of using an agent to reach legacy systems whose only interface is an undocumented API.

skilloraclelegacyplsqlautomation
by nuncij Aug 21, 2026 5/10
skill GitHub

federal-contracting-skills: SOW, PWS, and IGCE Builders as Portable Agent Skills

Free agent skills for federal contracting work: a SOW/PWS builder, three IGCE builders covering FFP, LH/T&M, and cost-reimbursement, plus OT project description and cost analysis. Written in portable SKILL.md format so they run on Claude, Codex, Gemini, Copilot, Grok, Cursor, opencode, and LibreChat.

skillsgovernmentcontractingportabletemplates
by 1102tools-dev Aug 21, 2026 6/10
skill GitHub

repo-context-ledger: Keep Repo Context and Handoffs Synced Across AI Tools

An open agent skill that keeps repository context, feature specs, change handoffs, and README summaries synchronized across AI coding tools. Targets the drift that appears when each tool keeps its own stale copy of what the project is.

skillcontextspecshandoffinterop
by gviiisen Aug 21, 2026 6/10
skill GitHub

stock-research-skills: 19 Skills Turning the Groww MCP Into a Research Desk

Nineteen research skills that build on Groww MCP server to cover Indian markets — stocks, ETFs, mutual funds, bonds, and F&O. A good illustration of layering domain skills on top of a single data-source MCP rather than expecting the MCP to do the analysis.

skillsmcpfinanceresearchindia
by getlost01 Aug 21, 2026 6/10
skill GitHub

win-rmux: Multi-Agent Control Unit Skill for Windows

A skill giving Windows users a multiplexed control unit for running several agents at once — the tmux-style workflow most multi-agent tooling assumes but Windows users rarely get. Documentation is in Chinese.

skillwindowsmulti-agentterminalchinese
by raystyle Aug 21, 2026 5/10
skill GitHub

jobgru: Agent Skills for a Full Job Search Pipeline

Agent skills that run a job search end to end from a single prompt: find postings, track them in Google Sheets, surface LinkedIn leads, and score your resume against ATS filters. Works with Cursor, Claude, and Codex.

skillsjob-searchautomationsheetsats
by ashujha301 Aug 21, 2026 5/10
skill GitHub

JovaniPink/skills: Portable Skills With Provenance and Cross-Client Packaging

Portable agent skills for Codex and Claude built around clean-room workflows, provenance tracking, security review, validation, and packaging for multiple clients. The provenance and validation focus is unusual — most skill collections ship the prompt and stop there.

skillsportableprovenancesecuritypackaging
by JovaniPink Aug 21, 2026 6/10
skill GitHub

skills-and-agents-library: Claude Code Plugin Marketplace and Skill Library

A plugin marketplace and skill library installable in one step with /plugin marketplace add Anlo-Ventures/skills-and-agents-library. Uses the native marketplace mechanism, so updates flow through rather than requiring a manual re-copy of files.

marketplacepluginsskillslibrary
by Anlo-Ventures Aug 21, 2026 6/10
skill GitHub

calendar-planner-skill: Turn dated tasks into Google Calendar events

A Claude skill that takes your dated, timed tasks and books them as Google Calendar events instead of keeping them in a separate to-do app. It schedules around fixed recurring commitments so protected blocks never get double-booked. Useful as a worked example of a personal-scheduling skill wired to a real calendar API.

skillcalendargoogle-calendarschedulingproductivity
by fenegroni Aug 21, 2026 5/10
skill GitHub

pherkad: Check whether a draft still sounds like you

A Claude skill that builds a personal voice profile from your writing and then audits new drafts against it. It flags documented AI tells with evidence, issues a verdict, and proposes targeted rewrites rather than wholesale regeneration. Handy if you use Claude for drafting but want the output to stay in your own voice.

skillwritingvoiceeditingai-detection
by btmoriarty Aug 21, 2026 7/10
skill GitHub

engineering-agent-skills: Provider-neutral skills for evidence-first engineering

A collection of portable Agent Skills aimed at software engineering workflows that insist on evidence before conclusions. Being provider-neutral, the skills are meant to work across Claude Code and other agent runtimes without rewriting. Good starting point if you want reusable engineering skills rather than one-off prompts.

skillagent-skillsengineeringportableworkflow
by haoyuqi Aug 21, 2026 6/10
skill GitHub

migu_skill: Curated open-source Agent Skills collection

An open-source collection of Agent Skills published by the Chinese tech account 别动生产库, described as streamlined and reviewed from first principles. The emphasis is on trimming skills down rather than piling on instructions. Worth a look if you want examples of tightly written skill definitions.

skillagent-skillscollectionopen-sourcechinese
by miguchn Aug 21, 2026 5/10
skill GitHub

goalsmith: Turn a one-line brief into a /goal completion contract

A Claude Code skill that expands a short brief into a detailed completion contract for long unattended runs. The contract spells out done-criteria up front so a multi-hour session has something concrete to check itself against. Aimed at people running agents overnight rather than babysitting each step.

skillgoalsunattendedautonomyplanning
by leoawesome Aug 21, 2026 7/10
skill GitHub

payplus-payment-gateway-skill: Offline PayPlus API Reference for Agents

An Agent Skill packaging the full REST API v1.0 documentation for PayPlus, an Israeli payment gateway, as an offline knowledge base. It covers payment pages, Hosted Fields, server-to-server charging, tokens, recurring payments, Invoice+ and error codes. Works with Claude Code, Claude.ai, Codex and Cursor, so the agent stops guessing at endpoint shapes.

paymentsapi-referenceknowledge-baseisraelagent-skill
by DanielMaximov1995 Aug 21, 2026 5/10
skill GitHub

class-action-finder: Agent Skill That Finds Class Action Settlements in Email

An AI skill for Claude, Codex and ChatGPT that scans your inbox for class action settlement notices and matches them against your actual purchase history to find cases you qualify for. It verifies claim links against known phishing patterns before you click, then tracks what you filed and what you were paid. A nice demonstration of a skill doing real cross-referencing rather than just prompt scaffolding.

emaillegalautomationphishing-checkagent-skill
by yingying-chu Aug 21, 2026 5/10
skill GitHub

god-skills: Three-Gate Code Review and Prose Humanizer Skills

Two Claude Code skills bundled together. God Dev runs code review through three sequential gates rather than one pass, so each stage can catch what the previous one missed. God Write rewrites AI-sounding prose into something that reads human. Small and focused, which makes them easy to lift patterns from.

code-reviewwritingskillsquality-gates
by xhanthis Aug 21, 2026 6/10
skill GitHub

DBHQ marketplace: Free Open-Source Skill Plugins for Claude Code and Codex

A Claude Code plugin marketplace from DBHQ collecting their free, open-source skills, installable with /plugin marketplace add dbhq-uk/marketplace. It is the distribution point for their individual skills rather than a single tool. Convenient if you already use one of their skills and want the rest without hunting repos.

marketplacepluginsskillsdistribution
by dbhq-uk Aug 21, 2026 6/10
skill Reddit

Weaponizing Style Contagion to Make Claude Respect Formatting Directives

A heavy Claude Code and Codex user, running roughly 117 messages a day, got fed up with walls of text surviving every instruction to be terse and went looking for why. The write-up documents the pattern behind directives being ignored and a technique using style contagion — shaping the surrounding context so the desired style propagates — rather than issuing more explicit instructions. Relevant to anyone whose CLAUDE.md tone rules keep getting steamrolled.

promptingstyleclaude-mdoutput-formattechnique
by allemaar Aug 21, 2026 6/10
skill GitHub

aiskills: Tool-Agnostic AI Engineering Skills, Templates and Eval Playbooks

A collection of reusable AI engineering skills, workflows, templates and evaluation playbooks written to be tool-agnostic rather than tied to one agent CLI. The evaluation playbooks are the differentiator — most skill collections cover building but not how to measure whether the output is any good.

skillstemplatesevaluationworkflowstool-agnostic
by karthikrshet Aug 21, 2026 6/10
skill GitHub

gym-operator: Agent Skill That Runs Recurring Gym Operations Work

An operator skill for gym owners that first builds a Gym Operations Knowledge Base, then runs recurring business tasks grounded in it rather than in generic model priors. The build-the-KB-then-operate-from-it shape is the transferable idea — it generalizes to any small business with repeatable weekly work.

businessknowledge-baseoperationsagent-skillvertical
by Level-Method Aug 21, 2026 5/10
skill GitHub

ozempskills: Token-Compressing Meta-Skill That Caches Shrunken Skills

A meta-skill that compresses any other skill's instructions, hashes the result, and caches it so repeat invocations cost fewer tokens. Compression is license-checked and preserves allowed-tools declarations and structure verbatim, so the skill's permissions and shape survive intact. Aimed at people running large skill libraries where the same instructions reload every session.

token-efficiencycompressionmeta-skillcachingcost
by marianif Aug 21, 2026 7/10
skill GitHub

rate-cv: Claude Code Skill That Scores CVs Against a Leadership Rubric

A Claude Code skill that critiques and scores CVs using a weighted engineering-leadership rubric. Includes ATS compatibility checks, AI-slop detection, and optional matching against a specific job description. Handy for anyone hiring or job hunting in engineering.

cvhiringrubricskill
by maccydee Aug 20, 2026 5/10
skill GitHub

rs2pydev/claude-skills: Publish Custom Skills as Slash-Command Plugins

Build, publish, and manage custom Claude Code skills as slash-command plugins distributed through a GitHub-hosted marketplace. Covers the packaging side that most individual skill repos leave to the reader.

marketplaceskillspluginsslash-commands
by rs2pydev Aug 20, 2026 6/10
skill GitHub

agent-skills-phoebe-picks: Skills Rated by Actually Building With Them

Every skill pick is field-tested by building a product from scratch with it, then scored on a public rubric. Currently 15 published picks across 16 field tests, with live demos and open source for each. A useful antidote to skill lists that are just README screenshots.

skillsreviewsrubriccuration
by phoebefu6 Aug 20, 2026 6/10
skill GitHub

rust-skills: Agent Skills for Production Rust

A skill collection covering the parts of Rust that agents usually get wrong: unsafe code, atomics, FFI/JNI/UniFFI boundaries, sanitizers, profiling, and supply chain checks. Aimed at production work rather than tutorials.

rustunsafeffiprofilingskills
by po4yka Aug 20, 2026 7/10
skill GitHub

agent-toolkit: 13 Skills, 9 Agents, and Quality Gates for Any Repo

A production-oriented bundle of skills and subagents covering plan, build, test, debug, and ship, plus harness hooks and quality gates for long sessions. Claude Code native but written to work with any LLM host, in any repo or language.

skillssubagentshooksquality-gates
by jvalin17 Aug 20, 2026 6/10
skill GitHub

muahib-skills: Production Skills for Web Cloning and Design Rebuilds

A set of Claude Code skills for website cloning, pixel-accurate design rebuilds, WordPress page-builder CMS work, modern CSS, and motion-graphics ad production. Front-end and design-heavy rather than backend.

designcsswordpresscloningskills
by abdul977 Aug 20, 2026 6/10
skill GitHub

job-hunt-skill: Discover, Verify, Rank, and Track Jobs in One Report

An agent skill that finds matching job postings, deduplicates them, verifies they are real and still open, ranks them, and tracks status in a searchable HTML report. The verification step is what separates it from a scraper.

jobssearchreportskill
by yanliudesign Aug 20, 2026 5/10
skill GitHub

linkpix-skills: 85 E-Commerce Agent Skills for Product Media

A large collection of agent skills for e-commerce content: product photography, short-form selling video, viral-post recreation, print-on-demand artwork, and cross-border product selection. Chinese-language, aimed at sellers rather than developers.

e-commercecontentmediaskillschinese
by autoagc Aug 20, 2026 5/10
skill GitHub

Greater China Legal: 478 Legal Agent Skills Across Five Jurisdictions

An adaptation of Anthropics claude-for-legal skills for mainland China, Hong Kong, Macau, Taiwan, and Singapore, covering 30 legal scenarios with 478 skills. One of the larger jurisdiction-specific skill systems published so far.

legalskillschinajurisdiction
by vivy-yi Aug 20, 2026 5/10
skill GitHub

poster-grid-inspector: Detect and Export a Posters Layout Grid

Uses a vision model to detect the grid system underlying a poster, overlays it for inspection, and exports SVG guides, CSS Grid, or Tailwind code. Model-agnostic and ships as an installable agent skill.

designvisioncss-gridtailwindskill
by Ygria Aug 20, 2026 5/10
skill GitHub

envskill: Least-Privilege Environment Variables for Coding Agents

A CLI plus portable agent skill that gives an agent only the environment variables it needs for the task at hand, rather than exposing your whole shell environment. Straightforward mitigation for the most common way secrets leak into transcripts.

securitysecretsenv-varsleast-privilege
by buhaistrikalo Aug 20, 2026 7/10
skill GitHub

terragrunt-skill: Terragrunt 1.x Skill That Reads Your Installed Version

Generates, reviews, and diagnoses Terragrunt configurations across AWS, Azure, and GCP. Notably it reads the installed terragrunt version from the machine rather than asserting one, and uses a grep-first reference set to avoid loading docs it does not need.

terragruntiacawsazuregcp
by kevin-burns Aug 20, 2026 6/10
skill GitHub

SEO Skills AI: Technical SEO Agent Suite Across Seven Hosts

A universal SEO and technical-optimization skill suite that runs in Claude Code, Antigravity, Cursor, Windsurf, Copilot, ChatGPT, and Cline. Covers audits and content optimization from one skill set rather than per-tool configs.

seoauditcross-toolskills
by seoskillsai Aug 20, 2026 5/10
skill GitHub

autoprompt-skill: Cuts Agentic Coding Failures by 45%

A coding-agent skill that reworks your prompt before the agent acts on it, which the author measures as a 45% reduction in failures on agentic coding tasks. Worth a look if your failures cluster around underspecified requests.

promptingreliabilityskillbenchmark
by Spielewoy Aug 20, 2026 6/10
skill GitHub

clear-business-writing-skills: Writing Without Bullshit, as Three Skills

Three Claude Code skills for engineering-management business writing, derived from Josh Bernoffs Writing Without Bullshit and built with a TDD-for-docs discipline. The methodology is the interesting part — the skills were tested against expected outputs before publishing.

writingmanagementtddskills
by introvenk Aug 20, 2026 5/10
skill GitHub

multi-source-paper-search: Cross-Source Literature Scan for Claude Code

Fans out a literature query to OpenAlex, Semantic Scholar, arXiv, and Perplexity, deduplicates deterministically rather than by model judgement, and reconciles everything into one cited consensus report. The deterministic dedup is what makes results reproducible.

researchpapersarxivsearchskill
by PlutoLei Aug 20, 2026 7/10
skill GitHub

paperbanana-skill: Publication-Quality Academic Diagrams

A Claude Code skill wrapping PaperBanana to generate publication-ready academic diagrams from a description. For the figures that usually cost an afternoon in Illustrator.

diagramsacademicfiguresskill
by PlutoLei Aug 20, 2026 5/10
skill GitHub

scientistos: Evidence-First Research Skills With a Verifiable Graph

Research skills for Claude Code and Codex that tie every agent claim to a node in a verifiable evidence graph instead of leaving it floating in chat history. Makes it possible to audit where a conclusion came from.

researchevidencegraphprovenance
by Ahmad-Jaradat-Space Aug 20, 2026 6/10
skill Reddit

grill-me: Have Your Agent Quiz You on Your Own Codebase

Run it and the agent interrogates you on the minutiae of your code, which quickly exposes the gap between how the code runs and what you believe about it. The author pitches daily use to hold down cognitive debt, and notes it also surfaces poor implementations and misaligned intent. Not a substitute for a real SDLC.

reviewlearningcognitive-debtskill
by jjw_kbh Aug 20, 2026 7/10
skill GitHub

qa-skills: Full-Lifecycle QA Agent Skills With a Reproducible Benchmark

A QA framework of methodology plus ten skills that makes an agent work like a senior test engineer, shipped with a reproducible benchmark so the claims can be checked. Chinese-language, works in Claude Code and other agent hosts.

qatestingbenchmarkskillschinese
by fishzjp Aug 20, 2026 6/10
skill GitHub

codex-engineering-workflow: Workflow Scaffolding Skill

A skill for Codex and Claude Code that scaffolds an effective engineering workflow onto a project, so the agent has a defined process to follow rather than inventing one per task.

workflowscaffoldingcodexskill
by xeonvs Aug 20, 2026 5/10
skill GitHub

dotagents: One Global Toolkit for Claude Code and Cursor

Skills, hooks, and verification gates installed once globally, so product repositories stay untouched by your personal tooling. Works across both Claude Code and Cursor.

dotfileshooksskillsglobal-config
by bwkw Aug 20, 2026 5/10
skill GitHub

asb-skill-collections: Evidence-Grounded Skills for Scientific Agents

Curated skill and software-tool collections for scientific AI agents, generated by the AgenticScienceBuilder and grounded in cited evidence. Domain coverage for research work rather than general software engineering.

scienceresearchskillsevidence
by HolobiomicsLab Aug 20, 2026 5/10
skill Reddit

You Can Turn Off the Shortened System Prompt in v5 Models

CLAUDE_CODE_SIMPLE_SYSTEM_PROMPT set to 0, false, no, or off opts out of the shorter system prompt and abbreviated tool descriptions even where the experiment would otherwise enable it. Full tool set, hooks, MCP servers, and CLAUDE.md discovery are unaffected either way. The poster reports noticeably fewer careless errors after 48 hours with it off.

env-varssystem-promptconfigurationtips
by dar-mit Aug 20, 2026 6/10
skill GitHub

meeting-transcript-summary-skill: Transcripts to Summaries and Actions

Turns meeting transcripts into three outputs at once: an executive summary, a detailed technical record that preserves decision rationale, and action items aligned to both. The rationale-preserving record is the part most summarizers drop.

meetingssummarizationtranscriptsskill
by terravic Aug 20, 2026 5/10
skill Reddit

PlayCanvas Shipped Official Skills for AI Coding Agents

PlayCanvas has published first-party agent skills for its engine, and one developer has been building a multiplayer FPS with them. First-party skills from an engine vendor are still rare enough to be worth noting.

playcanvasgamedevofficialskills
by Kpal81 Aug 20, 2026 6/10
skill GitHub

ymd38/dev-skills: Continuous Improvement Loop With Strict CI Gates

Skills plus a full project harness built around an evaluate, issue, plan, resolve, verify cycle, with gitleaks, semgrep, and trivy gates, guard hooks, and score-aligned coding rules. The author frames it as harness engineering rather than prompt engineering.

cisecurityhooksharnessskills
by ymd38 Aug 20, 2026 6/10
skill GitHub

prompt-it: A Planning Skill That Asks Before It Plans

A planning skill that interrogates the request before producing a plan, shipped in three variants: claude.ai, engineers, and a read-only version for people with data access who do not ship code.

planningpromptingskillvariants
by marcosathanasoulis Aug 20, 2026 5/10
skill GitHub

trust-me-bro: Audit a Skill Before You Install It

Every skill you install effectively asks you to trust it; this one reads it first. Pre-install audit for agent skills, plugins, and MCP servers covering lethal-trifecta reach, prompt-injection wording, provenance, and drift after you approved it. The drift check matters — approval is not permanent.

securityauditsupply-chainprompt-injectionmcp
by kanywst Aug 20, 2026 8/10
skill GitHub

CodeDNA: Per-Module CLAUDE.md That Updates With the Change

Keeps a CLAUDE.md and architecture.md next to each module so Claude loads verified local context before editing, and updates those files as part of the same change. Documentation that goes stale is the failure this targets.

claude-mdarchitecturecontextdocumentation
by rohit-patil-lifecode Aug 20, 2026 6/10
skill GitHub

code-standards: Deterministic Standards for Five Stacks

Deterministic coding standards for Python, TypeScript, SQL, infrastructure as code, and repository policy — written so an agent applies them the same way every time rather than interpreting them afresh.

standardspythontypescriptsqliac
by sarj-ai Aug 20, 2026 5/10
skill GitHub

decision-making-skills: Decision Skills With a Placebo-Controlled Test Harness

A set of agent skills for reasoning under uncertainty, shipped alongside a pre-registered, placebo-controlled harness that measures whether the skills actually change outcomes. The evaluation rigor is the unusual part — most skill packs ship without any evidence they help.

skillsdecision-makingevaluationbenchmark
by AngelCampa1 Aug 20, 2026 6/10
skill GitHub

OmniRed: Multi-Agent Offensive Security Skills Library for Red Teams

A skills library for offensive security work that targets Claude, ChatGPT, Gemini, and Copilot from one source. Includes categories specific to AI systems — MCP attack surface, LLM pipeline weaknesses, and AI-native attack patterns — alongside conventional red-team material.

securityred-teamskillsmcp
by sunilgentyala Aug 20, 2026 5/10
skill GitHub

okf-skill: Open Knowledge Format for Source-Linked Markdown Artifacts

An agent skill that produces knowledge artifacts in a defined Markdown format where every claim links back to its source. Intended for evidence bundles, research summaries, and reproducible AI context you can hand to another agent or a human reviewer.

skillsresearchdocumentationprovenance
by israelsaba Aug 20, 2026 5/10
skill Reddit

Precis: Claude Code Skill That Prepares a PR for Human Review

Precis deliberately does not review or judge code — it points at a PR, MR, or raw diff and generates a single self-contained HTML report to orient a human reviewer. Built for teams that delegate the coding to agents but still want a person to genuinely understand what landed.

pull-requestcode-reviewskillshtml-report
by Anaq42 Aug 20, 2026 7/10
skill GitHub

ai-writing-detector-skill: Flag AI Writing Signals in English and PT-BR Copy

An agent skill that reviews prose for formulaic phrasing, punctuation tells, cliches, and flat sentence rhythm, then suggests more human-sounding edits. Works in English and Brazilian Portuguese and is explicit about keeping authorship claims honest rather than promising undetectability.

skillswritingeditingportuguese
by israelsaba Aug 20, 2026 6/10
skill GitHub

html-to-pdf-skill: Provenance-Labelled PDFs From Web Pages via Playwright

Converts authorized public web pages to high-fidelity PDFs using Playwright screenshots, handling consent dialogs and lazy-loaded content. Preserves source URLs and timestamps in the output and deliberately keeps private browser profiles and credentials out of generated artifacts.

skillspdfplaywrightarchiving
by israelsaba Aug 20, 2026 6/10
skill GitHub

text-counter-skill: Exact Character, Word, and Byte Counts for Constrained Copy

An agent skill giving exact character, word, phrase, sentence, paragraph, line, grapheme, and UTF-8 byte counts, with the counting method stated for each. Ships a dependency-free CLI helper so the model verifies constrained copy locally instead of estimating.

skillswritingcliseo
by israelsaba Aug 20, 2026 5/10
skill GitHub

Persona OS: 40 Book-Grounded Product Manager Skills for Claude Code

A drop-in "operating system" for Claude Code that installs a role persona wholesale. The Product Manager OS bundles 40 skills grounded in PM literature, plus commands, memory, and getprompts/getskills helpers for inspecting what is loaded.

skillsproduct-managementpersonacommands
by Sidsaladi9 Aug 20, 2026 6/10
skill GitHub

distributed-systems-skills: Idempotency and Exactly-Once Correctness Skills

Agent skills aimed at production correctness in distributed systems: idempotency, exactly-once effects, failure-mode analysis, and money-movement integrity. Targets the class of bugs that pass tests and surface later under retries or partial failure.

skillsdistributed-systemscorrectnessidempotency
by abhisheksharma2411 Aug 20, 2026 6/10
skill GitHub

openscad-cad-skills: Parametric OpenSCAD Design With Verified Assemblies

Claude Code skills for parametric CAD in OpenSCAD, with machine verification of mechanical compatibility for moving assemblies. Catches interference and fit problems programmatically rather than leaving them to visual inspection.

skillscadopenscadhardware
by Altern92 Aug 20, 2026 6/10
skill GitHub

MAQUINA IA Ad Builder: Skills for AI Video and Image Ads via KIE.ai

A Spanish-language skill pack for Claude Code and Cursor that generates advertising video and imagery through the KIE.ai API, covering Seedance 2.0, Sora 2, Veo 3.1, and Nano Banana. Turns ad creative generation into agent-callable steps.

skillsvideoadvertisingspanish
by itsninoduke Aug 20, 2026 5/10
skill GitHub

dotclaude: Global Claude Code Config Symlinked and Synced Between Machines

One repo holding a global CLAUDE.md, settings, and bash environment, symlinked into place and kept in sync across machines. A concrete reference for anyone tired of hand-copying their Claude Code setup to a new box.

dotfilesconfigurationclaude-mdsync
by danjdewhurst Aug 20, 2026 5/10
skill GitHub

crypto-claude-skills: On-Chain Data Skills for Dune, Nansen, and Solana RPC

Skills for querying on-chain crypto data APIs — Dune, Solscan Pro, Nansen, and Solana RPC via Helius or QuickNode. Credit-aware and batch-optimized so the agent does not burn paid API quota, and exposed cross-agent through AGENTS.md.

skillscryptoon-chainapi
by Vo1ganin Aug 20, 2026 5/10
skill GitHub

securitymaxx: Ten Security Checks With an Evidence-Cited HTML Scorecard

An agent skill running ten security checks against a shipped app, where every PASS must cite a file:line or probe output and anything unverifiable scores zero. That evidence rule is the point — it blocks the usual agent habit of asserting a check passed without looking. Emits a self-contained HTML scorecard and works with Claude Code and Codex.

skillssecurityauditverification
by jtlgrowth Aug 20, 2026 7/10
skill GitHub

vstack: 22 Auto-Firing Skills, 7 Subagents, and a False-Completion Gate

A Claude Code setup where skills trigger themselves via a routing hook rather than waiting to be invoked, backed by 22 skills and 7 subagents. Includes a verification gate that blocks the agent from claiming a task is done when it is not.

skillssubagentshooksverification
by itsvedantkumar Aug 20, 2026 6/10
skill Reddit

Fix Claude-Speak With a Skill Built on Google Developer Style Guide

A simple, well-received trick: have Claude build a skill from the Google Developer Style Guide, then instruct it to communicate only through that skill. The poster reports it eliminated padded three-page responses and stock phrases like "load bearing" across every session.

skillswriting-stylecommunicationprompting
by poster_nutbaggg Aug 20, 2026 6/10
skill GitHub

fw-skills-share: 27 Firewall and Network Security Skills for SRX and Beyond

Twenty-seven agent skills for firewall and network security: Juniper SRX design, NAT, VPN, and MNHA playbooks, Security Director and ClearPass deployment, plus cross-vendor parse, audit, convert, and diff across Cisco, Fortinet, Palo Alto, and SRX. Also maps evidence to PCI, HIPAA, CMMC, CIS, ISO, SOC 2, and DISA STIG.

skillsnetworkingfirewallcompliance
by JNPRAutomate Aug 20, 2026 6/10
skill GitHub

OpenCMO: Growth Playbooks From 17 Operators as an Installable AI Skill

Growth marketing playbooks sourced from operators at Cursor, Notion, Linear, Deel, Gamma, and Granola, packaged as an installable agent skill. Turns marketing practice from those companies into something an agent can execute against.

skillsmarketinggrowthplaybooks
by About-Intelligence Aug 20, 2026 6/10
skill GitHub

browseros-skill: BrowserOS Automation and 40+ SaaS Integrations via MCP

A universal agent skill wiring BrowserOS browser automation plus more than 40 SaaS integrations through a Streamable HTTP MCP endpoint. Works across Claude Code, Antigravity, Gemini CLI, PicoClaw, Nanobot, and Hermes.

skillsbrowser-automationmcpsaas
by psthi Aug 20, 2026 6/10
skill Reddit

What Makes a Claude Code Skill Stick vs Get Abandoned

A survey of popular skill repos and community threads arguing that durable skills constrain agent behavior rather than add capability — Superpowers works because it stops the model charging ahead, not because it teaches anything new. The counterpoint raised is that generic skills produce technically-fine but unusable output because they know nothing about your conventions. Open discussion on whether a skill scoped to one repo is still worth writing.

skillsdiscussionbest-practices
by WhereasOtherwise4697 Aug 19, 2026 6/10
skill GitHub

dbt-navigator: dbt Agent Skills for the Full Development Lifecycle

Agent skills covering the whole dbt lifecycle — orient, decide, build, prove, ship. Conventions are read from a contract file you own, so the guidance reflects your project's standards rather than generic dbt advice.

dbtdataskillsanalytics-engineering
by yshah-1108 Aug 19, 2026 6/10
skill GitHub

closeloop: Corporate Finance Automation Skills for Claude Code

Claude Code skills for month-end close, reconciliation, flux analysis, three-statement integrity checks, and SaaS metrics. Includes NetSuite and BigQuery pipelines, financial artifact generation, and measured token economics. Built to run on a managed Enterprise seat.

financeskillsenterpriseaccounting
by Lukehle Aug 19, 2026 6/10
skill GitHub

procoder: Four-Rung Ship Gate Enforced on Every Claude Code Response

A ship gate for AI-written code that enforces four rungs on every response: SAFE (security at trust boundaries), TRUE (errors handled), OBVIOUS (readable code), and ALONE (nothing stale left behind). Output that has not cleared all four does not ship.

quality-gatecode-reviewsecurity
by azrtydxb Aug 19, 2026 7/10
skill GitHub

danshari.skill: The First Skill That Tells You to Delete Skills

Audits an agent's installed skills and recommends removing what is no longer needed — things the model already knows, capabilities the harness now provides natively, or work an MCP server has taken over. A deliberate counterweight to skill sprawl. Bilingual Chinese and English.

skillsauditcleanup
by swaylq Aug 19, 2026 7/10
skill GitHub

code-agent-board: Two Rival AI CLIs Debate Your Diff Until No Objections

A Claude Code skill that cross-reviews your uncommitted diff with two competing AI CLIs. They argue over the changes until neither has a blocking objection left, which surfaces disagreements a single reviewer would miss.

code-reviewmulti-agentskilldiff
by MazzaWill Aug 19, 2026 7/10
skill GitHub

kaliMaster_skill: 470+ Kali Pentest Tools as a Claude Code Skill

A penetration testing skill built from official kali.org data, covering 470+ tools, 13 domain references and 3 workflow playbooks. Gives the agent structured knowledge of the Kali toolset instead of guessing at flags.

securitypentestkaliskill
by StanleyChanH Aug 19, 2026 7/10
skill GitHub

zuzufang: Multi-Platform Rental Research Skill for Renting in China

An open-format agent skill loadable by Claude Code, Codex or Gemini CLI that answers plain-language rental questions. Collects public reviews across platforms and generates a visual report with maps and links back to the original posts.

researchskillchinareports
by daxueren666 Aug 19, 2026 5/10
skill GitHub

report-skills: Executive Reporting Skill Suite With 20+ Methodologies

A two-skill suite for writing reports aimed at senior stakeholders. Automatically matches the situation to one of 20+ reporting methodologies, then runs six layers of language polish. Works with Claude Code, Cursor, Trae and CodeBuddy.

reportingwritingskillbusiness
by cvk0524 Aug 19, 2026 5/10
skill GitHub

ai-workspace-archive: 11,000+ Skills, 240+ MCP Servers, 2,200+ IDE Rules

A large self-updating local archive of AI tooling: agent skills, MCP servers, Cursor/Cline rules and system prompt collections in one repository. Useful as a reference corpus when you want to see how others wrote a given skill.

archiveskillsmcprules
by HIDORAKAI002 Aug 19, 2026 6/10
skill GitHub

gaia-skill-heaven: Load Agent Skills Like RAM Instead of Storage

A plugin that treats skills as something you summon on demand rather than keep permanently loaded. Two modes let the agent either stay in the loop with you or code freely. Defaults to the Gaia Skill Tree as its source.

skillsplugincontextmanagement
by gaia-research Aug 19, 2026 6/10
skill GitHub

repo-cover: Design a GitHub Social Preview as One Self-Contained HTML File

An agent skill that reads your repo, rewrites the description into one tight line, and writes a 1280x640 self-contained HTML social preview card. Four editorial moods, CJK-first typography, deterministic checks and PNG export via the Chrome you already have — no image model involved.

designopengraphgithubskill
by sjh9714 Aug 19, 2026 7/10
skill GitHub

sloptrim-cn: Chinese AI-Writing Linter That Fixes Only the Lines It Flags

A local linter for Chinese AI-sounding prose, ported from sloptrim with a pattern library rewritten for Chinese internet writing. Only rewrites the sentences it flags, preserving facts and the author's stance instead of flattening the whole piece.

writinglinterchinesestyle
by pakco77 Aug 19, 2026 6/10
skill GitHub

flutter-rules: Explicitly Invoked Flutter Engineering Rules for AI Agents

Flutter engineering rules for Codex, Claude Code, Cursor and Devin covering architecture, BLoC, UI, APIs, navigation, quality, security and Git safety. Invoked explicitly rather than always-on, so they do not eat context on unrelated work.

flutterrulesarchitecturemobile
by aswinsubhash Aug 19, 2026 6/10
skill GitHub

profile-cover: Design Your GitHub Profile README as an Editorial Page

An agent skill that turns a GitHub profile README into an editorial layout with kerned serif mastheads rendered as path-outlined SVGs. Ships light and dark pairs, uses zero external resources, and validates itself with deterministic checks.

designgithubreadmesvg
by sjh9714 Aug 19, 2026 6/10
skill GitHub

delegate-local: Offload Summarisation and Log Triage to Local Models

A Claude Code skill that routes summarisation, log triage and bulk-text work to local models instead of burning API tokens. Keeps content on-device and audits which models your hardware can actually run.

local-llmdelegationtokensprivacy
by IsmaelMartinez Aug 19, 2026 7/10
skill GitHub

video-keyword-breakdown: Transcript to Keyword Timeline and B-Roll List

Converts a talking-head transcript into a tiered keyword timeline, a subtitle plan and a B-roll checklist. Analysis only — it does not render video. Works with Claude Code and Codex CLI on macOS, Linux and Windows.

videotranscriptcontentplanning
by jameswu881102 Aug 19, 2026 5/10
skill GitHub

turk-hukuku-ve-claude: 81 Plugins and 1000+ Skills for Turkish Law

An open-source Claude Code plugin marketplace for Turkish law with 81 plugins and over 1000 skills, covering methodology, citation hygiene, contracts, litigation and legal opinions. Explicitly not legal advice.

legalturkishpluginsskills
by aydincan Aug 19, 2026 6/10
skill GitHub

tui-design-skill: Terminal UI Design Guidance Across Four Languages

A Claude Skill that teaches the agent how to build clean, professional terminal UIs and CLIs rather than leaving layout and interaction choices to guesswork. It covers Bubble Tea (Go), Ratatui (Rust), Textual (Python), and Ink (TypeScript), so the same design conventions carry across whichever stack a project uses. Worth installing if your agent keeps producing functional-but-ugly CLI output.

tuiclidesignbubbletearatatuitextualink
by gfargo Aug 19, 2026 8/10
skill GitHub

Miraiji: GTM, Pricing, and Persona Skill Pack for Claude Code

A skill pack covering go-to-market work — pricing models, customer personas, and launch positioning — for developers who can build a thing but stall at shipping it to users. Extends the gstack skill collection. Narrow in scope, but a rare example of Claude Code skills aimed at the commercial side of a project rather than the code.

gtmpricingmarketingskillspersonas
by Yosei-Lab-ai Aug 19, 2026 5/10
skill GitHub

skill-glm-delegation-with-brief: Hand Mechanical Work to GLM With a 4-Part Brief

A skill that routes mechanical, low-judgment work to GLM after a consultant gate decides the task doesn't need the stronger model, passing a structured four-part brief so the cheaper model has enough context to succeed. Part of a small family of orchestration skills built around that gate. Relevant to anyone doing cost-aware multi-model routing.

multi-modeldelegationglmcost-optimizationskills
by dalsoop Aug 19, 2026 5/10
skill GitHub

skill-multi-model-overconfidence-guard: Budget Caps and Grok Adversarial Review

Guards against a model asserting more confidence than the evidence supports by combining a token budget, an adversarial review pass run through Grok, and prompt scoring. Pairs with an orchestrator-consultant-gate skill that handles the consult decision itself. A concrete implementation of the 'have a second model try to refute it' pattern.

multi-modeladversarial-reviewgrokguardrailsbudget
by dalsoop Aug 19, 2026 5/10
skill GitHub

plant-chemistry-skills: Biodiversity-to-Chemistry Research Skills With Controls

A French-language skill pack connecting plant biodiversity data to chemistry: WCVP name resolution, documented chemistry from LOTUS, GBIF collection effort, and public spectra from ReDU. Its most transferable idea is the set of methodological controls that stop the agent from publishing a false coverage result. A good template for building rigorous domain-science skills.

sciencechemistrybiodiversityresearchskillsdata-validation
by Oshinsu Aug 19, 2026 5/10
skill GitHub

agent-oracle: Decide Agent Count, Topology, and Loop Bounds Before Running

A design skill that makes the agent think through its own orchestration up front — how many subagents, what topology, what loop bounds, and which harness controls — before autonomous work begins. This front-loads the decisions that usually get improvised mid-run and cause runaway fan-out. Useful for anyone building multi-agent workflows.

multi-agentorchestrationdesignsubagentsskills
by AlveeeRahman Aug 19, 2026 7/10
skill GitHub

marroccofella/skills: Cross-Harness Skills With OAuth-Only Multi-LLM Review

A set of Agent Skills written to be portable across harnesses rather than tied to Claude Code, the headline one being multi-LLM peer code review that authenticates via OAuth only — no API keys to provision or leak. Useful if you run more than one agent CLI and want a single skill directory serving all of them.

skillscross-harnesscode-reviewmulti-llmoauth
by marroccofella Aug 19, 2026 6/10
skill GitHub

agent-standard-oss: Keep AGENTS.md and CLAUDE.md Single-Sourced

A small spec plus dependency-free bash tools for teams whose agents keep following stale instructions. It keeps AGENTS.md and CLAUDE.md generated from one source and checks that they stay honest as the project changes. No runtime, no package install — just shell scripts you drop into a repo.

claude-mdagents-mdspecbashconfig-sync
by anmoln7 Aug 18, 2026 6/10
skill GitHub

drug-discovery-agent-skills: Agent Skills for Small-Molecule and Protein Therapeutics

A skill pack covering cheminformatics, molecular ML, docking and molecular dynamics, protein design platforms, and target-discovery knowledge graphs. It gives Claude Code working knowledge of the standard computational drug-discovery toolchain instead of relying on general recall. Aimed at research teams doing therapeutics work inside an agent loop.

skillsdrug-discoverycheminformaticsprotein-designscience
by K-Dense-AI Aug 18, 2026 7/10
skill GitHub

PCMStack agent-skills: Official Skill Collection for the PCM Stack

A published collection of Agent Skills from the PCM stack team, packaged in the standard SKILL.md format. Drop them into Claude Code to give the agent stack-specific expertise without re-explaining conventions each session.

skillscollectionskill-md
by PCMStack Aug 18, 2026 5/10
skill GitHub

title-creation-skill: Five Interpretive Names for Any Image Prompt

A small Agent Skill that reads a text-to-image prompt and returns five short, interpretive title candidates for it. Narrow scope, but a clean example of a single-purpose SKILL.md that does one thing well.

skillnamingtext-to-imagecreative
by aschet Aug 18, 2026 5/10
skill GitHub

saas-builder: 15 Lifecycle Skills for Shipping a Secure SaaS in Claude Code

A Claude Code skill pack covering the full SaaS build: prevention-first security baked into generation rather than bolted on as an audit pass, real Stripe payment integration rather than a product catalog stub, and 15 skills spanning the product lifecycle. Designed to pair with Superpowers and otherwise stand alone.

skillssaassecuritystripepaymentslifecycle
by MartinOlivero Aug 18, 2026 7/10
skill GitHub

engineering-influence-skills: A 14-Phase Content Pipeline as Six Agent Skills

An MIT-licensed Claude Code plugin packaging a 14-phase content pipeline into six Agent Skills, carrying a project from thesis to book, novel, screenplay, AI film, and distribution. Formerly published as content-pipeline-skills. Niche, but a concrete example of chaining long-form creative work through skills.

skillsplugincontent-pipelinewriting
by adammatthewsteinberger Aug 18, 2026 5/10
skill GitHub

sapiens: A Claude Skill for Reading a Codebase You Did Not Write

A skill aimed at onboarding into unfamiliar code, constraining the agent to answers that are short, plain, and complete rather than sprawling summaries. Meant for joining a project mid-flight and getting an accurate picture quickly.

skillonboardingcode-comprehension
by parhamdavari Aug 18, 2026 7/10
skill GitHub

simple-man: A Communication Policy That Cuts Agent Output Tokens by 32%

A measured communication policy for coding agents that strips filler from responses while preserving the substance. The author reports a 32 percent reduction in output tokens with zero lost facts. Useful if agent verbosity is eating your budget.

prompttoken-usageverbositypolicy
by Maksim-Burtsev Aug 18, 2026 6/10
skill GitHub

appstore-ppp-pricing: Adjust App Store Prices to Local Purchasing Power

A Claude Code skill paired with a zero-dependency CLI that rewrites App Store subscription prices per country according to purchasing power parity. Handles the tedious per-territory price matrix that Apple otherwise makes you fill in by hand.

skillapp-storepricingcli
by harryjmg Aug 18, 2026 6/10
skill Reddit

How can I optimize my Context?

Hi everyone, I would like to reduce the size of my context in order to have much better control over my agent and the results from it. How can I do it? Any ideas? ❯ /context ⎿ Context Usage ⛁ ⛁ ⛁ ⛁...

skill
by brunoadam_ Aug 18, 2026 7/10
skill Reddit

Fable on Subscription vs API Billing are two different models

I have 4 Claude accounts all on the Max 20 plan. Over the last 4 weeks I have noticed a slow and steady reduction in quality to the point they are no longer usable. I have a lot of experience in De...

skillapireview
by Appropriate-Fox-2347 Aug 18, 2026 7/10
skill Reddit

Compact and skills FINALLY

They finally added the ability to compact and bring up custom skills on remote control. Does anyone have any idea what took so long? For compacting in particular, it’s something I reach for all the...

skill
by Odd_Antelope9098 Aug 18, 2026 5/10
skill GitHub

humanizer: agent skill that strips AI tells from written text

An agent skill that rewrites text to remove the giveaways of AI-generated writing. Drops into a Claude Code project as a skill so editing passes can be invoked mid-session rather than through a separate tool. One of several humanizer skills in circulation, so worth comparing against alternatives before adopting.

skillwritinghumanizerediting
by blader Aug 18, 2026 6/10
skill GitHub

book-source-creator-skill: Generate and Validate Legado Book Source JSON

A Claude Code skill that generates and verifies book source JSON files for the Legado (阅读) reader app. It handles the schema and validation loop so you do not hand-write and debug the config. Also works with Codex and other agents; niche, but a clean example of a schema-generation skill.

skilljsonlegadovalidation
by Narylr350 Aug 18, 2026 5/10
skill GitHub

Agent Guides Plugin: Walk Skills, Audit Hooks, and a Guide MCP Server

A Claude Code plugin bundling "walk" Skills, walk-observer audit hooks, and an accompanying guide MCP server. The three pieces together let the agent follow a documented procedure while the hooks record whether it actually did. Packaged as one installable plugin rather than loose files.

pluginskillshooksmcpaudit
by agentguides Aug 18, 2026 6/10
skill GitHub

Odin-Skills: Decision Scoring, Roadmap Planning, and Blueprint Decomposition

The skill set behind the Odin agent harness: decision scoring, roadmap planning, blueprint decomposition, mistake-to-gate hardening, and interface polish. Each is a discrete planning-oriented skill rather than a code-writing one. Worth a look if your agent is fine at coding but weak at deciding what to build.

skillsplanningdecision-makingroadmap
by RubyEyedReaper Aug 18, 2026 5/10
skill GitHub

skills-n-stuff: Product Research and Market Intelligence Skills

A collection of Agent Skills covering product research, market intelligence, and content production for AI-native teams. They point Claude Code at business-side work instead of the usual engineering tasks. Handy if you want the same agent handling competitive research and drafting.

skillsresearchmarket-intelligencecontent
by Studio-Moser Aug 18, 2026 5/10
skill GitHub

patent-intel: Plain-Language Patent Research as a Claude Code Skill

A Claude Code skill plus a zero-key CLI for querying patent landscapes, assignee leaderboards, and filing trends in plain language. It returns measured answers backed by real data rather than model recollection. No API key needed to run the CLI.

skillpatentsresearchcli
by kevin9327 Aug 18, 2026 6/10
skill GitHub

travel-buddy: Travel Skill That Verifies Every Fare and Entry Rule

A Claude Code and Codex skill that picks a destination before building an itinerary: it hard-filters candidates, then scores them. Every fare, timetable, and entry rule is checked against a live source rather than recalled from the model. Output is a self-contained booking-ready HTML plan with per-segment maps and a sourced per-person budget, all stored locally.

skilltravelresearchhtml-output
by dong845 Aug 17, 2026 6/10
skill GitHub

agent-skills: 124 Spec-Aligned Specialist Agents for Claude Code

A collection of 124 specialist agents aligned to the Anthropic Agent Skills spec, working across Claude Code, Codex CLI, and Antigravity CLI. Coverage spans development, security, design, testing, FinOps, compliance, observability, and AI/ML. Agents are wired for hub-and-spoke orchestration through a Nexus dispatcher rather than being invoked one at a time.

skillssubagentsorchestrationcollection
by simota Aug 17, 2026 7/10
skill GitHub

karman: Paired Skills for Test Generation and Pre-Deploy Smoke Gating

Two Agent Skills built around a launch-line metaphor: one generates the test cases that prove a change is ready, including mutation self-checks, and the other runs a pre-deploy smoke test and blocks deployment when it fails. Browser capability is detected automatically with four levels of graceful degradation. Documentation is in Chinese.

skilltestingsmoke-testdeployment
by ai798-Lab Aug 17, 2026 5/10
skill GitHub

skills: Documentation, Fleet Orchestration and Parallel Execution Skills

A set of Agent Skills covering documentation generation, fleet orchestration, and parallel task execution. It targets a broad compatibility surface — Claude Code, Cursor, Copilot, Gemini CLI, Codex, and 25 or more other agents. Useful if you want orchestration primitives that are not locked to one vendor.

skillsorchestrationdocumentationcross-tool
by quickcall-dev Aug 17, 2026 6/10
skill GitHub

honey-for-devs: Cross-Tool Skill That Cuts Agent Token Usage by 53%

A coding skill that reduces token usage by pushing the agent to write less code, less prose, and denser agent-to-agent handoffs. The authors report a 53% reduction that was lossless in their benchmarks. It works across Claude Code, Cursor, GitHub Copilot, Codex, Gemini CLI, Windsurf, Cline, and Kiro.

skilltokenscostcross-tool
by Green-PT Aug 17, 2026 7/10
skill GitHub

frontend-design-workflow: Stop AI Sites From Looking Generic

A frontend and web design skill that walks an agent from research through art direction, architecture, and design tokens to a verified build. The target problem is the sameness of AI-generated interfaces, which it attacks by forcing explicit art direction before any code. Works with AI coding agents generally, not just Claude Code.

skillfrontenddesignart-direction
by AviOfLagos Aug 17, 2026 7/10
skill GitHub

apple-design-skill: Apple HIG and Design System Skill for Agents

Packages the Apple Human Interface Guidelines and Apple Design System into a skill any AI coding agent can load. Supports Claude Code, Cursor, Copilot, Antigravity, and Windsurf. Gives the agent concrete platform conventions instead of a generic idea of what an Apple app looks like.

skilldesignapplehig
by billythekidz Aug 17, 2026 7/10
skill GitHub

requirement-zero: Skills That Challenge Whether Code Should Exist

Two Agent Skills that push back before work starts: Requirement Zero challenges whether a requirement should be built at all, and Codebase Zero audits whether existing code still deserves to exist. Both are Markdown-only with no runtime dependencies. The repo publishes its evaluation runs so you can judge the skills before installing them.

skillrequirementsauditcode-review
by Chisanan232 Aug 17, 2026 7/10
skill GitHub

SkillArtisan: Hardened Replacement for Anthropic's skill-creator

A plugin for building, validating, securing, and maintaining Claude Skills that positions itself as superseding the shipped skill-creator. It emphasizes spec compliance and security-hardened tooling rather than just scaffolding a directory. Relevant if you author skills often enough that correctness of the skill itself matters.

skilltoolingvalidationsecurity
by EONRaider Aug 17, 2026 8/10
skill GitHub

open_contribute: Skills That Take You From Idea to a Merged OSS PR

Agent Skills that carry you from "I want to contribute to open source" through to a submitted pull request. The distinguishing piece is that it measures whether a repo actually merges outside PRs before recommending you spend effort there. Avoids the common failure of contributing to projects that never merge external work.

skillopen-sourcepull-requestcontribution
by chjnett Aug 17, 2026 7/10
skill GitHub

desktop-folder-organizer: Reversible, Approval-Gated Folder Cleanup

An Agent Skill for organizing local folders where every action is reversible and gated behind explicit approval. It works with Codex, Claude Code, and Google Antigravity. The safety framing is the point — letting an agent move your files is otherwise hard to undo.

skillfilessafetyautomation
by Evan645test Aug 17, 2026 5/10
skill GitHub

claude-auto-dev: Autonomous Task Loops, Testing and Deploy Skills

A set of Claude Code skills for autonomous development: task loops, testing, and deployment automation. It targets the case where you want the agent to keep working through a queue rather than stopping after each step. Fairly broad in scope, so expect to tune it to your project.

skillautomationtestingdeployment
by djnsty23 Aug 17, 2026 5/10
skill Reddit

zero-tech-debt: A Skill That Makes Agents Delete Legacy Code, Not Patch It

A short, fully published skill file that reworks a change as if the intended UX and architecture had existed from day one, deleting compatibility cruft and accidental complexity. It counters the agent default of patching instead of redesigning, keeping dead "for compatibility" code, and duplicating logic across files. The author runs it right after fixing a bug or shipping a feature, while the agent still has full context.

skillrefactoringtech-debtclaude-md
by Electrical_Pea_943 Aug 17, 2026 7/10
skill GitHub

marketing-council-pack: 12-Role Marketing Council as a Skill Pack

A portable marketing strategy skill pack with 12 council roles and 13 focused skills, plus evidence challenge gates that force claims to be backed. It also includes deterministic utilities so the numeric parts do not depend on model recall. An example of a domain skill pack structured as a debate among roles rather than one prompt.

skillmarketingstrategyskill-pack
by imMamdouhaboammar Aug 17, 2026 5/10
skill GitHub

systemic: Claude Code Skill That Audits Your Lifecycles as Systems

A Claude Code skill that treats your code lifecycles as systems and looks for structural faults: states the code can reach but cannot represent, operators that have no inverse, and rules the README declares that the code breaks. This is a different lens from ordinary code review, which mostly checks lines rather than reachable states. Good fit for state machines and long-lived entities.

skillauditstate-machinesarchitecture
by gdavidpb Aug 17, 2026 7/10
skill GitHub

le-cabinet: French Accounting and Legal Skills With Sourced Figures

Two AI skills for French law — an accountant and a lawyer — covering both business and personal matters. The design rule is that no figure is ever written from memory: everything is sourced and dated. A useful pattern for any domain skill where stale numbers are worse than no numbers.

skilllegalaccountingfrench
by Sjrazaviebra Aug 17, 2026 5/10
skill GitHub

frontend-production-engineer: Next.js Skill With Blocking Gates

A frontend Agent Skill for planning, building, and reviewing production Next.js and TypeScript frontends against a typed Django/DRF backend contract. Accessibility, security, and performance checks are blocking gates rather than advisory notes. Opinionated about the stack, which is what makes the gates concrete.

skillfrontendnextjsaccessibilitydjango
by n-shadloo Aug 17, 2026 6/10
skill GitHub

h3-game-sprites: Turn AI-Generated Video Into 2D Game Sprite Sheets

An Agent Skill that converts AI-generated video into 2D game sprite sheets, using the Mortal Kombat approach of filming an actor — here MiniMax H3 plays the actor. It bridges video generation and usable game assets, which normally requires manual frame extraction. Novel enough to be worth a look even outside game development.

skillgamedevspritesvideo
by gary149 Aug 17, 2026 6/10
skill Reddit

Stopping Claude From Documenting Diffs Instead of Current State

Both Opus 5 and Sonnet 5 tend to document what changed rather than what the code now is, which rots instantly on a fast-moving codebase. The author addresses it with a CLAUDE.md section banning version-comparison framing — "used to", "no longer", "previously", "before this change", "renamed from" — and requiring present-state description in markdown, docstrings, code comments, and test docstrings alike. A concrete, copyable convention for anyone with the same complaint.

claude-mddocumentationpromptingconventions
by Stonemanner Aug 17, 2026 7/10
skill Reddit

Where to Put a Package-Level Build Rule Claude Code Will Read

A pnpm workspace case where a schema package generates a file a worker imports, but the root test command never rebuilds the schema — so the broken import only shows up in one specific command pair. Since the rule belongs to the package rather than to one person workflow, the author puts the two commands in a package-level CLAUDE.md next to the reason. A small but useful pattern for scoping instructions in a monorepo.

claude-mdmonorepopnpmconventions
by Aggravating-Dot4839 Aug 17, 2026 5/10
skill GitHub

handoff-readiness: State-Coverage QA Gate for Ecommerce Design Files

A Claude Code skill that acts as a pre-handoff QA gate on ecommerce design files, checking state coverage for product detail pages, cart, and checkout. It catches the states designers routinely omit — empty, error, loading — before files reach engineering. Narrow in scope but a clear example of a skill as a review gate.

skillqadesignecommerce
by llizell Aug 17, 2026 5/10
skill GitHub

whichskill: Skill Router That Returns a Settled Chain, Not a List of Guesses

A router for setups with too many installed agent skills, built to answer "which skill applies here" deterministically. Instead of returning a list of plausible skill names for the model to pick from, it returns an ordered chain with the arbitration between overlapping skills already resolved. Worth a look if skill collisions and inconsistent skill selection have become a problem in your setup.

skillsrouterskill-selectionarbitration
by whichskill Aug 16, 2026 7/10
skill GitHub

qa-digest: Claude Code Skill That Transcribes and Keyframes Local Video

A Claude Code skill that lets the model actually digest a local video file by transcribing its audio and exporting keyframes for reading. That turns an opaque media file into text and images the model can reason over, without any external video-understanding service. Handy for reviewing screen recordings, QA captures, and demo footage in-session.

skillvideotranscriptionkeyframesmultimodalqa
by ShreddyKrueger75 Aug 16, 2026 7/10
skill GitHub

identidad-personal: Claude Code Skill for Building a Personal Brand Manual

A skill that walks you through producing your own personal brand identity manual, covering positioning, voice, and visual guidelines. Works in both Spanish and English. Aimed at people who want a structured interview-style process rather than a blank document.

brandingskillspanishbilingualwriting
by Carlos-Padilla-Bravo Aug 16, 2026 5/10
skill GitHub

slop-writer: Telegram Channel Analytics and Post Scheduling Skill

A Claude Code skill that scrapes a Telegram channel into SQLite, then answers analytics questions over that local database and schedules future posts. Turns channel history into something you can query conversationally instead of scrolling. Useful pattern for anyone wanting agent-driven analytics over a social feed.

telegramsqliteanalyticsschedulingskill
by Lancetnik Aug 16, 2026 6/10
skill GitHub

skills-rssi-fr: Skill Pack for French CISO Work (EBIOS RM, Compliance)

A set of skills covering the day-to-day of a French RSSI/CISO: asset mapping, EBIOS RM risk analysis, compliance work, and review of deliverables. Design constraints are explicit — sources are mandated, facts are kept separate from claims, and the final decision stays with a human. A good example of a domain skill pack with built-in epistemic guardrails.

securitycomplianceebios-rmfrenchciso
by maogouste Aug 16, 2026 5/10
skill GitHub

excel-para-word: Skill Turning an Excel File Into a Word Report With Charts

A Claude Code skill that reads an Excel workbook and produces a Word report containing charts plus a factual written description of each one. Documentation is in Portuguese. Handy for recurring reporting work where the analysis is routine but the formatting is tedious.

excelwordreportingchartsportuguese
by Vascobranco2509 Aug 16, 2026 5/10
skill GitHub

clinical-assistant: Clinical Reasoning Skill With Citation and Retraction Checks

A Claude Agent Skill for differential diagnosis, GRADE evidence appraisal, a 13-perspective clinical board review, and treatment planning. Every citation is resolved and checked for retraction, and output carries calibrated confidence with a traceable chain. Bilingual EN/ES and explicitly scoped to decision-support drafts, never a diagnosis.

clinicalmedicalevidencecitationsbilingual
by makidav Aug 16, 2026 7/10
skill GitHub

anything-to-skill: Turn a PDF, EPUB, or Slide Deck Into an Agent Skill

A CLI and companion skill that reads whole books and documents, then writes a SKILL.md targeting Claude Code, Codex, Gemini CLI, Cursor, or opencode. Handles PDF, EPUB, DOCX, and slide decks. A practical answer to having reference material you want an agent to internalize rather than re-read every session.

skillspdfepubdocumentscross-tool
by asale-ai Aug 16, 2026 8/10
skill Reddit

Three MIT Agent Skills That Stop Rather Than Fake a Result

Three open-source skills covering backend setup, security hardening, and frontend/UI, installable with npx skills add. The stated rule is no fake credentials, placeholder content, or 'fixed' reports: if the skill cannot do something for real it stops. MIT licensed.

skillmitsecuritybackend
by MonitorFlat4465 Aug 15, 2026 5/10
skill GitHub

sbox-skill: Source-Verified s&box API Reference Plus an Editor MCP Toolset

A Claude Code skill bundling 16 source-verified reference files for the s&box game engine API, alongside an 11-tool MCP toolset for driving the editor. The stated goal is to stop agents from writing Unity-style code into Source 2 projects. Niche, but a good template for pinning an agent to one engine's real API.

skillmcpgamedevsbox
by fobiat Aug 15, 2026 5/10
skill GitHub

skill-stocktake: Audit Installed Skills for Staleness, Conflicts, Redundancy

A Claude Code skill that inspects your other installed skills and reports which ones are stale, overlapping, or contradicting each other. Useful once a skills directory grows past the point where you remember what is in it. Addresses a maintenance problem most skill collections ignore.

skillauditmaintenancemeta
by shimo4228 Aug 15, 2026 7/10
skill GitHub

ai-coworker-skills: Nine Skills Targeting Common AI Coworker Failure Modes

A set of nine ready-to-use Agent Skills addressing recurring agent behaviors: claiming false completion, deflecting blame, over-engineering small tasks, and writing documentation nobody can read. Bilingual Chinese/English. Behavioral corrections rather than new capabilities.

skillbehaviorqualitychinese
by zhaiby-web Aug 15, 2026 6/10
skill GitHub

easyen: Flag the Exact Words Making Your AI's English Unreadable

An agent skill plus CLI that measures vocabulary level and sentence length, then points at the specific words and sentences to fix. Zero dependencies. Useful against the dense, abstract prose recent models tend to produce.

skillwritingreadabilitycli
by zhangxiangliang Aug 15, 2026 5/10
skill GitHub

ai-coding-ironrules: An 11-Rule Operational CLAUDE.md Template

A reusable CLAUDE.md template of 11 operational rules meant to carry across projects. Written in Chinese and focused on hard constraints rather than style guidance. Worth skimming if you are still tuning your own baseline instructions.

claude-mdtemplateruleschinese
by evan966890 Aug 15, 2026 5/10
skill GitHub

skills-library: A Guided Interview That Recommends Skills for Your Repo

A Claude Code skill that interviews you about your repo or team and recommends which AI skills to install, then installs them in one prompt. Aimed at the discovery problem now that skill collections number in the thousands. Complements audit tools like skill-stocktake.

skilldiscoveryrecommendationonboarding
by lindblomstefan Aug 15, 2026 5/10
skill GitHub

claude-site-skills: Studio-Grade Website Build Skills for Claude Code

A Russian-language set of Claude Code skills covering orchestration, motion, quality, and SEO for building websites. Splits the work into distinct specialist roles rather than one generic build prompt. Useful reference even if you do not read Russian.

skillweb-designseorussian
by Yelpin Aug 15, 2026 5/10
skill GitHub

market-context-kit: Marketing Skills With B2B and Regulated Playbooks

Context-aware marketing skills for Claude Code, with separate playbooks for B2B, industrial, regulated, and consumer markets. The segmentation matters because generic marketing prompts produce generic copy. Handy for solo builders doing their own go-to-market.

skillmarketingplaybooksb2b
by marcus-at-localhost Aug 15, 2026 5/10
skill GitHub

skills-as-systems: Evidence-Led Skills for Web Design and Engineering

Portable Agent Skills covering web experience design and software engineering, written to cite evidence rather than assert preferences. Works across Agent-Skills-compatible tools. Worth a look if you want design guidance your agent can justify.

skilldesignengineeringportable
by makiaveli1 Aug 15, 2026 5/10
skill GitHub

code-loop: Expert-Minimal Discipline for Coding Agents

Pushes agents toward the best real result with the least code, fewest tokens, and lowest risk. A counterweight to agents that answer a small request with a large refactor. Fits alongside rules that constrain scope creep.

skilldisciplineminimalismtokens
by tuamah Aug 15, 2026 5/10
skill GitHub

compensate-skill: A Skill That Reads Before It Overwrites Your Work

A Claude Code skill enforcing a read-before-write discipline, and when the agent does clobber something it pays the debt back in work rather than apologies. Targets the destructive-overwrite failure mode directly. Small in scope but addresses a genuinely costly behavior.

skillsafetyoverwritediscipline
by OFFERSHAHAR Aug 15, 2026 5/10
skill GitHub

go-turbo: A Go Performance Mode for AI Coding Agents

Puts coding agents into a Go performance mindset, steering generated code toward faster idioms. Language-specific tuning of agent behavior rather than general guidance. Relevant if your agent writes correct but slow Go.

skillgolangperformanceoptimization
by hendriknielaender Aug 15, 2026 5/10
skill GitHub

beads-skill: A Version-Pinned Agent Skill for the beads Issue Tracker

A comprehensive skill for beads (bd), the Dolt-backed dependency-aware issue tracker built for AI coding agents. Version-pinned, so the skill will not drift out of sync with the tool. Good example of pinning a skill to a specific tool release.

skillissue-trackerbeadsversion-pinned
by mikezupper Aug 15, 2026 6/10
skill Reddit

House Rules Beats STRICT RULES: A CLAUDE.md Framing That Holds Up

A reported finding that renaming a CLAUDE.md section from 'STRICT RULES - MUST FOLLOW' with NEVER/ALWAYS caps to a conversational 'House rules' list improved adherence deep into long sessions. The author's take is that shouted constraints drift once context fills, while normal prose does not read as noise. Anecdotal but cheap to test on your own config.

claude-mdpromptingrulescontext
by Necessary_Abroad6632 Aug 15, 2026 6/10
skill GitHub

okf-author: Author and Validate Open Knowledge Format Markdown

A cross-agent skill for Claude Code and Codex that authors, converts, and validates Markdown in Open Knowledge Format. Validation is the useful half, catching format drift before it spreads. Relevant if you maintain structured knowledge bases agents read from.

skillmarkdownvalidationknowledge
by parkscloud Aug 15, 2026 5/10
skill GitHub

agents-party: A /party Skill Letting Agent Sessions Talk to Each Other

An open-standard skill plus CLI that lets Claude Code, Cursor, Codex, and other agent sessions communicate, on one machine or across machines. Turns separate sessions into something closer to a group. The open-standard framing is what makes it interesting beyond a single-vendor hack.

skillinter-agentcommunicationcli
by 1gr14 Aug 15, 2026 6/10
skill GitHub

SKILLS: A Daily-Updated Index of 1,600+ Agent Skill Sources

A daily-refreshed index of over 1,600 GitHub skill sources ranked by stars, with verified SKILL.md files and 40 directly installable skills for Codex and Claude Code. The verification step separates it from a plain awesome-list. A reasonable first stop when hunting for an existing skill.

skillindexdirectorydiscovery
by userInner Aug 15, 2026 6/10
skill GitHub

murderbot: An Output Style That Acts First and Verifies Before Asserting

A Claude Code output style borrowing two habits from Martha Wells' SecUnit: no scope creep, and verify before you assert. Delivers action first with no ceremony in a dry voice. The personality is the hook, but the two constraints are the substance.

output-styleverificationscopepersonality
by stepnovmi Aug 15, 2026 6/10
skill Reddit

failure-ux: An Agent Skill for Writing Error Messages Worth Reading

Reviews error messages, toasts, alerts, 404s, offline screens, empty states, and permission errors against five questions: clarity, reassurance, empathy, action, and escape route. Built because agents default to 'Something went wrong' and move on. A concrete rubric rather than vague guidance about tone.

skilluxerror-handlingcopy
by Nervous_Comparison84 Aug 15, 2026 7/10
skill GitHub

maxgfr/skills: Process Skills That Change How the Agent Works

A personal set of process-oriented skills, installable with npx skills add or as a Claude Code plugin. Focuses on changing agent working method rather than adding domain knowledge. The dual install path makes them easy to try.

skillprocesspluginnpx
by maxgfr Aug 15, 2026 5/10
skill GitHub

embedded-iot-mentor: MCU Selection, Cost Estimates, and MVP Build Plans

A Claude Code skill, API, and MCP server acting as a mentor for embedded and IoT hardware projects, covering MCU selection, cost and time estimates, MVP-first build plans, and PCB transition guidance. Hardware domain knowledge is thin on the ground in agent skills. Useful if your software agent has to reason about physical constraints.

skillembeddediothardware
by mh-mansouri Aug 15, 2026 5/10
skill GitHub

spec-architect: Turn a Rough Idea Into a Buildable Technical Spec

Spec-first skills for Claude Code that refine a vague idea into a technical specification precise enough to implement from. Front-loads the ambiguity instead of discovering it mid-build. A lighter alternative to full spec-driven frameworks.

skillspecsplanningspec-first
by DahanItamar Aug 15, 2026 6/10
skill GitHub

ghidra-iterative-re: A Claude Code Skill for Iterative Reverse Engineering

Drives iterative reverse engineering sessions in Ghidra from Claude Code. Reverse engineering suits agents well because it is repetitive analysis over a large binary. One of the few security-research skills in this space.

skillreverse-engineeringghidrasecurity
by GeReV Aug 15, 2026 7/10
skill GitHub

nifi-and-ai: Claude Skill for Building and Debugging Apache NiFi 2.x Flows

A Claude Code skill for working with Apache NiFi 2.x, MiNiFi, and EFM data flows. Covers building, deploying, and debugging flows rather than only generating config snippets. Niche, but a clean example of packaging domain-specific ops knowledge as a skill.

nifidata-engineeringdevopsskill
by cldr-steven-matison Aug 15, 2026 6/10
skill GitHub

design-taste: 24 Agent Skills That Encode Visual Taste as Instructions

Twenty-four open-source agent skills that translate design taste into explicit instructions, organized as ten genre identities. Each identity ships a before/after demo built from the same brief, so you can see exactly what the skill changes. A concrete answer to the complaint that agent-generated UI all looks the same.

designuiskillsfrontend
by madebymustafa Aug 15, 2026 7/10
skill GitHub

test-audit: Skill Giving a Plain-Language Ship or Don't-Ship Verdict

A /test-audit slash command that reviews the tests covering AI-written code and returns a verdict in plain language instead of a coverage percentage. Aimed at people shipping code they did not hand-write and cannot easily judge. Low ceremony: one command, one answer.

testingslash-commandcode-qualityvibe-coding
by gtskevin Aug 15, 2026 6/10
skill GitHub

dotagents: Portable Skills, Commands, and Templates for Agent Harnesses

A personal collection of agent skills, slash commands, design examples, and project templates written to work with Claude Code and most other harnesses. Useful as a reference for structuring your own dotfiles-style agent config. Note that two unrelated projects also use the dotagents name.

skillscommandstemplatesdotfiles
by thefilesareinthecomputer Aug 15, 2026 6/10
skill Reddit

Use a Claude Code Skill Without Installing It — Just Hand Over the Path

Claude Code auto-loads skills only from ~/.claude/skills/, which breaks when shared skills live in ~/.agents/skills/ for other agents. Rather than copying, symlinking, or running an rsync daemon to keep both in sync, the post notes that a skill is just a folder with a SKILL.md — so you can tell Claude to read it at its absolute path mid-conversation. Avoids duplicate copies and the ambiguity of which one actually loads.

skillstechniqueno-installmulti-agent
by Annual_Variation_916 Aug 15, 2026 6/10
skill GitHub

walk-route-3d: Skill Generating Walkable 3D Tokyo Routes as Standalone HTML

A skill that takes a start and end point and generates a self-contained HTML file letting you walk the route across Tokyo's PLATEAU 3D city model. No routing API and no tile server needed — everything ships inside the one file. Documentation is in Japanese; a strong demo of how much a single skill can carry.

3dmapshtmlplateaujapanese
by kofujimura Aug 15, 2026 6/10
skill GitHub

polish-open-source-prose: Edit OSS Docs Without Losing Facts or Voice

An agent skill for Claude Code and Codex that copy-edits open-source prose — READMEs, docs, announcements — under the constraint of preserving factual claims and the author's voice. Includes zh-Hant-TW support. Targets the common failure where an LLM rewrite flattens tone and quietly changes facts.

documentationwritingreadmei18n
by ting-hong-shieh Aug 15, 2026 6/10
skill Reddit

Three Escalating Fixes for Opus 5's Verbose Output

Ranked remedies for over-long Claude Code replies, from weakest to strongest. The key insight is that abstract instructions like 'be concise' barely register, while rules that specify output shape do: lead with the answer, carry multi-item results in tables or bullets, cap unbroken prose at two paragraphs. Output styles beat CLAUDE.md because they modify the system prompt directly instead of riding in as a user message.

claude-mdoutput-styleverbositypromptingopus-5
by cleverhoods Aug 14, 2026 7/10
skill GitHub

question-surface: Answer All of an Agent's Questions on One Screen

When an agent has eight clarifying questions, it normally asks them one at a time across a long chat. This renders them together in a local, dependency-free web form with the tradeoffs shown next to each choice, so you answer once with full context. Includes a Claude Code skill for wiring it in.

clarificationuxformsskill
by avanrossum Aug 14, 2026 7/10
skill Reddit

/retro: Single-File Skill That Compounds Session Lessons Into Rules

A dependency-free SKILL.md run at the end of every session. It demands an honest review citing specific corrections from the actual conversation, then routes at most three lessons by type: context gaps go to the memory file, recurring procedures become skills, and hard always/never constraints become rule files or deterministic hooks. The routing is the point, since enforcement beats instructions.

retrospectiveskillruleshookslearning
by Anti17 Aug 14, 2026 7/10
skill GitHub

anchor: Project Memory That Only Records What It Can Prove

Addresses Claude Code rebuilding code that already exists and retrying approaches that already failed. Anchor writes down only claims it can verify, drops a note the moment the code it describes changes, and retires instruction files superseded by newer ones. The self-invalidation is what separates it from a memory file that quietly rots into misinformation.

memorycontextsession-continuitystaleness
by alrox360 Aug 14, 2026 7/10
skill GitHub

goshipit: 188-Check Pre-Deploy Audit Skill for Claude Code

Runs a codebase audit before every deploy across 14 categories: leaked secrets, XSS, SQL injection, rate limiting, test coverage, bundle size, WCAG accessibility, SEO, Stripe webhooks, and GDPR among them. Works entirely from source, so no staging URL is needed. A reasonable last gate for solo developers shipping without a review process.

securityauditpre-deployaccessibilityskill
by Capta1nRaj Aug 14, 2026 7/10
skill GitHub

project-change-router-skill: Routes Changes to the Right Module in Big Repos

A skill for Claude Code and Codex that governs where a change should land in a large full-stack codebase. It helps the agent find the correct capability boundary, avoid re-implementing something that already exists, and respect write constraints on protected areas. Useful if your agent keeps creating duplicate helpers instead of extending existing ones.

skillmonorepocode-reusecodexgovernance
by WeirdSky924 Aug 14, 2026 6/10
skill GitHub

pm-skills: 68 Product Management Skills With Sub-Agents and Workflows

A large plug-and-play skill pack covering product management: 30 Triple Diamond phase skills, 11 foundation, 12 utility, and 15 tool skills including Foundation Sprint and Design Sprint. Ships with 6 sub-agents, workflows, 200+ sample outputs, and CI-enforced contracts so the skills stay consistent. Apache 2.0.

skillproduct-managementsubagentsworkflowapache-2.0
by product-on-purpose Aug 14, 2026 7/10
skill GitHub

agent-kit: Shared Safety-Conscious Resources for Codex and Claude Code

A collection of reusable agent resources meant to be shared across both Codex and Claude Code, with an emphasis on safety-conscious defaults. Useful as a starting point if you work in both tools and want one set of conventions instead of two. Generic in scope — worth a skim rather than a wholesale adoption.

skillcodexsafetyshared-configportable
by kimgea Aug 14, 2026 5/10
skill GitHub

no-misread: Lints Prompts for Ambiguity and Output for AI Tells

A linter and Claude skill that works on the text on both sides of the model. On input it flags the ambiguity a model will quietly guess its way through; on output it catches invisible watermark characters, machine rhythm, and other AI tells. Supports English and Chinese.

skilllinterprompt-engineeringwritingwatermark
by ryvn-dev Aug 14, 2026 7/10
skill GitHub

evidence-based-copywriting: Marketing Copy Gated on Fetched Sources

A copywriting workflow that requires every factual claim in marketing copy to be traced back to a fetched source before publishing, with adversarial checks to catch unsupported statements. Aimed at teams who want agent-written copy that will not invent specs, numbers, or customer results.

copywritingmarketingverificationfact-checkingskill
by mucinous-riposte867 Aug 14, 2026 6/10
skill GitHub

ai-drama-pipeline: Four Claude Code Skills for AI Short-Drama Production

A Korean-language bundle of four Claude Code skills covering the whole AI short-drama pipeline: script, per-cut prompts, video generation, then QC and assembly. Distributed through the Hamlog marketplace. Worth a look as a template for chaining several skills across a multi-stage creative workflow.

skillvideopipelinekorean
by uyuni0217sh-design Aug 14, 2026 5/10
skill GitHub

ultimate-viral-writer: Viral-Copy Skill With Industrialized Headline Tests

A Chinese-language writing skill that packages influencer strategy, natural-sounding phrasing, and systematic headline A/B testing into one Claude Code skill. Aimed at content creators rather than developers. A concrete example of encoding an editorial methodology as a skill.

skillwritingcontentchinese
by tanchunzhuo Aug 14, 2026 5/10
skill GitHub

using-lwc: Source-Grounded Project Memory Skill Built on a Document Graph

A memory skill for AI agents that grounds recall in actual sources via an LWC Wiki, document graphs, and CodeGraph. The goal is durable project memory that does not drift from the code. Pairs with the author's llm-wiki-cli for the CLI side.

skillmemoryknowledge-graphcontext
by JanYork Aug 14, 2026 6/10
skill Reddit

What I Learned Writing 15 Claude Code Skills, Including What I Got Wrong

A practitioner writeup on skill authoring after building fifteen of them. Key findings: the description field does nearly all the triggering work, vague descriptions never fire, and happy-path instructions in the body are wasted since the model would do that anyway. Includes the mistakes the author had to unlearn.

skillauthoringlessonsreddit
by Wilddocofficial Aug 14, 2026 8/10
skill GitHub

funbox-plugins: A Claude Code Marketplace of Independently Versioned Plugins

A small but growing Claude Code plugin marketplace where each plugin is self-contained and versioned on its own. Install only what you need rather than a monolithic bundle. Good example of the modular end of the marketplace spectrum.

marketplacepluginsskillsmodular
by nthansen Aug 14, 2026 6/10
skill GitHub

claude-global-skills: Machine-Wide Skills for Review Loops and Session Resume

A curated skill collection covering a code-review loop, local chat-history search, session end and resume, Gemini image generation, and transcript retrospectives. Everything runs machine-wide with only Python and Node as prerequisites. A solid starting set if you are building a personal skill library.

skillscode-reviewsessionscollection
by BryceEWatson Aug 14, 2026 7/10
skill GitHub

plainspeak: Plain-Language Mode for Non-Developers Using Claude Code

Puts Claude Code into plain-language mode so people without a dev background can still ship real products. Strips jargon out of explanations and prompts. Aimed squarely at the vibe-coding crowd.

skillaccessibilityplain-languagebeginners
by mkt-henry Aug 14, 2026 6/10
skill GitHub

writing-skills: Plain Language, GOV.UK, AP Style, and STE-100 as Skills

Turns official writing frameworks (plain language, business writing, GOV.UK, AP style, STE-100, developer docs) into procedural agent skills, plus a set of character voices. Ships as Agent Plugins 1.0.0 and works in opencode, Claude Code, and Codex. Better than pasting a style guide into every prompt.

skillwritingstyle-guidedocs
by surendranb Aug 14, 2026 6/10
skill GitHub

evidence-research-report: Research Skill With Deterministic Citation Checks

An evidence-first research-report skill for Claude Code and Codex that works under a bounded search budget and verifies citations deterministically. Stops the agent from spending unbounded time searching or fabricating sources. Good fit for reports that need to survive scrutiny.

skillresearchcitationsevidence
by royalskynet Aug 14, 2026 6/10
skill GitHub

specback: Multi-Agent Reverse Spec Generator That Turns Code Into Specs

Runs code through a multi-agent pass to reconstruct the specification it implements. Works with Claude Code, Codex, OpenCode, Copilot, and Cursor. Useful for inherited codebases where no written spec ever existed.

skillspecreverse-engineeringmulti-agent
by nekolife1984 Aug 14, 2026 6/10
skill GitHub

shiarauzo/skills: Packaged Workflows You Stop Re-Explaining to Claude Code

Agent skills built from the workflows the author ran often enough that re-explaining them became the bottleneck. That origin story is the strongest signal for which workflows are worth packaging. A practical reference for choosing what to turn into a skill.

skillsworkflowautomationcollection
by shiarauzo Aug 14, 2026 5/10
skill GitHub

claude-chart-dashboard: Turn Any Data Into an Offline HTML Dashboard

A Claude Agent Skill that converts any dataset into a self-contained HTML dashboard or report with interactive SVG charts. Zero dependencies and works offline, so the output is a single shareable file. Ships as a Claude Code plugin.

skilldashboardchartsvisualization
by raghuramsirigiri Aug 14, 2026 7/10
skill GitHub

WorkbuddySkillGroups4DSH: 44 Expert-Team Skill Bundles Ported to DSH

Repackages the WorkBuddy expert-team skills as a DeepSeek Harness plugin: 44 multi-role SKILL.md bundles installable to ~/.dsh/skills with Cordis plugin registration. Shows how a Claude-style skill collection ports to another harness. Bilingual documentation.

skillsdshportmulti-role
by darker2016 Aug 14, 2026 5/10
skill GitHub

awesome-agent-harness: Curated Skill List Spanning Seven Coding Agents

A curated list of useful Agent Skills for Claude Code, Codex, Gemini CLI, OpenClaw, Hermes, and other agents. Useful as a discovery index rather than something you install. Handy when you want to see what already exists before writing your own.

awesome-listskillsdiscoverycurated
by zients Aug 14, 2026 6/10
skill GitHub

dev-skills: Laravel Standards Packaged as AI Coding Skills

AI skills that encode Laravel conventions and standards so agents write framework-idiomatic code. Narrow by design. Useful template if you want to do the same for another framework.

skilllaravelphpstandards
by jotafurtado Aug 14, 2026 5/10
skill GitHub

report-helper: One Sentence In, a Full Research Report PDF Out

A research and writing assistant for long-form deep research reports that runs the whole pipeline from a single prompt and emits a formatted PDF. Chinese-language. Useful if your deliverable is a document rather than code.

skillresearchpdfchinese
by Jiaranbb Aug 14, 2026 5/10
skill Reddit

ui-ideation-lab: A Lazy Senior Designer Mode That Cuts 6x Less Bloat

Two Claude Code skills in one: redesign-studio produces three or four distinct design directions, and impeccable checks each output against real design standards. Both ask whether the pattern already exists or a native element would do before generating anything. Outputs HTML files, a compare page, and notes -- an ideation tool, not a production pipeline.

skilldesignuiideation
by for_blues_ Aug 14, 2026 7/10
skill GitHub

threadwave-skill: Review-Gated Bilingual X Automation Skills

A bilingual skill suite for Twitter/X automation powered by ThreadWave, with a review gate before anything is published. The gate matters: unattended posting is how accounts get flagged. Relevant if you run social automation from an agent.

skilltwitterautomationreview-gate
by ohmyskyhigh Aug 14, 2026 5/10
skill GitHub

claude-stack: A Shipping Solo Builder's 156 Skills, 6 Hooks, and Router

A working Claude Code configuration published whole: 156 skills, 6 hooks, a conductor routing pattern, and an auto-dedupe watcher. Value is in seeing how the pieces fit at scale rather than installing all of it. The routing pattern is the most transferable part.

configskillshooksrouting
by bertbertov Aug 14, 2026 7/10
skill GitHub

second-brain-starter-kit: 101 Skills Turning Claude Code Into a Second Brain

All 101 skills behind the author's Claude Code second brain, plus a working CRM engine, vault templates, and a handover map. Ships the method rather than the personal data. Substantial starting point if you want agent-managed personal knowledge.

skillssecond-brainknowledgecrm
by tonydzi Aug 14, 2026 6/10
skill GitHub

guide-forge: Turn Your Idea Into a Gated, Learn-As-You-Go Build Guide

A Claude Code plugin that plans a gated milestone ladder for your own project idea, then drafts atomic step files explaining every action at the point it happens. Aimed at learning while building rather than getting handed a finished repo. Good for onboarding onto unfamiliar stacks.

pluginlearningmilestonesguide
by tomthebearded Aug 14, 2026 6/10
skill GitHub

cue: Record Requirements, Design, and Rejected Alternatives Beside Code

Claude Code plugins where cue-dev writes the requirement, design, rejected alternatives, and outcome next to the code they produced, so any line traces back to its reasoning. Attacks the biggest gap in agent-written code: nobody remembers why. Lightweight compared to full ADR processes.

plugindocumentationtraceabilitydecisions
by FrogBaek Aug 14, 2026 6/10
skill GitHub

shidi-skill: A Junior Lab Mate Skill for Literature Review and Figures

An agent skill that plays the role of a junior lab mate: literature research, experiment design, figure production, and paper reading, delivering files rather than chat. Results are meant to be cross-verifiable and it has no dependencies. Aimed at academic workflows.

skillresearchacademicfigures
by IcyCreamDAS Aug 14, 2026 5/10
skill GitHub

epicsagas/plugins: A Marketplace for Claude Code Skills and Commands

A Claude Code plugin marketplace for discovering and installing skills, commands, and agent configurations. Another entry in a crowded category. Browse before installing to see whether the catalog overlaps what you already run.

marketplacepluginsskillscommands
by epicsagas Aug 14, 2026 5/10
skill GitHub

reoclo/skills: On-Demand Reference Guides Shared Across Skill-Aware Agents

Shared agent skills for Reoclo tooling, written as reference guides that Claude Code and other skill-aware agents load on demand. Vendor-specific but a clean example of the load-when-needed pattern. Small footprint until invoked.

skillsreferenceon-demandshared
by reoclo Aug 14, 2026 5/10
skill GitHub

AgentSmithy: Distributable Skills for Screenshots, Transcripts, and Gifts

A distributable skill collection for Codex, Claude Code, and similar agents: screenshot to Markdown, video and audio transcription, pre-publish risk checks for Xiaohongshu, and evidence-based gift selection. An unusually eclectic mix. Chinese-language documentation.

skillsocrtranscriptionchinese
by BambooXiu Aug 14, 2026 5/10
skill GitHub

visualkan: Turn Any Content Into Whiteboards, Infographics, and Mind Maps

Converts arbitrary content into a visual explanation: whiteboard, infographic, presentation, diagram, mind map, or UI mockup. Installs as a skill into AI coding assistants. Useful when the deliverable is a picture rather than prose.

skillvisualizationdiagramsinfographics
by dapih Aug 14, 2026 6/10
skill GitHub

socratic: A Seven-Question Post-Ship Retrospective for Claude Code

A retrospective skill that asks seven questions after you ship, built around confidence, blind spots, and decay. Structured enough to run every time without becoming a chore. Pairs well with the same author's other review skills.

skillretrospectivereviewreflection
by robcsaszar Aug 14, 2026 6/10
skill GitHub

prose: Write in Channel Voice and Scrub AI Patterns From Existing Text

Drafts new content in the right voice for each channel, or scans existing text for AI tells and rewrites it in an authentic human voice. Two directions in one skill: generate and remediate. Useful for anyone publishing agent-assisted writing.

skillwritingvoiceediting
by robcsaszar Aug 14, 2026 6/10
skill GitHub

crucible: Parallel-Agent Codebase Audit That Adversarially Verifies Itself

Runs a parallel-agent audit over a codebase, then has agents adversarially try to refute each finding before it is reported. The verification step is what keeps plausible-but-wrong findings out of the output. A good pattern to copy even if you do not use the skill.

skillauditparallel-agentsverification
by robcsaszar Aug 14, 2026 7/10
skill GitHub

scaffold: Skills for Authoring AGENTS.md, CONTEXT.md, and DESIGN.md

Claude Code skills that write the three files agents rely on most: AGENTS.md, CONTEXT.md, and DESIGN.md. Removes the blank-page problem when setting up a new repo for agent work. Small and focused.

skillagents-mddocumentationscaffolding
by robcsaszar Aug 14, 2026 6/10
skill GitHub

ai-forge: The Full Skill-Authoring Lifecycle, From Create to Regression Eval

Claude Code skills covering the whole skill-authoring lifecycle: create, judge, eval with persisted regression suites, audit for ecosystem-wide coherence, review, and update. The persisted regression suites are the standout, since most skill authoring has no test loop at all. For people maintaining many skills rather than a handful.

skillauthoringevalregression
by robcsaszar Aug 14, 2026 7/10
skill GitHub

dsh-skills: Parallel Dispatch and Zero-LLM Architecture Mapping for DSH

A DeepSeek Harness skill pack with parallel-dispatch scheduling rules and an archmap agent that computes deterministic diff impact surfaces without calling an LLM, saving tokens. The zero-LLM impact analysis is the interesting idea. Chinese-language documentation.

skillsdshparallelarchitecture
by xu-jin-cs Aug 14, 2026 5/10
skill GitHub

ai-readiness-assessment: Score Your Team Against an Agentic Maturity Model

A self-contained Claude Code and GitHub Copilot plugin that assesses team AI readiness against the Agentic Habitat Maturity Model and the Sovereign Engineer framework, producing a gap-anchored maturity report. Aimed at engineering leads rather than individual developers. Opinionated about which frameworks matter.

pluginassessmentmaturityteam
by techtalk Aug 14, 2026 5/10
skill GitHub

Cluide: Guides, Setup Tasks, and Templates for Building Claude Assistants

A framework for building, maintaining, and improving AI assistants with Claude, combining guides, runnable setup tasks, installable skills, and copy-paste templates. Broad rather than deep. Useful as a structured starting point if you are new to assembling assistants.

frameworktemplatesskillsguides
by KalastajaM Aug 14, 2026 5/10
skill GitHub

oss-launch: Generate Every Open Source File a Repo Needs to Launch

A skill that scans a repo, asks only what it cannot infer, then generates README, LICENSE, contributing, security, changelog, CI, and a launch playbook. The ask-what-you-cannot-infer step keeps the output from being generic filler. Useful right before making a repo public.

skillopen-sourcereadmelicensing
by AnayDhawan Aug 14, 2026 6/10
skill GitHub

docdna: Backfill Docs the Code Can Prove and Flag the Ones It Contradicts

Decides which documents a repo owes, flags the existing ones that now contradict the code, and writes the ones the code can prove, with citations. Portable across Claude Code, Codex, Cursor, and Windsurf. The citation requirement is what separates it from generic doc generators.

skilldocumentationcitationsbackfill
by hannsxpeter Aug 14, 2026 7/10
skill GitHub

dsh-mattpocock-skills: Matt Pocock's 25 Skills Ported to DeepSeek Harness

An unofficial DSH port of mattpocock/skills, bundling 18 engineering and 7 productivity skills as a DeepSeek Harness plugin. MIT licensed with credit to the original author. Shows how portable well-written skills are across harnesses.

skillsdshportengineering
by xiaoxiaosrm Aug 14, 2026 5/10
skill GitHub

playcanvas/skills: Official PlayCanvas Skills for AI Coding Agents

Reusable skills published by PlayCanvas for agents working with their products. First-party skills are worth noting as a trend: the vendor encodes its own API conventions rather than leaving agents to guess. Useful if you build with PlayCanvas.

skillsplaycanvasgamedevfirst-party
by playcanvas Aug 14, 2026 6/10
skill GitHub

natural-talk: A Ruleset That Strips AI-Speak Out of Model Output

A complete ruleset for removing AI phrasing, lecture tone, and collaboration filler from model responses, usable with Claude, ChatGPT, and other conversational AI. Bilingual documentation. Broader than a coding skill but directly applicable to agent-written prose.

skillwritingtoneprompting
by chengzhi-c Aug 14, 2026 6/10
skill GitHub

claude-code-system-prompts: Every System Prompt and Tool Description, Versioned

A complete extraction of Claude Code's system prompt, its 27 builtin tool descriptions, subagent prompts for Plan/Explore/Task, and utility prompts for CLAUDE.md, compaction, statusline, WebFetch, Bash, security review, and agent creation. Updated for each Claude Code release. Essential reference if you write skills or subagents and want to match the house style.

referencesystem-prompttoolsinternals
by Piebald-AI Aug 14, 2026 8/10
skill GitHub

gemini-cli-extensions/spanner: Agent Skills for Google Cloud Spanner

Skills for working with Google Cloud Spanner, published under the gemini-cli-extensions org. Another first-party vendor skill set, portable to any skill-aware agent. Narrow but authoritative for Spanner work.

skillsspannergcpdatabase
by gemini-cli-extensions Aug 14, 2026 5/10
skill GitHub

gen-ai-skills: Picsart's Shared Skills and Prompts for Generative Workflows

Shared skills, prompts, and tooling for Picsart's gen-ai CLI and generative AI workflows. A company-internal skill library published openly. Mostly of interest as an example of how an organization structures shared skills.

skillsgenerative-aipicsartprompts
by PicsArt Aug 14, 2026 5/10
skill GitHub

Hemusci-Skills: A Chinese Skill Library for Research Writing and Analysis

A continually expanding professional agent skill library aimed at research writing, data analysis, and professional report delivery. Chinese-language. Relevant if your agent work is document-heavy rather than code-heavy.

skillsresearchreportschinese
by SoMic520 Aug 14, 2026 5/10
skill GitHub

brain-starter: A Claude Code-Powered Second Brain Template for Obsidian

An Obsidian second-brain template driven by Claude Code, shipping skills, auto-linking, and note conventions. Lighter than the 101-skill kits in the same space. A reasonable entry point if you already use Obsidian.

skillobsidiansecond-brainnotes
by michaeljauk Aug 14, 2026 6/10
skill GitHub

dsh-output-styles: Claude Code Output Styles Ported to DeepSeek Harness

Brings Claude Code outputStyles to DeepSeek Harness as session-scoped, durable, runtime-switchable styles, with a /style command, an output_style storage domain, and systemPrompt injection. Runtime switching without restarting the session is the useful bit. A clear reference for how output styles are wired.

output-stylesdshportprompting
by PerryLink Aug 14, 2026 5/10
skill GitHub

honest-skills: Agent Skills That Force a Model to Report What It Cannot Do

Two skills with teeth: root-cause forbids a causal claim without evidence, and sitrep puts the finding first, bad news above good, and names every gap. It ships clarity.py so the rules run as a check rather than sitting in the prompt as advice. Directly aimed at agents that overstate confidence.

skillhonestyreportingverification
by openhonest Aug 14, 2026 7/10
skill GitHub

openagentskills: A Community Library of Skills for Five Coding Agents

A community-driven library of reusable agent skills covering Claude Code, Cursor, Codex, Cline, and others. Community-maintained means variable quality, so read before installing. Useful as a discovery surface.

skillscommunitylibrarymulti-agent
by Notysoty Aug 14, 2026 6/10
skill GitHub

best-practice-skill: Anthropic Build Guidelines as an Agent Skill

An Agent Skill that encodes Anthropic's documented best practices for building with Claude. It advises on model and effort selection, prompt construction, subagent delegation, tool design, evaluation, and guardrails. A convenient way to keep official guidance in the loop while designing agent systems.

skillbest-practicespromptingsubagentstool-design
by starsinc1708 Aug 14, 2026 6/10
skill GitHub

skillary: Hub Index for 321 Claude Skills Across 11 Repos

A directory that indexes 321 Claude skills spread across eleven category repositories. You browse the full list in one place and then clone only the category you need, instead of pulling down everything. Handy for finding an existing skill before writing your own.

skillsdirectoryindexcatalog
by prvthmpcypher Aug 14, 2026 6/10
skill GitHub

skills-business: 29 Claude Skills for Business Workflows

A collection of 29 skills covering non-engineering work — project management, OKRs, SOPs, meeting summaries, proposals, and negotiation. Useful if you want Claude Code handling the operational paperwork around a project rather than just the code.

skillsbusinessokrsopproject-management
by prvthmpcypher Aug 14, 2026 5/10
skill GitHub

msu-skills: SKILL.md Catalog for MapleStory Universe Builders

An official NEXPACE catalog of agent skills for building on MapleStory Universe. It is distributed as plain SKILL.md files, so it works with Claude Code, Codex CLI, Gemini CLI, Kimi CLI, or any agent that reads the format. A good example of a vendor shipping first-party skills for their platform.

skillsgamedevmaplestoryvendorskill-md
by NEXPACE-Limited Aug 14, 2026 5/10
skill GitHub

claude-skills-realestate: Listing Copy and Fair Housing Compliance Screening

A free set of Claude skills for real estate agents, covering listing copy and MLS remarks. The more interesting piece is compliance screening against Fair Housing and state advertising rules, which turns the skill into a check on generated marketing text rather than just a generator.

skillsreal-estatecompliancecopywriting
by trevormchaffie Aug 14, 2026 5/10
skill GitHub

IncredAgents: Catalog Site for Claude Code SKILL.md Agent Skills

A documentation and catalog site for the IncredAgents collection of SKILL.md skills for Claude Code and compatible agents. Every skill gets its own page with real output demos, so you can see what it produces before installing. Useful for browsing skills without cloning repos first.

skillscatalogdocsskill-md
by MyAiFreedomSystems Aug 13, 2026 5/10
skill GitHub

claude-freelancer-skills: Five MIT Skills for Freelancer Operations

A free set of five Claude Code skills covering invoice chasing, proposals, client onboarding, status updates, and renewals. The focus is the admin side of freelancing rather than writing code. MIT licensed and drop-in for anyone running a solo practice.

skillsfreelanceinvoicingproposalsbusiness
by simoabdelmoumen10-sys Aug 13, 2026 6/10
skill GitHub

quiz-me-skill: Makes Claude Quiz You on the Bug Before It Writes Code

A Claude Code plugin that interrupts the usual fix-it-immediately loop by quizzing you on root cause and intended fix first. The goal is to keep your understanding of the codebase from decaying while the agent does the typing. A deliberate inversion of the normal agent workflow, aimed at learning.

pluginlearningdebuggingroot-cause
by schwann2402 Aug 13, 2026 7/10
skill GitHub

straightedge: Design Execution Engine With Computed WCAG Gates

A design skill for Claude Code, Cursor, and Codex that enforces computed WCAG contrast gates, a 22-shape catalog with rotation memory, and a ship scan blocking generic output and invented statistics. Covers web, print, brand identity, packaging, and apparel. Aimed at stopping agents from emitting the same slop layout every time.

designwcagaccessibilitybrandingskill
by iamAlvinV Aug 13, 2026 6/10
skill Reddit

Web-Design-Skills: A Two-Prompt Skill Suite From Site Discovery to Launch

A portable Agent Skills suite for Claude Code, Cursor and other coding agents that covers a website end to end in two prompts instead of fifty. The first prompt produces a blueprint — product goals, users, top tasks, content, visual direction, risks and acceptance criteria — before any code is written. The second builds and releases against that approved blueprint, with accessibility, SEO, privacy and QA treated as gates rather than afterthoughts.

skillsweb-designaccessibilityseoworkflow
by Both_Animator_1120 Aug 13, 2026 7/10
skill Reddit

ArcForge: A Review Gate for Claude Code Architecture Changes

An open-source set of Agent Skills that adds a second pass over architecture work: ask Claude Code to propose or modify an architecture, then review the resulting RFC, ADR or diagram before implementation begins. The gate returns evidence gaps, adversarial findings, blockers with a score, and a verdict with explicit approval conditions. It also ships a general production-architecture skill and a separate one for AI-agent system architecture, both instruction-first and portable.

skillsarchitecturecode-reviewadrrfc
by FunNewspaper5161 Aug 13, 2026 7/10
skill GitHub

architecture-decisions: Claude Code Skills for AWS and DevOps ADRs

A set of Claude Code skills for recording infrastructure decisions as architecture decision records, aimed at AWS and DevOps work. Each decision is evaluated against the AWS Well-Architected Framework and CALMS/DORA rather than captured as free-form prose, which gives the agent an explicit rubric to argue against. Handy if your team already keeps ADRs but writes them inconsistently.

skillsadrawsdevopswell-architecteddora
by eenlpe1 Aug 13, 2026 6/10
skill GitHub

clinpharm-pmx-skills: Agent Skills for Clinical Pharmacology and Pharmacometrics

An open Agent Skills library that turns a coding agent into a clinical pharmacology and pharmacometrics assistant. It reviews, reconciles and prepares evidence, with hard boundaries stated up front: it never selects a dose, signs off, or submits. The repo also tracks honest built-versus-released status per skill, which is unusual and worth copying for any regulated-domain skill pack.

skillsclinical-pharmacologypharmacometricshealthcareregulated
by malekokour Aug 13, 2026 6/10
skill GitHub

radar-suite: Five Claude Code Audit Skills for Swift and SwiftUI Apps

A one-install bundle of five audit skills that form a complete pipeline for finding bugs in Swift and SwiftUI apps before shipping. Each skill covers a distinct audit dimension rather than running a single generic review, which tends to surface more than one broad pass does. Aimed squarely at iOS and macOS developers using Claude Code.

skillsswiftswiftuiiosauditcode-review
by Terryc21 Aug 13, 2026 7/10
skill GitHub

magros.ai-skills: Portuguese-Language AI Skills Bundle Built on ECC

A skills bundle combining an ECC base with original Portuguese-language skills — engenharia-de-grafos for graph engineering, doctor for diagnostics, grills, and score-loop for iterative scoring. One of relatively few skill packs authored natively in Portuguese rather than translated, which matters for prompt phrasing quality.

skillsportuguesebundlegraphsscoring
by majinmagros Aug 13, 2026 5/10
skill Reddit

Unforget: Collapse Scattered TODOs and Plan Files into One UNFORGET.md

Deferred work usually ends up spread across a Deferred.md, inline TODOs, plan files, and memory files that disagree with each other. The Unforget skill sweeps the codebase and consolidates everything into a single UNFORGET.md, sorted into four categories: plan deferrals, spillovers, audit findings, and bugs. Each item gets a target column tied to your release cycle, so a ship-blocker flag means something concrete.

skilltodo-trackingrelease-managementcontext
by BullfrogRoyal7422 Aug 13, 2026 7/10
skill GitHub

Scriptorium: French Professional Writing Workshop for Claude with 26 Genres

Scriptorium is a French-language writing studio for Claude Code and Cowork, covering 26 source genres with a strict house style. Guardrails are deterministic and written in pure Python rather than left to the model. It exports finished work to Word, PDF, HTML, and LaTeX against a defined visual identity.

writingfrenchdocument-generationguardrails
by MariusYvard Aug 13, 2026 5/10
skill GitHub

Banka: Skills Kit for Scoping Claude Code Projects at the Right Complexity Tier

Banka is a protocol plus skills kit for scoping, generating, and building Claude Code projects without over- or under-engineering them. It sorts work into complexity tiers and matches the build approach to the tier. It stays agnostic about your stack while being deliberately opinionated about quality.

skillsscopingproject-setupquality
by partikularwaters Aug 13, 2026 6/10
skill GitHub

autonomous-engineer: Meta-Skill with Evaluator Loops and Workspace Sandboxing

autonomous-engineer is a meta-skill aimed at pushing coding agents toward staff-level autonomy across Claude Code, Cursor, Zed, OpenHands, and Codex. It combines context engineering, spec-driven development, and three-layer evaluator loops with an explicit graph topology for task decomposition. Evaluation-driven development against golden datasets and rigid workspace sandboxing round it out.

meta-skillspec-drivenevaluationsandboxing
by johngbl Aug 13, 2026 6/10
skill GitHub

claude-github-security-audit: Seven-Dimension Risk Audit Before Adopting a Repo

This skill audits a GitHub repository for risk before you pull it into your stack, which matters more as agents install third-party plugins and skills on your behalf. It scores across seven weighted dimensions covering maintenance, provenance, and code quality signals. The output is a single ADOPT, EVALUATE, CAUTION, or AVOID verdict rather than a wall of raw findings.

securitysupply-chainauditdependency-review
by Consultora-AMDT Aug 13, 2026 7/10
skill GitHub

claude-code-project-pack: 23 Subagents and 21 Skills for Japanese Contract Dev

A Claude Code project pack built for Japanese contract software development, aligned with the IPA Common Frame 2013 process model. It ships 23 subagents and 21 skills alongside QCD and security governance standards. The pack assumes you will tailor it to each engagement rather than adopt it wholesale.

subagentsskillsjapanesegovernance
by CT-masato-hino Aug 13, 2026 6/10
skill GitHub

second-reader: A Knowledge Vault Where Every Note Is Verified Against Its Source

second-reader is a knowledge vault skill for AI agents built around one rule: a note is not believed until it has been checked against its source. That verification step guards against the compounding errors you get when agents summarize their own summaries. It gives agents a store of notes with provenance rather than free-floating claims.

knowledge-baseverificationprovenancenotes
by mplind Aug 13, 2026 6/10
skill GitHub

competency-check: Diagnostic Skill for Finding Blind Spots in Adjacent Fields

competency-check is a diagnostic skill that probes what you do not know in professional areas next to your own. It surfaces blind spots rather than testing depth in your existing specialty. Useful for solo builders whose agent output now spans design, ops, and legal territory they never trained in.

skilldiagnosticlearningself-assessment
by wheeleny-design Aug 13, 2026 5/10
skill GitHub

mexican-mom: Skills That Make Your Agent Nag You Like a Traditional Mom

A skill pack that gives your agent the persona and habits of a traditional Mexican mother. It is a light take on persona skills, trading the usual neutral assistant tone for something with opinions. Worth a look mainly as a compact example of how far persona instructions can shift agent behavior.

personafunskilltone
by mcasillas17 Aug 13, 2026 5/10
skill GitHub

reSanity: A Zero-Dependency SKILL.md for Retail Investor Research Discipline

reSanity is a single-file Chinese-language skill that applies research discipline to retail investing decisions. It covers fact-checking claims, avoiding known traps, retaining what you learned, and reviewing past calls. One SKILL.md with zero dependencies, which makes it a clean example of packing a full workflow into one file.

skillchineseresearchzero-deps
by Thhoho Aug 13, 2026 5/10
skill Reddit

Audit skill that reports which checks Claude Code actually skipped

A single-file Claude Code plugin skill that audits the current change against an AUDIT_PROTOCOL.md and reports the tier it picked, the phases it ran, and the phases it skipped with reasons. Because it is just markdown it also works with Cursor, Codex, and other file-reading agents. The value is the explicit skipped-checks report rather than a silent pass.

auditcode-reviewpluginverification
by sturec5 Aug 13, 2026 7/10
skill GitHub

seudesign: Executable system design skill for Claude Code and Codex

Turns system design work into a runnable skill: design docs, architecture audits, capacity estimation, and mock interview drills. Works across Claude Code and Codex. Useful both for real architecture work and for interview prep.

system-designarchitecturecodexdocs
by SeuPut0705 Aug 13, 2026 6/10
skill GitHub

pm-evaluation-framework: 23 Claude Code skills for product managers

A library of frameworks, templates and rubrics wrapped as 23 Claude Code skills covering problem framing, value hypothesis, MVP scoping, prioritization, metrics, launch, PMF and AI integration. Aimed at daily PM workflows rather than one-off strategy documents.

product-managementtemplatesrubricsskills
by kalyvask Aug 13, 2026 6/10
skill GitHub

1c-quality-gate: Blocking quality gates for 1C:Enterprise development

A Claude Code plugin that enforces 1C:Enterprise (BSL) code standards — SOLID, design patterns, metadata XML rules — through blocking session gates. Produces a machine-readable evidence trail of what was checked. Very niche platform, but a solid template for domain-specific quality gating.

1cquality-gatestandardsplugin
by Romandredan Aug 13, 2026 5/10
skill GitHub

appllama-skills: Turn top-grossing app patterns into native-quality mobile screens

Agent skills that go beyond researching competitor apps and actually generate mobile screens following the UI patterns that top-grossing apps use. Framed as a builder rather than a research assistant. Useful starting point for mobile UI work driven by an agent.

mobileuidesignskills
by Appllama Aug 13, 2026 5/10
skill GitHub

LunarCommand/claude-skills: Query real traces and logs from your local stack

Claude Code skills for prod-local agent development: pull real traces and logs out of your local stack, plan before building, and review more deeply than a diff-scoped bot can. The observability angle is the differentiator — the agent reasons over actual runtime data instead of source alone.

observabilitytraceslogscode-review
by LunarCommand Aug 13, 2026 6/10
skill GitHub

superclarity: Make the agent clarify intent before it starts working

A general-purpose skill pack for long-horizon tasks: clarify what was actually asked, plan against the machine's real capabilities, and require evidence before claiming completion. Chinese-language documentation. Targets the ask-first, verify-after failure modes that bite on multi-hour tasks.

clarificationplanningverificationchinese
by haxudev Aug 13, 2026 5/10
skill GitHub

claude-skills-collection: 14 skills for a Chinese WeChat publishing pipeline

A complete pipeline from trending topic to published article for Chinese WeChat official accounts, packaged as 14 Claude Skills installable with two commands. Domain-specific, but a good example of chaining skills into one editorial workflow.

publishingwechatcontentchinese
by ma2ong Aug 13, 2026 5/10
skill Reddit

see-video: A skill that gives Claude Code real video frames, not the title

Extracts actual frames and captions so Claude answers from the video instead of guessing from the title. The clever part is frame selection: it reads your question first, scores moments against it using the transcript and on-screen text, then spends its frame budget there (5 of 55 candidates on one lecture). Downloads only the requested section, OCRs a larger copy locally, and transcribes with whisper.cpp — no API key.

videoffmpegwhispermultimodal
by krazybionic Aug 13, 2026 7/10
skill GitHub

what-are-the-bottlenecks: Find the real constraint in any system

A portable Agent Skill that identifies the actual limiting constraint in an idea, product, codebase, architecture, workflow or agent setup, rather than listing every possible improvement. Theory-of-constraints thinking packaged for agents. Works anywhere markdown skills work.

analysisconstraintsarchitectureportable
by Antonod1988 Aug 13, 2026 5/10
skill GitHub

docktor-compose: Read-only Docker Compose troubleshooting for agents

A CLI and Agent Skill for Codex and Claude Code that diagnoses exited, restarting and unhealthy containers plus ports, mounts, DNS, logs and OOM kills. Deliberately read-only, so the agent can investigate without changing your stack. Good pattern for giving agents diagnostic power without write access.

dockerdiagnosticsread-onlytroubleshooting
by bigu1 Aug 13, 2026 6/10
skill GitHub

claude-ad-skills: Seven read-only skills for Google and Meta ad accounts

Does senior media-buyer analysis on your ad accounts, working from either a connected account or a CSV export. Read-only by design, so it recommends rather than spends. Seven skills covering the usual optimization passes.

advertisingmarketingread-onlyanalytics
by riz1k9 Aug 13, 2026 6/10
skill GitHub

resume-tailor-skill: Tailor a resume to a job description, output a one-page .docx

A Claude Code skill that rewrites a resume against a specific job posting with recruiter-grade positioning and evidence scoring for each claim, producing a one-page .docx. Requires no code changes to use. Practical example of a document-producing skill.

resumedocxjob-searchwriting
by sakshi-gupta-1 Aug 13, 2026 5/10
skill GitHub

airshare: Publish HTML artifacts to a private, access-gated Cloudflare Pages site

One command to push reports, decks and dashboards to a private Cloudflare Pages site protected by Cloudflare Access. Ships as both a CLI and a Claude Code skill. Solves the awkward last step where an agent generates a nice HTML report and you need to share it with someone.

cloudflarepublishingartifactssharing
by hsongra11 Aug 13, 2026 6/10
skill GitHub

buyer-persona-builder: Research-backed personas from job posts and reviews

An AI research skill that synthesizes job postings, analyst reports, product docs, forums and reviews into buyer personas grounded in sources rather than invented. Compresses work that normally takes weeks into hours. Marketing-side use of an agent, but the source-synthesis pattern generalizes.

researchpersonasmarketingsynthesis
by LaureBrosseau Aug 13, 2026 5/10
skill GitHub

ds-vision-kit: Give text-only models vision through Claude Code skills

A generic vision core with pluggable scene skills — OCR, table-to-markdown, chart reading, UI review — so text-only models like DeepSeek and GLM can handle image tasks. A fork of Anionex/agent-vision-toolkit. Practical if you run a cheaper text-only model as your main driver.

visionocrdeepseekmultimodal
by awslew Aug 13, 2026 6/10
skill GitHub

claude-design-kit: Seven design skills plus two hooks that stop design drift

Design and build skills for Claude Code, paired with hooks that catch the slow drift away from your design system across a long session. MIT licensed with clear authorship and beginner-friendly docs. The anti-drift hooks are the differentiator over yet another design skill pack.

designhooksdesign-systemui
by emcquesten Aug 13, 2026 6/10
skill GitHub

ucsandman/claude-skills: 26 skills used daily on real projects

A working set rather than a demo collection: adversarial code review, shipping rituals, marketing asset pipelines, iPhone and desktop control, and multi-agent orchestration. The adversarial review and shipping-ritual skills are the ones worth reading first.

skillscode-revieworchestrationautomation
by ucsandman Aug 13, 2026 6/10
skill GitHub

claude-skill-writing-ecosystem: Orchestrator for human-facing writing and review

Coordinates article writing, editing, essay review and fact checking with an explicit AI-slop banned-word list in Japanese and English, voice rules, and title conventions. Role boundaries keep the editor from rewriting as the author. Designed to pair with an llms-txt writer for machine audiences.

writingeditingjapaneseorchestration
by shimo4228 Aug 13, 2026 5/10
skill GitHub

codex-review: A decorrelated second opinion on your diff from another model

A read-only Claude Code skill that wraps the OpenAI Codex CLI to review a diff, so the reviewer is a different model than the author. Cross-model review catches the blind spots a model shares with itself. Read-only, so it cannot quietly fix what it flags.

code-reviewcodexcross-modelread-only
by shimo4228 Aug 13, 2026 7/10
skill Reddit

Caveman rebuilt after JetBrains measured 8.5%, not 65%

JetBrains independently benchmarked the Caveman token-saving skill and found 8.5% output-token savings on long coding tasks, not the ~65% the author had been quoting from chat-style conversations. The author accepts the correction, notes JetBrains also found no quality loss, and rebuilds around the bigger source of waste the benchmark exposed. A rare public post-mortem on one's own numbers.

token-savingsbenchmarkoutput-stylepost-mortem
by VeryVexxy Aug 13, 2026 7/10
skill GitHub

web-app-security-skill: Scope, Audit, Harden and Retest With Evidence

An agent skill that runs a full web-app security cycle: define scope, audit for issues, apply hardening, then retest to confirm. Each pass leaves reproducible evidence so findings can be re-verified rather than taken on the agent's word.

securityauditwebskillhardening
by parousia8888 Aug 13, 2026 7/10
skill GitHub

gauntlet-loop: Bounded Worker-and-Critic Orchestration as a Skill

A portable Agent Skill implementing the worker/critic loop with an explicit bound, so review cycles terminate instead of spiraling. Portable across skill hosts, making it a drop-in way to add adversarial review to any task.

criticreview-looporchestrationskill
by kamtS Aug 13, 2026 7/10
skill GitHub

dev-skills-hub: Flat Skills Registry for Claude Code, Codex and Copilot

An extensible flat-file registry for sharing AI skills across Claude Code, OpenCode, Codex, and Copilot. Ships pre-configured with Magento 2 and Govard workflows, so it doubles as a working example of packaging domain-specific skills.

registryskillscross-agentmagento
by ddtcorex Aug 13, 2026 6/10
skill GitHub

agent-skills: Curated Collection of Reusable Agent Skills

A bilingual (EN/ZH) collection of agent skills packaged for reuse across projects. Useful mainly as a browsing source for skill patterns worth copying into your own setup.

skillscollectionchinesereusable
by manchan4869 Aug 13, 2026 5/10
skill GitHub

ShanireZskills: Skills for Competitive C++ and K-12 Teaching

A public Agent Skills marketplace focused on two niches: competitive-programming C++ style enforcement and K-12 teaching workflows. Narrow, but a concrete example of shipping domain skills as an installable marketplace.

skillsmarketplacecppeducation
by ShanireZ Aug 13, 2026 5/10
skill GitHub

korean-prose-skill: Korean Writing and Proofreading for Coding Agents

A skill that fixes awkward machine-translated Korean, targeting the unnatural 해요체 register that LLM output tends to produce. Useful for anyone shipping Korean-facing docs, UI copy, or commit messages written with an agent.

koreanwritingproofreadinglocalizationskill
by JellyBrick Aug 13, 2026 6/10
skill GitHub

speak-human-tw: Strip the AI Tells From Traditional Chinese Writing

A rewriting skill that detects 38 distinct AI writing tells in Traditional Chinese and rewrites them into natural prose, while correcting mainland-Chinese vocabulary and half-width punctuation. Works with Claude Code, Codex, and Cursor.

chinesewritingrewritinglocalizationskill
by Raymondhou0917 Aug 13, 2026 6/10
skill GitHub

deckmason: Production-Quality HTML Decks From Any Coding Agent

A presentation skill with 31 curated themes, automated color-theory validation, and Pyramid Principle storytelling structure, exporting to PPTX and PDF with brand import. Host-agnostic across Claude Code, Cursor, Codex CLI, and Windsurf.

slidespresentationhtmlpptxdesignskill
by a692570 Aug 13, 2026 8/10
skill GitHub

know-skills: Answers With Computational Social Science Rigor

A skill that routes questions by mode and depth and enforces truth-source discipline, so answers cite where they came from instead of confabulating. Backed by 48 offline contract tests, bilingual ZH/EN, works across Claude Code, Cursor, and Codex.

researchrigorcitationstestingskill
by Yuuqq Aug 13, 2026 6/10
skill GitHub

agy-companion: Delegate Code Review to Google Antigravity From Claude Code

Lets Claude Code shell out to Google's Antigravity CLI (agy) to review code or hand off tasks. A lightweight way to get a genuinely different model's opinion in-loop without leaving your Claude session.

antigravitycode-reviewdelegationcross-modelskill
by unlikelyzero Aug 13, 2026 7/10
skill GitHub

claude-skills: Open-Source Marketplace With agent-army and Continuation

A public Claude Code skills marketplace you add once, then install individual skills from — headliners include agent-army and claude-continuation. Hosted browsing available at claude-skills.amjad1233.com.

marketplaceskillsagent-armycontinuation
by amjad1233 Aug 13, 2026 6/10
skill GitHub

justin-figma-design: Inspect, Edit and Visually QA Figma Files

An agent skill for working directly against Figma files, including visual QA of the rendered result rather than just reading layer metadata. Host-agnostic across Agent Skills implementations; requires the Figma Console MCP.

figmadesignvisual-qamcpskill
by 1955m Aug 13, 2026 6/10
skill GitHub

e2e-skills: Generate, Audit and Debug Playwright and Cypress Tests

A testing toolkit that writes E2E specs from scratch, audits existing ones against 24 anti-patterns graded P0/P1/P2 with a focus on silent always-pass smells, and debugs flaky runs straight from playwright-report/ or cypress/reports/. The anti-pattern audit is the standout — agent-written E2E tests frequently pass without asserting anything.

e2eplaywrightcypresstestinganti-patternsflaky
by voidmatcha Aug 13, 2026 8/10
skill GitHub

collection-skill: Catalogs 150+ Scraping Tools, Then Picks One For You

Discovers and indexes over 150 scraping and collection tools on GitHub, then progressively narrows to the right one for your target and kicks off the crawl. Saves the usual half hour of comparing scrapers before any data gets collected.

scrapingcrawlingdiscoverytoolingskill
by Yuuqq Aug 13, 2026 6/10
skill GitHub

cargo-skills: GTM engineering skills for Claude Code via the Cargo CLI

A skill pack that turns Claude Code into a go-to-market engineering assistant. Covers lead list building, email finding and verification, waterfall enrichment, lead scoring, CRM sync, and buying-signal monitoring for job changes, funding, and tech intent. Backed by the Cargo CLI with 138 integrations and 50 data providers; also works with Codex and Cursor.

skillsgtmsalesenrichmentcrm
by getcargohq Aug 13, 2026 6/10
skill GitHub

dotbabel: Global Claude Code config and plugin for spec-driven development

A shareable global Claude Code configuration bundled with a portable harness plugin that enforces spec-driven development. Aims to keep agent work anchored to written specs and governance rules rather than ad-hoc prompting, and travels between machines and projects as one package.

configurationspec-drivenplugingovernanceclaude-md
by kaiohenricunha Aug 13, 2026 6/10
skill GitHub

tray-api-ai-plugin: Skills, Agents and Commands for 150+ Tray API Endpoints

An official plugin from Tray Tecnologia giving AI agents full integration with the Tray e-commerce platform APIs. It ships skills, agents, and slash commands covering more than 150 endpoints, so an agent can work the storefront API without you hand-writing request code. Documentation is in Portuguese; relevant mainly to Brazilian e-commerce developers.

pluginskillsapiecommercetray
by tray-tecnologia Aug 12, 2026 5/10
skill Reddit

Peter: A Skill That Turns Goals Into a Persistent JSONL Dependency Graph

An MIT-licensed Claude Code skill where a parent orchestrator decomposes a goal into a dependency graph persisted as JSONL, and backend and frontend agents implement scoped nodes with attached evidence and commits. Security and UI auditors are separate roles that cannot modify the code they judge. Loops stay inside nodes while the graph controls dependencies and handoffs, so a fresh agent can resume without reconstructing history.

skillorchestrationmulti-agentdependency-graphaudit
by BaXRS1988 Aug 12, 2026 7/10
skill GitHub

search-and-scale-os: A Job-Search Operating System Built as Skills

A set of Claude Code skills covering the full job-search lifecycle: sourcing roles, tailoring resumes, chasing referrals, interview prep, and offer negotiation. Everything runs locally with a human in the loop at each stage, and it is MIT licensed.

job-searchcareerskillshuman-in-the-loop
by guerrilla2799 Aug 12, 2026 6/10
skill GitHub

pm-chief-of-staff: A Personal Chief of Staff Skill for PMs

A Claude Code skill that acts as a chief of staff for product people, building a second brain that starts from a conversation and adapts to how you work. Documentation is in Portuguese.

product-managementsecond-brainportuguese
by pe-menezes Aug 12, 2026 5/10
skill GitHub

code-idea: Turn an Idea Into a Complete AGENTS.md Docs Set

Takes a plan or rough idea and produces an agent-ready documentation set: AGENTS.md plus linked architecture, decisions, roadmap, product, and design docs. It interviews you with grounded recommendations instead of filling a fixed template, and works with any AGENTS.md-compatible agent.

agents-mddocumentationplanningscaffolding
by melconcoast Aug 12, 2026 6/10
skill GitHub

malaysian-chinese-skill: Authentic Manglish Voice for AI Agents

An agent skill that produces authentic Malaysian Chinese voice, covering Manglish particles, Hokkien/Cantonese/Malay code-switching, and kopitiam cultural register. Useful for localized copy that generic models get wrong.

localizationwritingmalaysianvoice
by jotterhans Aug 12, 2026 5/10
skill GitHub

hci-paper-writing: Red-Team Your HCI Paper Before Reviewers Do

An open-source agent skill for HCI research writing that diagnoses whether a paper's contribution is real, traces each claim back to its supporting evidence, and red-teams the argument before peer reviewers get to it.

academicwritingresearchpeer-review
by RobbieRao Aug 12, 2026 6/10
skill GitHub

claude-anatomy: Decision Tree for What to Build in Claude Code

A decision tree for choosing between a skill, subagent, hook, MCP server, plugin, routine, web page, app — or nothing at all — plus the file skeleton for whichever piece the tree lands on. Documented in Spanish and English; not affiliated with Anthropic.

decision-treeskillshooksplugins
by Hainrixz Aug 12, 2026 7/10
skill GitHub

save-point: A 30-Second Comprehension Check After Every Merge

An agent skill that quizzes you on the code you just shipped, right after an AI-assisted merge. The premise is that the review step catches defects but nothing checks whether you actually understand what landed. Works with Claude Code, Codex, and Goose.

code-reviewlearningquizmerge
by thierrypdamiba Aug 12, 2026 7/10
skill GitHub

blind-ux-test: A Subagent That Uses Your App Cold to Find Friction

Hands a business system to an AI with no prior explanation and measures where a first-time user would get stuck. Ships as a single Claude Code subagent definition; documentation is in Japanese.

uxtestingsubagentusability
by kishii-py Aug 12, 2026 6/10
skill GitHub

find-files-with-everything: Fast Windows File Search for Agents

Gives coding agents fast file discovery on Windows by shelling out to the Voidtools Everything CLI instead of walking directories. Works with Claude Code, Codex, and other compatible agents.

windowssearchfilesperformance
by DerrickZeng33 Aug 12, 2026 6/10
skill GitHub

deep-research-cs: 8-Agent Pipeline for Survey-Grade Lit Reviews

A research skill for CS and AI papers that runs an eight-agent pipeline to produce survey-quality literature reviews complete with comparison and SOTA tables. Search is arXiv-first, every citation is verified individually, and output passes through seven quality gates.

researcharxivmulti-agentliterature-review
by Yang-Shihui Aug 12, 2026 7/10
skill GitHub

peitho: A Rhetoric-Based Skill for Prose That Holds a Reader

A Claude Code skill for writing openings and prose that keep a reader engaged, built on classical rhetoric plus research that contradicts a lot of conventional hook advice.

writingrhetoricprosecopywriting
by Pr1m4lc0d3 Aug 12, 2026 5/10
skill GitHub

superCMO-skills: End-to-End Marketing Campaign Skills for Agents

Open-source skills that let any agent produce complete marketing campaigns, including UGC video, ad video, and product photography. Works across Claude, Cursor, and other skill-compatible agents.

marketingvideougccampaigns
by SupercmoHQ Aug 12, 2026 5/10
skill GitHub

digital-marketing-pro: Marketing OS With Human Approval Gates

An open-source marketing system covering strategy, SEO, AEO/GEO, paid media, content, CRM, and analytics. Outputs are grounded in explicit brand context and gated behind human approval, with verifiability as a design goal.

marketingseoanalyticscrm
by indranilbanerjee Aug 12, 2026 5/10
skill GitHub

slopware-skills: Portable Skills Built on a Minimum Sufficient Work Kernel

A free collection of portable agent skills and plugins for Codex, Claude Code, and other Agent Skills clients. Centred on the MSW Kernel, which pushes agents toward the minimum sufficient work for a task rather than sprawling output.

skillsportablecodexplugins
by transcendr Aug 12, 2026 5/10
skill GitHub

compdf-skills: PDF Convert, Edit, Split, and Compare for Agents

Official ComPDF skills that give coding agents real PDF processing: conversion, editing, splitting, insertion, comparison, and compression. Compatible with Claude Code, Cursor, Copilot, OpenCode, and dozens of other agents.

pdfdocument-processingskillsconversion
by ComPDFKit Aug 12, 2026 6/10
skill GitHub

framia-skills: Storyboard-First Video Generation With Audit Gates

Agent skills for creating video with Framia, structured storyboard-first with model routing, editor assembly, local ffmpeg finishing, and audit gates between stages. A companion repo holds reproducible example videos.

videostoryboardffmpegmedia
by convergeai-labs Aug 12, 2026 5/10
skill GitHub

Yandu DECK: Turn an Article Into a Scrollable Presentation Site

A Claude Code skill that converts an article into an immersive one-screen-per-frame presentation page with page-flip or autoplay, in warm-dark or off-white themes. Chinese fonts are self-hosted and subsetted, with one-command publishing to Cloudflare Pages.

presentationwebcloudflare-pageschinese
by huiyonghkw Aug 12, 2026 5/10
skill GitHub

Three Korean Skills for PR Writing, Review, and Comprehension Debt

A trio of Claude Code skills aimed at team practice: writing PRs, issues, and commits your teammates will actually read; a procedure for reviewing a teammate's PR; and a check on how much AI-written code you don't yet understand.

koreanpull-requestcode-reviewwriting
by iceberggymnast Aug 12, 2026 5/10
skill GitHub

lucide-svg-skill: Generate Original Lucide-Style Icons With Metadata

An agent skill that produces original icons matching Lucide's visual style, emitting both the SVG and Lucide-format metadata JSON. Works with Claude Code, Codex, Cursor, Gemini CLI, and other Agent Skills tools.

iconssvglucidedesign
by S6U5 Aug 12, 2026 6/10
skill GitHub

engineering-skills: 33 SDLC Skills Under Shared Principles

A unified Claude Code plugin packing 33 skills spanning the whole SDLC — product, research, design, develop, tune, test, verify, ship, operate — with a shared set of engineering principles injected at session start so every skill inherits the same standards.

sdlcpluginengineeringskills
by int2t05 Aug 12, 2026 6/10
skill GitHub

brainrot: Mine Your Own Chat History Into a Lean Claude Rule Set

A self-audit toolkit that mines your Claude chat history for the corrections you've had to repeat and the approaches that worked, arbitrates the findings into a compact rule set, and keeps the resulting memory tidy rather than ever-growing.

memoryself-auditclaude-mdrules
by coltonbearden Aug 12, 2026 7/10
skill GitHub

ship-what-you-built: Domain, HTTPS, and Deploys for First-Timers

A free guide plus Claude Code skill that walks someone who has never deployed anything through getting their project online: a domain, HTTPS, a GitHub repo, and automatic deploys.

deploymenthttpsgithubbeginners
by jhammant Aug 12, 2026 6/10
skill GitHub

bg-text: Bulgarian Text Quality Skill for AI Assistants

A skill that raises the quality of Bulgarian text produced by AI assistants and editor workflows, targeting the specific errors models make in the language.

bulgarianwritinglocalizationtext-quality
by AcTePuKc Aug 12, 2026 5/10
skill Reddit

ISO 24495 Plain Language Plugin: Five Skills and an Advisory Hook

A Claude Code plugin keeping output in plain language per the ISO 24495 international standards. Five skills cover core rules, legal writing, technical writing, organisational rollout, and document design, with Claude picking the right one per task. An advisory hook audits every markdown file it writes and reports sentence length, paragraph density, and legalese counts in a single line.

plain-languageiso-24495writinghooks
by gazmagik Aug 12, 2026 7/10
skill GitHub

dq-skills: Ten Skills That Audit and Clean Data Quality in SQL

Ten Claude Code skills for data quality work against any SQL database: profiling, quality metrics, audit reporting, standardization, imputation, deduplication, and defect prevention.

data-qualitysqlprofilingdeduplication
by koprjaa Aug 12, 2026 7/10
skill GitHub

light-novel-writer: Full-Pipeline Japanese Light Novel Creation

Covers the whole light-novel production pipeline: project setup, ranking-based topic selection, teardown analysis of successful works, outlining and the crucial opening chapters, drafting, de-AI-ifying the prose, multi-perspective review, and foreshadowing and timeline tracking. Integrates with Syosetu, Kakuyomu, and other Japanese and Chinese publishing platforms.

writinglight-noveljapanesepublishing
by MSKmrc Aug 12, 2026 5/10
skill Reddit

whetstone 4.4.1: Fixing Skills That Load When They Shouldn't

A release note worth reading for the trigger-scoping lesson: adding C and C++ skills that both claimed **/*.h meant every C header edit force-loaded 24 KB of skill bodies, most of it irrelevant to the task. whetstone itself is a Claude Code plugin of 19 agents, 22 commands, and 32 skills pushing agents toward planning, verification, and review before editing.

pluginskillstriggersrelease-notes
by Ilia0001 Aug 12, 2026 6/10
skill GitHub

video-gen-demo-booth: Pick a Video Model With Evidence, Then Ship

Claude Code skills for running AI video generation demo activations: choose a generation model based on evidence rather than vibes, then build a booth experience people can actually operate.

videodemoevaluationskills
by thepandanlabs Aug 12, 2026 5/10
skill GitHub

realmanagement: A Negotiation and People-Management Advisor

A Claude Code advisor for communication, people management, sales, and negotiation, distilled from 275 principles and 1,019 recorded negotiations across 157 live classes in Vladimir Tarasov's social-technology tradition. Answers in Spanish.

managementnegotiationcommunicationspanish
by arturgaliev3099-ux Aug 12, 2026 5/10
skill GitHub

bluepencil: Edit AI-Sounding Drafts Into Human Prose, or Audit

An agent skill that rewrites AI-sounding drafts into human prose, or audits them and reports the problems without touching the text. It targets the tells that persist after ordinary prompt tuning.

writingeditingai-detectionprose
by chernistry Aug 12, 2026 6/10
skill GitHub

repo2skill: Turn Any Public GitHub Repo Into an Agent Skill

Converts any public GitHub repository into a repository-native Agent Skill for ChatGPT and Claude. Browser-first and free, with no AI API key required to do the conversion.

skillsgithubgenerationbrowser
by Hhhkarimi Aug 12, 2026 7/10
skill GitHub

ru-text: Russian Text Quality Scoring With 2,000+ Atoms

A Russian-language text quality skill covering neuroslop cleanup, typography, information style, editorial standards, UX writing, and business correspondence. Scores text on a 0-10 scale using more than 2,000 linguistic atoms.

russianwritingtext-qualityediting
by talkstream Aug 12, 2026 6/10
skill GitHub

pa-reviewer: Review Against Italian Public-Sector Guidelines

An agent skill reviewing Italian public administration codebases against national guidelines and CAD obligations, checking what the official validators cannot see. It explicitly does not issue formal compliance judgements.

italypublic-sectorcompliancecode-review
by engineering87 Aug 12, 2026 5/10
skill GitHub

masters-nudge: Six Engineering Lenses for Long-Running Sessions

Delivers one well-timed third-party nudge into a long-running Claude Code session, evaluated through six distinct engineering lenses — a check from outside the session's own reasoning.

reviewlong-sessionsengineeringnudge
by shihchengwei-lab Aug 12, 2026 6/10
skill GitHub

paper-writer-skill: IMRAD Workflows and Literature Matrices

A Claude Code skill for academic manuscript writing, covering IMRAD-structured workflows, literature matrices, and table and figure preparation, with tested utility scripts included.

academicimradwritingresearch
by kgraph57 Aug 12, 2026 6/10
skill GitHub

claude-skills (ohugonnot): Quality-Gated Delivery and Review

A battle-tested personal skill collection covering quality-gated feature delivery, senior-level review, issue and merge-request workflow, branch wrap-up, book distillation, context saving, human-sounding technical writing, and a learning mentor.

skillscode-reviewquality-gatesworkflow
by ohugonnot Aug 12, 2026 6/10
skill GitHub

document-design-system: Five Skills Over One Token Contract

A design system for documents — analytical reports, diagrams, charts, decks, and long-form specs — output as self-contained HTML. Five Claude Code skills share a single semantic token contract so everything they produce looks like one system.

documentsdesign-systemhtmlreports
by Avinava Aug 12, 2026 7/10
skill GitHub

heliograph-skill: Debug an Unreachable Machine Using Git

A free skill for debugging a machine you cannot log into, through an operator who cannot debug it — aimed at air-gapped, client-owned, and change-controlled estates. Git serves as the transport in both directions.

air-gappeddebugginggitoperations
by dbhq-uk Aug 12, 2026 7/10
skill GitHub

claude-webapp-security-skill: A 9-Phase Audit and Hardening Plan

A Claude Code skill running a nine-phase web application security audit and hardening program covering API, LLM, OAuth, database, supply chain, and detection concerns. Also includes a crawl-boundary policy for AI crawlers, AWS hardening guidance, and read-only audit scripts.

securityaudithardeningweb
by parousia8888 Aug 12, 2026 7/10
skill GitHub

build-card: Make Your Agent Show a Plan Before It Builds

A Claude Code skill that forces the agent to present a seven-part plan in plain English before writing any code. Released into the public domain.

planningtransparencypublic-domainskill
by CraniusMaximus Aug 12, 2026 6/10
skill GitHub

claude-skills-research: Paper Review, Bibliographies, HPC Runs

Claude Code skills for academic research support: paper review, bibliography verification, literature surveying, head-to-head paper comparison, and managing HPC experiment campaigns.

academicresearchbibliographyhpc
by chgagne Aug 12, 2026 6/10
skill GitHub

SuperMD: Composable Anti-Slop System Prompt for 92 Professional Fields

A pure-Markdown system prompt kit built to cut generic AI output. It composes a universal core with per-domain modules across 16 categories and 92 sub-fields, is bilingual EN/ID, and ships an eval harness to verify the prompts do what they claim. Worth a look if you maintain CLAUDE.md files for work outside software.

prompt-engineeringmarkdownanti-slopevalclaude-md
by TegarTheGreat Aug 12, 2026 7/10
skill GitHub

claude-code-config: Daily-Driver Settings, Hooks, Permissions, and Skills

A public dump of one engineer's working Claude Code configuration — settings.json, hooks, permission allowlists, plugins, and custom skills. The value is in seeing which permissions and hooks someone actually keeps after daily use, rather than a curated demo. Good starting point for tuning your own setup.

confighookspermissionssettingsdotfiles
by slogsdon Aug 12, 2026 6/10
skill GitHub

claude-plugins (jontsai): Plugins for Research, Productivity, and Dev Work

A personal but curated collection of Claude Code plugins grouped around research, productivity, and development workflows. Installable as a marketplace, so you can pull just the pieces you want. One of many such collections — skim it for the research-oriented plugins in particular.

pluginsmarketplaceresearchproductivity
by jontsai Aug 12, 2026 6/10
skill GitHub

lernkarten: Claude Code Skill Set for Print-Ready A4 Flashcards

A German-language skill set that turns arbitrary source material into printable study cards — A4 pages, 8 cards per sheet, laid out for duplex printing. Handles the layout details that usually make DIY flashcard generation annoying. Useful template even if you adapt it to another language.

skillflashcardslearningprintinggerman
by mhabedank Aug 12, 2026 6/10
skill GitHub

interview-sim: Timed Coding-Assessment Practice as an Agent Skill

An Agent Skill that runs GCA and ICA style coding assessments in your terminal with a deterministic timer and hidden-test grading. Questions are original rather than scraped from question banks. A neat demonstration of a skill that enforces constraints on you rather than helping you write code.

skillinterviewassessmentpracticeterminal
by chrisjacksonn Aug 12, 2026 7/10
skill GitHub

robotics-agent-skills: ROS1/ROS2 Skills for Production Robotics Code

Agent skills that push coding assistants toward production-grade robotics software, covering ROS1, ROS2, design patterns, SOLID principles, and testing. Written as SKILL.md files, so they work with Claude Code, Cursor, Copilot, or anything else that reads the format. Narrow domain, but robotics code is exactly where unguided agent output tends to go wrong.

skillroboticsrostestingdesign-patterns
by arpitg1304 Aug 12, 2026 7/10
skill Reddit

PlanX: Versioned, Foldable Plans You Will Actually Read

A planning skill and CLI built on the premise that most agent-generated plans are never read because they are an unreadable wall of text. PlanX splits plans into collapsible sections, versions them, diffs revisions while hiding unchanged parts, and lets you leave line-level feedback or edit directly before sending it back for another pass. Once approved, the plan can be executed by any agent.

planningskillclireviewversioning
by Yellow-Minion-0 Aug 12, 2026 8/10
skill GitHub

prompt-boost: Sharpen a Vague Request Into a Checkable Brief

A skill that intercepts loose requests and turns them into a structured brief before Claude Code starts working: goal, done-check, assumption, and scope fence. The done-check and scope fence are the useful parts — they give you something to verify the result against and a boundary the agent is told not to cross.

promptingscopingplanningbriefs
by sernoxxx Aug 11, 2026 6/10
skill GitHub

quant-llm-skills: 10 Quant Research Skills With 11 Reproducible Evals

Ten skills aimed at the failure modes that quietly ruin LLM-assisted quant research: lookahead bias, at-the-money detection, survivorship bias, and transaction-cost realism. Notably it ships 11 reproducible evals showing 8 of the skills measurably improve Haiku's output, which is more evidence than most skill collections offer. MIT, works with Claude Code and Cursor.

quantfinanceevalsresearch
by jefrnc Aug 11, 2026 7/10
skill GitHub

scrnaseq-skills-v2: Single-Cell RNA-Seq Analysis Skills for AI Agents

A knowledge framework for AI-assisted single-cell RNA-seq analysis, packaged as reusable computational workflows. Aimed at bioinformaticians who want an agent to follow established scRNA-seq practice rather than improvising an analysis pipeline.

bioinformaticsrna-seqresearchgenomics
by Ryannachmand Aug 11, 2026 5/10
skill GitHub

php-opcua/ai-skills: Auto-Synced SKILL.md for Every php-opcua Package

Agent skills for the php-opcua ecosystem, with a SKILL.md automatically kept in sync for each package in the family. Works across Claude Code, Laravel Boost, Cursor and Copilot. A reasonable pattern to copy if you maintain a multi-package library and want agent guidance to track releases.

phpopcuaskillsindustrial
by php-opcua Aug 11, 2026 5/10
skill GitHub

claudekit: Symlinkable Skills and CLAUDE.md Rule Snippets, No Build Step

A content-only collection of Claude Code skills — TypeScript audits, legal policy writing, SEO, agent memory — plus CLAUDE.md rule snippets. Nothing to compile: symlink a skill into .claude/skills and @-import the rule files into your own CLAUDE.md.

skillsclaude-mdtypescriptseo
by daanvandenbergh Aug 11, 2026 6/10
skill GitHub

aws-reinvent-planner: Conflict-Free re:Invent Schedules From Skills + CLI

Claude Code skills plus a zero-dependency CLI for planning an AWS re:Invent week. It scores sessions against your profile, builds conflict-free schedules that account for travel time between Las Vegas venues, and can produce team coverage plans so a group does not all attend the same talks.

awsconferenceplanningcli
by connor-tyndall Aug 11, 2026 6/10
skill GitHub

skill-vault: Organize, Secure and Search Your Claude Code Skills

A single vault for collecting Claude Code skills so they can be found and reused across projects instead of being scattered per repo. Adds organization and a security review step on top of plain file storage.

skillsorganizationreusesecurity
by Synchronic-leafbud824 Aug 11, 2026 5/10
skill GitHub

cami-design: UI Audit Skill That Routes Each Issue to the Right Owner

A Claude Code skill that audits your UI before you ship and, rather than dumping one flat list, classifies every finding as a layout, interaction, copy or engineering problem. The routing is the useful part: it turns a design review into work items that already belong to someone.

uidesign-reviewauditqa
by PawlakCamille Aug 11, 2026 7/10
skill GitHub

Foreman: Markdown-Only Build Playbook for Agent-Driven Website Builds

A playbook that makes your coding agent run a website build like a foreman: it interviews you, forces the design and scope decisions up front, locks a visual system, writes the build brief, then verifies, ships and indexes the site. Available as a Claude Code plugin and Agent Skill, and it is markdown only — no scripts to install or trust.

websitescopingdesign-systemplaybook
by Turki-Sh Aug 11, 2026 7/10
skill GitHub

sdlc-skills: Phase-Isolated SDLC Skills to Keep Agents on the Rails

A collection of SDLC skills deliberately isolated by phase, so an autonomous agent handles requirements, design, implementation and verification as separate disciplined steps rather than blurring them. The isolation is the mechanism — it prevents the agent from jumping to code while requirements are still open.

sdlcprocessengineeringphases
by augments-labs Aug 11, 2026 6/10
skill GitHub

ultimate-seo-geo: Audit, Plan and Execute SEO + AI-Search Optimization

A three-mode SEO and GEO skill — audit, plan, execute — covering full site audits with scored findings, optimization for Google AI Overviews, ChatGPT and Perplexity, schema generation and E-E-A-T assessment. Ships 20 diagnostic scripts, so the audit findings come from real checks rather than model opinion.

seogeoauditschema
by mykpono Aug 11, 2026 5/10
skill GitHub

anti-ai-slop-writing: Skill That Strips AI Tells From Prose

A Claude skill for writing human-sounding English, Russian, and Ukrainian, paired with a zero-dependency detector that flags common AI writing patterns. Useful if you draft docs, posts, or copy with Claude and want the output to stop reading like a model wrote it.

skillwritingmultilingualai-detection
by GitVoytenko Aug 11, 2026 6/10
skill GitHub

fullenrich-skills: SKILL.md Collection Usable as Skill, MCP, or Plugin

A published set of SKILL.md files from FullEnrich, packaged so the same definitions work as Claude skills, through MCP, or as a plugin. Worth a look mainly as a reference for how one team structures and distributes skills across all three delivery formats.

skillcollectionmcpplugin
by FullEnrich Aug 11, 2026 5/10
skill GitHub

cmdi-command-injection: Skill for Testing OS Command Injection

A Claude Code skill for security testing focused on OS command injection and argument injection. Packages the methodology so the agent probes for these specific classes systematically instead of relying on whatever it recalls about them.

skillsecuritycommand-injectiontestingappsec
by snowflakeovo Aug 11, 2026 7/10
skill GitHub

repocharter: One shared repo charter for Claude Code, Codex, and OpenCode

Generates a single charter file per repository that every coding agent reads, instead of maintaining separate CLAUDE.md, AGENTS.md, and tool-specific config. Aims for lean prompts plus guardrails that are actually verified rather than just stated. Useful if your team switches between agents or runs more than one against the same codebase.

claude-mdagents-mdcontextmulti-agentconfiguration
by 7fromheaven Aug 11, 2026 7/10
skill GitHub

agent-traffic-control: 61 skills for running parallel Claude Code sessions on one repo

A multi-skill plugin for the case where several CC sessions share a single repository. Covers an issue-pickup claim protocol so two agents do not grab the same work, worktree isolation pitfalls, recovering from conflicting parallel PRs, subagent integrity checks, and squash/merge mechanics. The most detailed treatment of parallel-session collisions posted so far.

parallel-sessionsworktreesgitskillsplugincoordination
by wan-huiyan Aug 11, 2026 8/10
skill GitHub

atlas-flight-booking-skill: Flight Search and Booking Skill for AI Agents

A skill that lets an agent search and book flights, auto-installing the atlas-flight CLI on first use. Demonstrates the pattern of a skill that bootstraps its own binary dependency. Niche, but a clean template for wrapping any CLI as a skill.

skilltravelclibooking
by atlas-doc Aug 11, 2026 5/10
skill GitHub

claude-scope-gate: Skills That Ask Whether a Change Is the Right Change

A set of Claude Code skills that interrogate the premise of a change before it gets built, rather than checking the code after. The argument is that code review, linters, and security scanners are all structurally downstream of the scoping decision. Sits at planning time, not review time.

skillscopeplanningreview
by Snowfly0709 Aug 11, 2026 7/10
skill GitHub

Claude-Skills: Agent Skills for Frontend, Secure Coding, Research, and Meta Ads

An open collection of Agent Skills spanning frontend engineering, secure coding practices, research, automation, and Meta Ads workflows. Follows the open Agent Skills standard so it works beyond Claude Code. Breadth over depth, but the secure-coding entries are worth a look.

skillsfrontendsecuritycollection
by sergeyizmailov Aug 11, 2026 5/10
skill GitHub

image-skills: AI Image Handoff and Deterministic Asset Processing

Open-source skills that separate the creative image-generation handoff from deterministic asset processing like resizing and format conversion. The deterministic half runs as real code rather than model output. Useful pattern for anything where you want the model to decide but not to compute.

skillimagesassetspipeline
by x0c Aug 11, 2026 5/10
skill GitHub

HMAP: Skill That Scores How Maintainable a Project Is for Humans

A Human Maintainability Assessment skill that evaluates whether a codebase remains workable by people, not just by agents. Produces a structured assessment rather than a lint report. Relevant as AI-generated code accumulates in projects humans still have to own.

skillmaintainabilitycode-qualityassessment
by hmr-BH Aug 11, 2026 5/10
skill GitHub

ai-daily-skill: Claude Code Skill That Builds a Daily AI News Digest

A skill that fetches, analyzes, and categorizes AI news on a daily schedule into a digest. Runs entirely through Claude Code rather than a separate service. Chinese-language documentation and output.

skillnewsautomationdigest
by geekjourneyx Aug 11, 2026 5/10
skill GitHub

BrotherModeUp: Skill for Plain-Language Planning and Verified Completion

A skill that reshapes Claude into a careful project partner: it plans in plain language, keeps durable state across sessions, and refuses to call work done without a passing check. Aimed at non-expert users who cannot easily audit the model's claims. The completion gate is the substantive part.

skillplanningverificationstate
by khalilmaaouni Aug 11, 2026 5/10
skill GitHub

jira-ticket-builder-skill: Rough Requirements Into Jira Stories and a Diagram Portal

Turns a loose requirements document into structured Jira stories alongside an HTML portal with architecture, UI flow, and customer journey diagrams. Runs as a Claude Skill or as ChatGPT custom instructions. The diagram portal is the differentiator over plain ticket generation.

skilljirarequirementsdiagrams
by kirti Aug 11, 2026 6/10
skill Reddit

EdgeResearch: Skills That Run Measured One-Change-at-a-Time Experiments

A skill set adapted from Karpathy's research repo that freezes the success metric, changes one thing, re-measures, then keeps or discards. Applied to prompts, copy, and configuration rather than model training. Guards against the common failure of agents shipping changes that quietly make things worse.

skillexperimentsevaluationresearch
by Free_Tennis7754 Aug 11, 2026 6/10
skill GitHub

Skillquiver: 23 Curated Agent Skills Installed as One Plugin

A bundle of 23 curated Agent Skills for Claude Code, installable as a single plugin instead of one-by-one. Once installed the skills are available across projects. Worth skimming for individual skills to lift even if you do not want the whole set.

skillsplugincollection
by Drizzy07x Aug 11, 2026 6/10
skill Reddit

ORC: Skill Constellation Running Intake, Plan, Subagents, and Verify

Not a runtime — markdown skills, slash commands, and model-pinned subagent definitions dropped into .claude/ that Claude Code reads as a disciplined pipeline: intake, analyze, plan, score, parallel subagents, review, verify, ship. The orchestrator never writes code itself; it scores each task 0-100 and routes accordingly. Installs via npm.

skillsorchestrationsubagentspipelineslash-commands
by JoR0th Aug 11, 2026 7/10
skill GitHub

idaibin/skills: Skills for Analysis, Planning, Review, and Runtime Verification

Independent Agent Skills covering repository analysis, planning, implementation, review, delivery, design, and runtime verification. Each is usable on its own rather than as a mandatory pipeline. Reasonable starting point for assembling a per-phase skill set.

skillsreviewverificationplanning
by idaibin Aug 11, 2026 5/10
skill GitHub

unit-cma-lite: Australian Apartment Comparative Market Analysis Skill

A Claude Code skill implementing buyer's-agent CMA methodology for Australian units and apartments using only free data sources. Open-sourced by Avocado Wealth. Domain-specific, but a solid example of encoding professional methodology into a skill.

skillreal-estateaustraliaanalysis
by mra2898 Aug 11, 2026 5/10
skill GitHub

mcp-server-skill: Skill for Building MCP Servers

A skill that guides Claude through building MCP servers, encoding protocol conventions and structure so you do not re-explain them each time. Minimal, focused scope. Useful if you write MCP servers regularly.

skillmcpdevelopment
by cyberreinxy Aug 11, 2026 5/10
skill GitHub

no-slop: Skill That Strips AI Slop From Writing and Interfaces

Checks writing and interface copy for the telltale patterns of AI-generated text, applies your own voice, then runs a final review pass. Includes safe update handling and an optional hook to run it automatically. Addresses the tone problem rather than the correctness problem.

skillwritingstylehook
by Rlegaspi562 Aug 11, 2026 6/10
skill GitHub

sichen-skills: Handoff, First-Principles, and Clarify-Until-Clear Skills

Three general-purpose skills validated on real projects: new-convo-handoff for carrying long projects across sessions, first-principles for reasoning from fundamentals, and clarify-until-clear for forcing disambiguation before work starts. Follows the open SKILL.md standard. Chinese-language documentation.

skillshandoffplanningclarification
by sichenai Aug 11, 2026 5/10
skill GitHub

claude-skill-unity-code-architecture: Architecture Standard for Unity and C#

A Claude Code skill encoding an architecture and code-quality standard for Unity and C# game code. Covers game programming patterns, Gang of Four patterns, code smells and refactorings, SOLID, and Unity-specific pitfalls. Substantial domain depth for a single skill.

skillunitycsharparchitecturegamedev
by alpershin Aug 11, 2026 6/10
skill GitHub

hey-codex: Skill That Calls the Codex CLI for a Second Opinion

A Claude Code skill that shells out to OpenAI's Codex CLI for a second opinion, to hand off a task, for analysis, or to generate an image. Makes cross-model consultation a single invocation instead of a manual context copy. Russian-language documentation.

skillcodexcross-modelsecond-opinion
by warodan Aug 11, 2026 6/10
skill Reddit

Tweed: Research-Mentor Guidelines for Reviewing Study Designs and Claims

An open-source framework that makes an AI behave like an experienced research mentor — clarify the question before picking methods, prefer established solutions, avoid unnecessary complexity, and check whether claims are actually supported by evidence. Can review ideas, study designs, manuscripts, references, and methodological choices. The author is explicitly asking for critical feedback.

skillresearchmethodologyreview
by Ashamed_Charity_7063 Aug 11, 2026 5/10
skill GitHub

claude-skills-nederlands: 121 Free Dutch-Language Agent Skills

A collection of 121 Dutch-language skills for Claude and any agent following the open Agent Skills standard. Published free by theseo.nl. Notable mainly for its scale and for serving a non-English audience.

skillsdutchcollectionlocalization
by GianlucaNaarden Aug 11, 2026 5/10
skill GitHub

syarif-laravel-ai-skills: Reusable Laravel Skills for Claude Code and Codex

A set of reusable Laravel-focused skills usable from Claude Code, Codex, and other AI coding assistants. Encodes framework conventions so they do not have to be re-explained per project. Straightforward but useful for Laravel shops.

skilllaravelphpframework
by soden46 Aug 11, 2026 5/10
skill GitHub

skills-gamedev: 22 Claude Skills for Unity, Unreal, Godot, and Roblox

Twenty-two skills aimed at game developers across Unity, Unreal, Godot, and Roblox, plus level design, narrative design, and shader authoring. Covers design disciplines and not only code. One of the broader domain-specific skill sets published so far.

skillsgamedevunityunrealgodot
by prvthmpcypher Aug 11, 2026 6/10
skill GitHub

subsquid-labs/skills: SQD's Official Agent Skills Collection

SQD's officially maintained collection of agent skills for working with their indexing platform. First-party, so it tracks the current API. Relevant for Web3 data indexing work.

skillsweb3officialindexing
by subsquid-labs Aug 11, 2026 5/10
skill GitHub

Paymob-AI-Integration-Skill: Official Payment Integration Skill for Claude Code

Paymob's official skill covering the Intention API, HMAC verification, mobile wallets, BNPL, and Apple Pay across Node.js, Python, PHP, Flutter, and more. Being first-party means the integration details stay current. A good example of a payment provider shipping agent-ready docs.

skillpaymentsofficialapiintegration
by PaymobAccept Aug 11, 2026 6/10
skill GitHub

agent-skills-collection: Curated Modular Skills for LLM Agents

A curated set of modular skills intended to be mixed and matched across LLM-based agents. Each skill is self-contained rather than part of a fixed pipeline. General-purpose collection.

skillscollectionmodular
by oliverb-io1902e8 Aug 11, 2026 5/10
skill GitHub

ai-video-generator-claude: 10 Skills for Studio-Quality AI Video Prompts

Ten Claude skills that generate structured video prompts for Seedance 2.0 on Higgsfield, spanning viral hooks, SaaS demos, personal brand, faceless content, and luxury aesthetic. Encodes prompt structure per format rather than leaving it freeform. Marketing-oriented rather than engineering-oriented.

skillsvideopromptscontentmarketing
by rediumvex Aug 11, 2026 5/10
skill GitHub

social-media-caption-generator-claude: Captions for Reels, TikTok, and Shorts

A skill that turns text, a script, or a screenshot into ready-to-post captions for Instagram Reels and Carousels, TikTok, Threads, Facebook, and YouTube Shorts. Tuned toward shares, saves, and completion rate per platform. Built by a creator with a large Instagram following.

skillsocial-mediacontentmarketing
by rediumvex Aug 11, 2026 5/10
skill GitHub

hormozi-sales-cold-outreach-claude: Offer Building and Cold Outreach Skills

Three skills encoding Alex Hormozi's frameworks: building offers, running a 0-to-$10M business playbook, and writing cold outreach. Turns a well-known business methodology into agent-callable steps. Business-oriented rather than technical.

skillsalesoutreachbusiness
by rediumvex Aug 11, 2026 5/10
skill GitHub

claude-codex-subagent: Run OpenAI Codex as a Subagent Inside Claude Code

A Claude Code skill plus watchdog runner that delegates tasks to OpenAI Codex (GPT models) as a subagent, with no background daemon required. Claude dispatches the work and the watchdog supervises the run and returns the result. Useful for cross-model second opinions or offloading work to a different model without leaving your session.

codexsubagentskillmulti-model
by caesay Aug 11, 2026 7/10
skill GitHub

claude-skills-czl: Drop-In CLAUDE.md Baselines, Skills, and Enforcement Hooks

An opinionated bundle of Claude Code configuration — CLAUDE.md baselines, skills, slash commands, and hooks that enforce the stated rules. It is meant to be copied into any project as a starting point rather than assembled piece by piece. A useful reference if you are standardizing setup across several repos.

claude-mdskillsslash-commandshooks
by Cristhianzl Aug 11, 2026 6/10
skill GitHub

ai-system-engineer-skill: Turn Messy AI Prototypes Into Structured Systems

An Agent Skill that applies systems-engineering discipline to prototype agent workflows, pushing them toward defined structure and explicit validation. It targets the stage where a working hack needs to become something maintainable. Installs as a skill rather than requiring a framework migration.

skillsystems-engineeringvalidationrefactoring
by Odinary-AI Aug 11, 2026 6/10
skill GitHub

cs-automation-skills: Eight Claude Code Skills for Customer Success

Eight Claude Code skills targeting enterprise customer success work: health scoring, QBR preparation, onboarding diagnostics, and punchout troubleshooting. A useful example of packaging non-engineering business processes as skills. Niche unless you work in enterprise CS.

skillscustomer-successenterpriseqbronboarding
by Prashanthvara Aug 10, 2026 5/10
skill GitHub

easy-prd-testing: PRD-Driven Automated Testing Skills with Execution Gates

A set of skills for Claude Code and Codex that drives automated testing from a PRD or prototype rather than from ad hoc prompts. Covers requirement clarification, test planning, execution gating, evidence collection, XMind mind maps, and regression runs. Documentation is in Chinese.

testingprdqaregressionchinese
by dszblackmagic Aug 10, 2026 6/10
skill Reddit

Opus 5 Resolves Contradicting CLAUDE.md Rules by Position, Not by Flagging

Report that when two instructions in CLAUDE.md conflict, Opus 5 silently commits to whichever appears later in the file and drops the earlier one, instead of wavering or raising the conflict. Older models tended to split the difference, which at least made the contradiction visible in the output. Practical takeaway: audit your instruction file for conflicts and put the rule you actually want lower in the file.

claude-mdopus-5instructionscontext-engineering
by cleverhoods Aug 10, 2026 7/10
skill GitHub

Helpful-Claude-Skills: Free Open Collection of Agent Skills for Claude

An open, freely licensed collection of Agent Skills that work in both Claude Code and Claude Desktop. Useful as a starting library if you want working skill examples to copy and adapt rather than authoring from scratch.

skillscollectionclaude-desktopopen-source
by jmadden Aug 10, 2026 6/10
skill GitHub

verifiable-agent-skills: 7 Skills to Stop AI Fabrication and Fake Completions

Seven methodology skills aimed at the failure modes where an agent invents data, reports work as done when it is not, or loses context when a session hands off. Each skill pushes the agent toward claims that can be verified and traced back to evidence. Bilingual Chinese and English documentation.

verificationhallucinationskillstraceabilitychinese
by billyzhou0-0 Aug 10, 2026 6/10
skill GitHub

htmldeck: Single-File HTML Decks via a 163-Rule Claude Code Design System

A Claude Code plugin that produces presentations as one self-contained .html file you can double-click and view with the network off. It enforces a 163-rule design system, runs a build check that names every rule it could not satisfy, and finishes with a deliberately blunt critique pass. Targets the problem of slides that visibly look machine-generated.

presentationshtmldesign-systempluginoffline
by uchimata2 Aug 10, 2026 7/10
skill GitHub

nestjs-hexagonal: Claude Code Plugin for DDD, CQRS, and Hexagonal NestJS

A Claude Code plugin for building NestJS bounded contexts using hexagonal architecture, DDD, CQRS, and event-driven patterns. Bundles 10 skills and 8 agents split across Opus and Sonnet, with a TDD workflow and GSD compatibility. Opinionated but concrete if you already work this way.

nestjsdddcqrshexagonaltddplugin
by Softtor Aug 10, 2026 6/10
skill GitHub

skill-email-html-mjml: Cross-Client HTML Email with MJML

A Claude Code skill that generates HTML email using MJML so the output survives real mail clients. Output is Outlook-safe, Gmail-optimized, and meets WCAG 2.1 AA accessibility. Removes most of the trial and error from hand-writing table-based email markup.

emailmjmlhtmlaccessibilityskill
by framix-team Aug 10, 2026 6/10
skill GitHub

personify: Revise Text to Keep Your Voice and Strip AI Writing Tells

A Claude skill that reviews and rewrites text to remove the stylistic tells of AI generation while preserving the author voice. Rather than a generic humanizer, it works from your existing writing as the reference point. Useful for anyone drafting with Claude but publishing under their own name.

writingstyleeditingskillvoice
by smartwatermelon Aug 10, 2026 7/10
skill GitHub

paperasse: AI Agent Skills for French Bureaucracy — Accountant, Notary

A collection of skills that give AI agents domain knowledge of French administrative processes, with specialized roles such as accountant and notary. Narrow in scope but a good template for how to package regional or regulatory expertise as agent skills. Documentation is in French.

skillsfrancebureaucracydomain-expertisefrench
by romainsimon Aug 10, 2026 5/10
skill Reddit

Slushpile: nine skills that model the applicant queue, not the job description

A plugin of nine Claude Code skills for job hunting that scores you against the other applicants in a req's queue rather than against the job description itself. An onboarding interview writes four files you keep (profile, preferences, stories, search state), and subsequent commands search job boards and tailor material against them. The argument is that a 91% JD match is a rejection if the queue's 75th percentile sits at 94%.

job-searchskillsresumeplugin
by aaddrick Aug 10, 2026 7/10
skill GitHub

handdrawn-ppt: turn one character image into hand-drawn presentation decks

A Claude skill that takes a single character illustration and produces a full hand-drawn-style deck around it, including research with cited sources plus charts, tables, and flow diagrams. Supports Korean and English.

slidesdesignkoreanresearch
by moongiadventures-dev Aug 10, 2026 5/10
skill GitHub

dream-skill: memory consolidation with snapshots and one-command rollback

Consolidates a project's accumulated agent memory in passes: a read-only 'dream' pass that only proposes, a checkbox and validator gate before anything is written, and a full-auto mode once you trust it. Every run snapshots first and rolls back with one command, and the tooling never calls rm.

memoryconsolidationsafetyrollback
by timoncool Aug 10, 2026 7/10
skill GitHub

klinko-content-strategy-builder: prioritize topics, formats, and channels

An agent skill for content strategy work: ranks the questions your audience actually asks, then maps them to topics, formats, channels, and where to invest. Business-side rather than engineering, but it is a real skill you can install.

content-strategymarketingplanning
by klinkoai Aug 10, 2026 5/10
skill GitHub

touchstone: build agent skills and prove they work with paired baseline evals

A toolkit for authoring agent skills for Claude Code, Codex, and OpenCode that pairs every skill with a baseline eval, so you can measure whether the skill actually changed behavior versus the model doing it anyway. That baseline comparison is the part most skill repos skip.

skillsevalstestingcodexopencode
by ecoma-io Aug 10, 2026 8/10
skill GitHub

mywholelife: self-managing long-term agent memory with a Claude Code boot skill

A persistent memory store plus a Claude Code skill that teaches the agent how to boot from it, recall relevant pieces, and consolidate new material at the end of a session. The skill half is what distinguishes it from a plain memory database.

memorypersistencecontext
by ChrisZhangJin Aug 10, 2026 6/10
skill GitHub

production-architecture-guardian: audits that never invent config numbers

A skill and subagent pair for production architecture work, auditing and designing for scalability, security, performance, and reliability. Its stated constraint is that it never fabricates a configuration number, which is the usual failure mode of architecture advice from LLMs.

architectureauditsubagentproduction
by dankofly Aug 10, 2026 6/10
skill GitHub

skill-tuner: verify a SKILL.md edit actually worked and still routes

Probes a SKILL.md, AGENTS.md, or CLAUDE.md to find out whether a change to it actually altered agent behavior, applies fixes that three independent skeptic passes agree on, and re-checks that the description still routes correctly. Treats agent-consumed documents as things you test, not things you hope about.

skillsevalsclaude-mdtesting
by StartupBros-com Aug 10, 2026 8/10
skill GitHub

handoff-prompt: compress a session into a handoff the next one can execute

Turns a finished agent session into a structured handoff document containing what was decided and what remains, so the next session can act without re-diagnosing the problem. A cheaper alternative to dragging a long transcript forward.

handoffcontextsessioncontinuity
by Xuepoo Aug 10, 2026 6/10
skill GitHub

i18n-guard: catch untranslated UI strings across 7 i18n stacks

A Claude Code skill that finds hardcoded UI strings that never made it into a translation catalog, and keeps catalogs in sync across seven different i18n frameworks. Exactly the tedious, mechanical check that agents are good at and humans skip.

i18ntranslationlintingfrontend
by omerfarukorc Aug 10, 2026 7/10
skill GitHub

reasonix_skill_repo: 12 self-contained skills from patent search to local OCR

Twelve independent agent skills covering patent search, document-to-skill conversion, web scraping, local OCR, project migration, Obsidian and OneNote note handling, remote deployment, and multi-machine sync. Each is self-contained, so you can take one without the rest.

skillsocrresearchobsidian
by Linearl Aug 10, 2026 6/10
skill GitHub

claude-skills-kit: 7 interconnected skills from prompt polishing to focus groups

Seven skills designed to work together: prompt polishing, an engineering workflow, web research, knowledge ingestion, an advisory board, and focus group simulation. The interconnection is the pitch, since output from one feeds naturally into the next.

skillsresearchpromptsworkflow
by Abed-Zahed Aug 10, 2026 6/10
skill GitHub

analyst-toolkit: BRD/NFR/ADR templates with skills that review against them

A requirements framework pairing BRD, NFR, and ADR templates with explicit quality rules, plus agent skills that both draft documents and review them against those rules. Templates and prompts are structured to stay in sync rather than drifting apart.

requirementstemplatesanalysisadr
by YuliaMelekhova Aug 10, 2026 6/10
skill GitHub

taste: learned coding preferences for Claude Code, stored as readable markdown

Captures your coding preferences from real signals during sessions and stores them as plain markdown you can read, edit, and delete, shared across a team over git. The readability and the delete path are what separate it from opaque memory systems.

preferencesmemorymarkdowngit
by toshon-jennings Aug 10, 2026 7/10
skill GitHub

Quant-Off skills: security audit marketplace for crypto and binary review

A Claude Code plugin marketplace of evidence-based security auditing skills, including constant-time crypto review, checks for whether mitigations survived compilation into the binary, and zero-trust codebase audits. Considerably more specialized than generic 'find vulnerabilities' skills.

securityauditcryptographymarketplace
by Quant-Off Aug 10, 2026 7/10
skill GitHub

authoring-kaltura-docs-skill: a Diátaxis documentation expert skill

An agent skill encoding Diátaxis documentation practice for Kaltura's docs, installable via Claude Code, GitHub Copilot, and Claude Desktop. Vendor-specific in its content, but a usable reference for how to encode a documentation framework as a skill.

documentationdiataxiswriting
by kaltura Aug 10, 2026 5/10
skill GitHub

saas-preflight: pre-ship audit for billing and data-isolation holes

A pre-ship audit skill for SaaS products that take money, targeting the billing and tenant data-isolation gaps that generic scanners miss on Next.js, Supabase, and Stripe stacks. Narrow stack focus is what lets it check things a general scanner cannot.

securitysaasstripesupabaseaudit
by Comoco235 Aug 10, 2026 7/10
skill GitHub

linkly-notes-skill: friction-free capture and verified recall for a personal KB

A note-taking skill for a personal knowledge base built around one-sentence capture, verified recall rather than hallucinated retrieval, and tags that grow out of your own notes instead of a fixed taxonomy. Bilingual Chinese and English.

notesknowledge-basememorychinese
by logog782-cmyk Aug 10, 2026 5/10
skill GitHub

prove-it: a claim taxonomy and protocol for catching false completions

Catalogs ten ways agents claim work is done when it is not, provides a taxonomy for classifying those claims, and defines a protocol for catching them before the change ships. Directly targets the most expensive agent failure mode.

verificationqualityprotocoltesting
by Nagacash Aug 10, 2026 7/10
skill GitHub

simplicio-sprint: read a Jira sprint, then verify it against repo architecture

A multi-agent skill that reads a sprint from Jira or Azure DevOps and then verifies the work against how the repository is actually structured, rather than taking the ticket description at face value. Works with Claude, Codex, Hermes, Openclaw, and Copilot.

jiraazure-devopssprintmulti-agent
by wesleysimplicio Aug 10, 2026 6/10
skill GitHub

research-bot: SDLC modernization skills for regulated environments

A Claude Code skill toolkit for teams modernizing SDLC under regulatory constraints, covering research digests, Copilot and GHAS governance, and an Obsidian-backed knowledge vault. Specific to regulated contexts, which most agent tooling ignores.

researchgovernanceobsidiancompliance
by themarmack Aug 10, 2026 5/10
skill GitHub

attention-span: ADHD-friendly output styles for Claude Code

Output styles that make agent responses easier to actually read: shorter, more human, structured for attention rather than completeness. Reduces token spend as a side effect of reducing verbosity.

output-stylesaccessibilityreadability
by alexgreensh Aug 10, 2026 6/10
skill GitHub

pm-tpm-skills: PRDs, roadmap prioritization, and build-vs-buy for PM/TPM work

A project-agnostic skill pack for product and technical program management: PRD generation, roadmap prioritization, build-versus-buy analysis, and TPM program mechanisms. Reusable across projects rather than tied to one codebase.

productprdroadmapprogram-management
by pavani-aiml-space Aug 10, 2026 5/10
skill GitHub

show-dont-tell: Claude Code Skill That Answers in ASCII Boards Instead of Prose

A Claude Code skill that reshapes responses into ASCII status boards, flow chains, and case matrices rather than long paragraphs. The goal is faster scanning of agent output when you want state and branching at a glance. A small, focused output-formatting skill.

skilloutput-formatasciireadability
by faridjaff Aug 10, 2026 6/10
skill GitHub

llm-sight-skill: PaddleOCR Wrapper Skill for Reading Image Text Without Vision

A Claude Code skill that wraps PaddleOCR so non-multimodal models can extract text from images. It fills the gap when you are running a text-only model but still need to read screenshots, scans, or diagrams. Documentation is bilingual (Chinese/English).

skillocrpaddleocrimagesvision
by BFRKQSB7 Aug 10, 2026 6/10
skill GitHub

ai-engineering-workflow-skills: Aggregated Canonical AI Engineering Skills

A curated aggregation of AI engineering workflow skills, collected into one installable repo. It serves as a starting pack for people who want established workflow patterns rather than authoring skills from scratch. Sourced from the maintainer's broader skills collection.

skillscollectionai-engineeringworkflow
by wakqasahmed Aug 10, 2026 5/10
skill GitHub

awesome-ai-agent-skills: 103 Complete SKILL.md Workflows, Not a Link List

A collection of 103 ready-to-use agent skills that ship as full SKILL.md workflows rather than pointers to other repos. The skills work across Claude Code, OpenAI Codex, Gemini CLI, Cursor, Copilot, Windsurf, and other Agent Skills-compatible tools. Useful as a browsable library when you want a working skill immediately.

skillscollectioncross-toolskill-md
by seb1n Aug 10, 2026 7/10
skill GitHub

writing-skills: Three-Step Rewrite Pipeline for AI-Drafted Prose

A set of Claude Code skills that rewrite AI-drafted prose through structural rewrite, tell removal, and cross-model diction passes, scored against the Pangram detector. It also includes reference management and citation auditing skills for research writing. Worth noting the detector-evasion framing is contentious in academic and publishing contexts.

skillswritingeditingcitationsprose
by petar-djukic Aug 10, 2026 5/10
skill GitHub

skills-vault-knowledge: Twenty Obsidian Knowledge-Work Skills for Claude Code

A set of twenty Claude Code skills for knowledge work in an Obsidian vault, including connect, contradict, emerge, trace, ghost, and weekly-learnings. They target synthesis over retrieval, surfacing contradictions and emergent themes across notes rather than just searching them. Useful if your notes live in Obsidian and you want an agent working the vault.

skillsobsidiannotesknowledge-worksynthesis
by slogsdon Aug 10, 2026 6/10
skill Reddit

Opus Pocus: Strip Legacy Prompt Incantations That Backfire on Opus 5

A plugin that removes instruction patterns written for weaker models, which the Claude 5 family now follows too literally: CRITICAL/YOU MUST shouting, verify-your-work charms, and Stop hooks that re-fire on unchanged state. The author's argument is that compensation written for an older model becomes a curse on a stronger one, producing death spirals and off-task behavior. Packaged so you can apply the cleanup to your own repo's memory files, hooks, and agent definitions.

pluginpromptingopus-5claude-mdhooks
by MickQn Aug 10, 2026 7/10
skill Reddit

graph-engineer: Automated Claude-to-Codex Write and Review Loop

A Claude Code skill that automates the manual copy-paste dance of writing with one model and reviewing with another. Claude drives the loop while Codex handles writing, review, and fixes. Requires the Codex plugin to be installed, and the author notes it is early-stage.

skillcodexreview-loopcross-model
by Ranteck Aug 10, 2026 6/10
skill GitHub

mastermind: Markdown Brain That Adds Judgment and Verification Discipline

An experimental markdown-based instruction layer for AI coding tools that pushes sharp defaults, explicit decisions, and verification before declaring work done. It targets Claude Code, Cursor, and Codex from one shared source, and is designed to refine itself over time as you use it. Flagged experimental by the author.

claude-mdpromptingcross-toolverification
by mehrad-dm Aug 10, 2026 5/10
skill GitHub

matrix-task: Requirements Matrices and Invariant Checks for Complex Tasks

An agent skill for Codex and Claude Code that decomposes complex coding work into a requirements matrix, then checks invariants and runs independent reviews before completion. The structure is meant to stop partial implementations from being reported as done. Works across both CLIs from the same skill definition.

skillrequirementsverificationreviewcodex
by JoeMarsh Aug 10, 2026 6/10
skill GitHub

indonesian-agent-skills: Compliance, Tax and Legal Domain Skills for Indonesia

A domain-intelligence skill pack for agents operating in the Indonesian business environment, covering compliance, tax, legal, and operational workflows. It is a useful example of encoding jurisdiction-specific knowledge into agent skills rather than relying on model recall. Niche by design, but a good template for other regions.

skillscompliancetaxlegalindonesia
by adamriofc Aug 10, 2026 5/10
skill Reddit

system-design-skill: arXiv-Backed System Design Before Claude Writes Code

An open-source Claude Code skill that forces a research pass before implementation: it searches arXiv for relevant papers, reads related work, and picks an architectural approach before any code is written. The author's argument is that agents default to building every service from scratch, which produces slow and fragile projects. Aimed at people who want design decisions grounded in prior art rather than improvised.

system-designarxivresearcharchitecture
by Uditakhourii Aug 9, 2026 6/10
skill GitHub

claude-code-power-pack: 12 Slash Commands, 4 Subagents, 3 CLAUDE.md Templates

A starter pack bundling twelve slash commands, four subagent definitions, and three CLAUDE.md templates aimed at real engineering workflows rather than demos. Good pick if you want a working baseline configuration to adapt rather than assembling one command at a time.

slash-commandssubagentsclaude-mdtemplates
by dacode-dev Aug 9, 2026 6/10
skill GitHub

agent-skills: Cross-Platform Skills for Codex and Claude Code

A skill and plugin distribution designed to install cleanly on both OpenAI Codex and Claude Code from one source. Useful if you switch harnesses and do not want to maintain two divergent copies of the same skills.

skillscross-platformcodexplugins
by ValentinNikolaev Aug 9, 2026 5/10
skill GitHub

graph-engineering (HM-Li): Design Multi-Agent Work as Dependency Graphs

A Claude Code skill for laying out multi-agent work as a dependency graph rather than a linear pipeline, so independent branches can run concurrently and only genuine dependencies serialize. One of several projects converging on graph engineering as a term.

multi-agentgraphorchestrationparallelism
by HM-Li Aug 9, 2026 7/10
skill GitHub

khazix-skills: Open-Source Agent Skills for Claude Code and 40+ Agents

A Chinese-language open-source skill collection covering goal definition (leader), code tidiness (neat-freak), analysis, and writing. Packaged to work across Claude Code, Codex, and a broad set of other agents.

skillscollectionchinesecross-platform
by KKKKhazix Aug 9, 2026 5/10
skill GitHub

Marginalia: A Claude Skill for PaperMC Plugin Development

A Claude Code skill and guided pathway for developing PaperMC (Minecraft server) plugins. Narrow domain, but the kind of API-specific grounding that stops an agent inventing method signatures.

minecraftpapermcplugin-devskill
by Y2Kwastaken Aug 9, 2026 5/10
skill GitHub

award-craft: Six Claude Code Skills for Awwwards-Level Landing Pages

A Claude Code plugin bundling six skills aimed at producing landing pages at the visual quality bar of Awwwards submissions. For people who find agent-generated marketing pages competent but generic.

designlanding-pagesfrontendplugin
by alanvaa06 Aug 9, 2026 6/10
skill GitHub

ship-it: Catch Forgotten UX and Product Details Before You Ship a Screen

A Claude Code skill that reviews a screen or feature for the product and UX details people routinely forget — empty states, error paths, loading, edge cases — before it ships. A checklist pass that costs one prompt.

uxreviewchecklistproduct
by LunkiBR Aug 9, 2026 6/10
skill GitHub

australian-accounting-skills: BAS, FBT, Division 7A and Month-End Close

Agent skills for Australian public-practice accounting covering BAS, FBT, Division 7A, Single Touch Payroll, month-end close, and workpapers. A clear example of encoding jurisdiction-specific professional rules as skills rather than trusting the model's recall.

accountingaustraliacomplianceskills
by ryanduguid Aug 9, 2026 5/10
skill GitHub

superpowers-safe: obra/superpowers With Five Mandatory Safety Gates

A safety-hardened fork of the widely used obra/superpowers skill library, keeping the same skills but adding a mandatory preflight with five hard gates before any skill runs. Defends the machine, hardware, budget, and data — relevant given how much superpowers can do unattended.

superpowerssafetygatesfork
by JFWaskin Aug 9, 2026 7/10
skill GitHub

advise-project-approach: Research Comparable Projects Before Advising

A Claude and Codex skill that forces an agent to research comparable projects, tradeoffs, costs, and failure conditions before it recommends how to build something. Counters the tendency to answer architecture questions from priors alone.

researcharchitectureadviceskill
by AaravKashyap12 Aug 9, 2026 6/10
skill GitHub

osint-verifier: Admiralty-Graded Source Verification Subagent for Claude Code

A free OSINT source-verification subagent written by a former intelligence analyst: it grades every source with the Admiralty system, flags single-source and uncited claims, catches circular reporting, and returns a calibrated verification note. Applies well beyond OSINT to any research an agent does.

osintverificationresearchsubagent
by beeswaxpat Aug 9, 2026 7/10
skill GitHub

mobile-adapt-skill: Audit and Adapt Web Apps for Mobile Devices

A skill that audits a web application for mobile issues and applies the adaptations. Narrow and practical for the common case of a desktop-first build that needs to work on phones.

mobileresponsiveauditfrontend
by lovstudio Aug 9, 2026 5/10
skill GitHub

install-tanstack-query-skill: Install and Configure TanStack Query

A single-purpose skill that installs and configures TanStack Query in a React project. The value of skills like this is getting current, correct setup rather than whatever version the model remembers.

reacttanstack-querysetupskill
by lovstudio Aug 9, 2026 5/10
skill GitHub

multi-model-routing-skill: Route Grunt Work to Local LLMs and Codex

A Claude Code and Cowork skill that routes batch and grunt work to local LLMs via Ollama or LM Studio, to Codex CLI, or to Claude subagents, keeping your quota for work that needs it. Routing is per-task rather than per-session.

routingollamalocal-llmquota
by scottconverse Aug 9, 2026 6/10
skill GitHub

superpowers-zh-tw: Full Traditional Chinese Translation of Superpowers

A complete Traditional Chinese translation of obra/superpowers — fourteen coding-agent skills — published with a GitHub Pages site offering paragraph-by-paragraph bilingual reading. Useful both as a translation and as a way to study the originals closely.

superpowerstranslationchineseskills
by shumingyang-opencode Aug 9, 2026 5/10
skill GitHub

cf-scraper: Web Scraping via Cloudflare Browser Rendering, No Infra

A Claude skill for web scraping and page analysis through the Cloudflare Browser Rendering API, returning rendered HTML, screenshots, PDFs, Markdown, structured data, and crawls. No browser infrastructure to run yourself.

scrapingcloudflarebrowserskill
by TempoRoyale Aug 9, 2026 6/10
skill GitHub

wix-to-astro: Migrate a Wix Site to Astro on Cloudflare With an Agent

A Claude skill and playbook for migrating a full Wix site to Astro on Cloudflare Workers, aiming for pixel-faithful output with measured results and stronger SEO than the original. Specific enough to be genuinely reusable if you have that migration ahead of you.

migrationastrowixcloudflare
by marian-kamenistak Aug 9, 2026 6/10
skill GitHub

craft-prompt-forge: Forge a Vague Idea Into a Craft-Grade Build Prompt

A bilingual Claude skill that turns a rough one-sentence idea into a detailed build prompt intended to get near-finished quality on the first attempt. Front-loads the specification work you would otherwise do through several rounds of correction.

promptingspecificationskillchinese
by dittowang Aug 9, 2026 6/10
skill Reddit

backend-setup-wizard: Provision Real Backends via CLI, No Placeholder Keys

An Agent Skill in the open SKILL.md format that provisions real backend services — Stripe, Postgres and similar — via their CLIs instead of hallucinating commands or quietly setting up a sandbox and calling it done. It asks for existing credentials first, looks up current official docs with the actual date, writes secrets only to .env, checks or creates .gitignore, and never prints keys back to the terminal.

backendprovisioningsecretsskill
by MonitorFlat4465 Aug 9, 2026 7/10
skill GitHub

art-direction-skill: Derive a Visual Concept, Then Audit the Build Against It

A Claude Code skill for interfaces with a visual identity of their own: derive the concept from the subject matter, write it to disk as an artifact, then audit the built UI against it. Writing the concept down first is what makes the audit step meaningful.

designart-directionuiaudit
by audient-id4 Aug 9, 2026 6/10
skill GitHub

traceknot: ISTQB-Aligned, Auditable QA Verdicts for Coding Agents

Makes coding-agent QA auditable with an ISTQB-aligned skill, traceable evidence, and deterministic verdicts, working across Codex, Claude Code, OpenCode, and other harnesses. The ISTQB grounding gives the verdicts a standard to point at in a regulated setting.

qatestingistqbaudit
by Jin-Doh Aug 9, 2026 6/10
skill GitHub

slide-forge: Generate Google Slides Decks With Offline Layout Checks

A Japanese-language Claude Code plugin for generating diagram-heavy Google Slides decks that inspects coordinates offline before generation, catching overflow, overlap, text spill, and disconnected connectors without calling the API. The offline check is the clever part — layout bugs get caught before you burn API calls.

slidesgoogle-slideslayoutjapanese
by wfukatsu Aug 9, 2026 6/10
skill GitHub

sovereign-ui: Build, Review, and Repair Production UI With Design Judgement

A Claude Code skill for product design engineering that builds, redesigns, reviews, and repairs production UI with actual design judgement, adapting to your codebase rather than imposing a template. Covers web, Android, Apple, desktop, and cross-platform targets.

uidesignfrontendcross-platform
by aliimrankhan86 Aug 9, 2026 7/10
skill GitHub

adversarial-review: Multi-Model Review With a Computed Release Verdict

A portable agent skill running multi-model adversarial code review and producing a deterministic, machine-computed release verdict rather than a prose opinion. Works with Claude Code, OpenAI Codex, and any SKILL.md-compatible platform.

code-reviewmulti-modeladversarialrelease
by SathiaAI Aug 9, 2026 7/10
skill GitHub

oceneni-nemovitosti: Czech Property Valuation and Negotiation Skill

A free Czech-language Claude Code skill for property valuation and price negotiation: three valuation methods, a guide to the land registry, and a negotiation playbook. A good example of local, jurisdiction-specific domain knowledge packaged as a skill.

real-estatevaluationczechskill
by konecny-lukas Aug 9, 2026 5/10
skill GitHub

apple-bento-grid: Apple-Style Bento Grid Cards as Self-Contained HTML

Generates Apple-style bento grid cards as self-contained HTML files, built for AI coding agents to produce pixel-accurate output with no design tools involved. Narrow but effective for a layout pattern models routinely get slightly wrong.

designhtmlbento-gridlayout
by NxProxyStudios Aug 9, 2026 5/10
skill GitHub

ai-media-generator: Director-Grade Prompts Across 14+ Generative Platforms

A Claude Code skill for crafting high-quality AI image, video, and music prompts and executing them through the browser across more than fourteen generative platforms. Packages director-level prompt craft so you do not need it yourself.

mediapromptingvideoimage-generation
by Hao0321 Aug 9, 2026 5/10
skill Reddit

Greenbatch: Run Each Dependency Update Through Your Gates, Then One PR

A skill that tests each dependency update individually against your CI gates and then opens a single consolidated PR. Written out of frustration with Dependabot opening several PRs a week, each triggering a full pipeline run and, with continuous deployment, a separate deploy. The per-update testing is what keeps the single PR trustworthy.

dependenciescipull-requestsautomation
by Anaq42 Aug 9, 2026 7/10
skill GitHub

open-visualization-protocol: 74 Chart Skills Across 16 Design Languages

An open protocol for describing, validating, and rendering information design identically for humans, software, and AI agents on any platform, with 74 chart skills across 16 design languages. Ambitious in scope; the validation step is what would make agent-generated charts consistent.

visualizationchartsprotocoldesign
by babarda Aug 9, 2026 6/10
skill GitHub

mac-to-windows-testing-skill: Build and Test Windows Apps From a Mac

Lets an AI running on a Mac build, operate, inspect, repair, and retest desktop applications on a real Windows PC. Solves a genuine cross-platform gap where the agent otherwise cannot see the target environment at all.

windowsmacostestingcross-platform
by wimi321 Aug 9, 2026 6/10
skill GitHub

genesis-architect: Mine GitHub Issues for Failures Before Scaffolding

Research-first project scaffolding for Claude Code that mines GitHub Issues for real production failures in comparable projects before writing a single file. Grounds early architecture decisions in what actually broke for other people.

scaffoldingresearchgithub-issuesarchitecture
by maioio Aug 9, 2026 7/10
skill GitHub

claude-skills-vetted: Curated Claude Skills That Were Read and Tested

A curated skill list where each entry is read in full, trimmed of Claude Code-only dependencies, checked against claude.ai's upload requirements, and labeled by where it actually works, with ready-to-download zips. The vetting is the value — most skill lists are link dumps.

skillscurationvettedclaude-ai
by Zephyrex21 Aug 9, 2026 6/10
skill Reddit

pi-research: A Web Research Skill Built Around Injection Risk and Sourcing

An agent skill for web research and knowledge lookup, alongside a writeup on why default agent browsing is both risky and inefficient. Covers prompt injection from hostile pages — the example given is a site whose robots page instructs agents to delete things — and argues for a dedicated research path over ad-hoc fetching. Originally built for the Pi coding agent, now used mainly in Claude.

researchwebprompt-injectionsecurity
by JaspreD Aug 9, 2026 6/10
skill Reddit

security-hardening-wizard: A Security Audit Skill That Applies the Fix

Scans every file in a project — not just source, since secrets and misconfiguration show up in READMEs, CI YAML, Dockerfiles, and old notes — using real scanners like gitleaks, npm audit, and pip-audit plus manual review for injection risks, weak CORS, and missing auth. It then applies the fix directly in code rather than filing a report. Honest about the case it cannot fix: a secret already exposed in git history.

securityauditsecretsremediation
by MonitorFlat4465 Aug 9, 2026 7/10
skill GitHub

tutorial-creator: Generate Personalized Coding Lessons From Your Codebase

A Claude Code skill that generates coding lessons from your own repository across three surfaces (tutorial, vocabulary, status), with six writing-to-learn entries and six venue templates for audience-facing output. Useful for onboarding people onto an unfamiliar codebase.

learningonboardingdocumentationskill
by Terryc21 Aug 9, 2026 6/10
skill Reddit

Proven-Viral-Content-System: A Skill That Generates Meme and UGC Promos

A free skill that interviews you about your product, target audience, and competitors, then suggests and generates viral content ideas for posting across socials. The author reports 10M+ views, 80k visits, and 500+ signups in a week at roughly $0.40 per video — self-reported numbers worth treating as such.

marketingcontentugcgrowth
by swaroopmehetar Aug 9, 2026 5/10
skill GitHub

decision-ledger: Three Skills That Record Decisions You Could Defend

Three Claude Code agent skills that capture which structural decisions you could actually defend and hand them back as a map of your project. Filters for defensible decisions rather than logging everything indiscriminately.

decisionsarchitecturedocumentationskills
by Dupflo Aug 9, 2026 6/10
skill GitHub

groundschool-skill: Turn a Repo Into a Course With Exams and Code Anchors

A Claude Code skill that reads a repository and writes a course about it: tracks, checklists, flash decks, exams, and code anchors that open your editor at the relevant line, presented as a local-first dashboard that remembers your progress.

learningonboardingdashboardskill
by brickster241 Aug 9, 2026 6/10
skill GitHub

reactbits.dev-skill: Fetch Real React Bits Source From the Live Registry

A Claude Code skill that pulls actual React Bits component source from the live registry rather than reconstructing it from model memory. The same pattern — fetch, do not recall — applies to any fast-moving component library.

reactcomponentsregistryskill
by Philotheephilix Aug 9, 2026 6/10
skill GitHub

get-cited-by-ai: Skill for Getting Cited by AI Search Engines

A Claude Code skill implementing a demand-gated GEO (generative engine optimization) workflow. Every rule in it is evidence-tagged against a corpus of 26,767 measured citations, so recommendations trace back to observed data rather than SEO folklore.

seogeocontentskill
by paultaki Aug 8, 2026 7/10
skill GitHub

ai-market-research-skills: Six Evidence-Led Market Research Skills

Six skills covering audience discovery, market validation, positioning and content strategy, each structured to work from evidence rather than assertion. Works in both Claude Code and Codex.

market-researchskillspositioningcontent-strategy
by klinkoai Aug 8, 2026 6/10
skill GitHub

Ai-Stack: Daily-Driver Agent Skills Installable With npx skills add

A collection of the agent skills an engineer reaches for day to day, packaged so each installs with a single 'npx skills add' command. Low-ceremony way to pick up individual skills without cloning a whole repo.

skillscollectionnpx
by nazmulnahid-git Aug 8, 2026 5/10
skill GitHub

temper-skills: Test Suites for Your Agent Skills' Decision Logic

Adversarial persona reviewers write test suites against a skill's decision logic, then deterministic Python is generated that must keep passing them - with zero LLM calls at inference time. Try it with 'uvx temper-skills audit <skill.md>'. A rare attempt to make skill behavior verifiable instead of vibes-checked.

testingskillsdeterminismaudit
by CyrilLeMat Aug 8, 2026 8/10
skill GitHub

catalyst-search-skill: Bilingual Catalysis Literature Search for Agents

A bilingual (English/Chinese) skill for searching catalysis literature, usable from Claude Code, OpenClaw, Hermes, Cursor and WorkBuddy. Narrow domain, but a clean example of packaging a research search workflow as a portable skill.

researchchemistryliteraturebilingual
by ANDYPENG09 Aug 8, 2026 5/10
skill GitHub

deep-structural-analysis-skill: 16-Lens Toolkit for Complex Questions

A multi-disciplinary analysis skill for social, economic, philosophical and systemic questions: 16 lenses, 10 structural tools and an attack-loop protocol that deliberately assaults the analysis's own priors. Bilingual and MIT licensed.

analysisreasoningbilingualskill
by tetckx Aug 8, 2026 5/10
skill GitHub

pinescript-plugin: Pine Script v6 Skills and MCP With a Real Validator

Pine Script v6 skills plus MCP tooling for coding agents, backed by an actual validator rather than prose guidance - generated scripts get checked instead of assumed correct. Aimed at TradingView indicator and strategy work.

pinescripttradingmcpvalidation
by jpantsjoha Aug 8, 2026 6/10
skill GitHub

bioinformatics-agent-skills: Genomics, Drug Discovery and Multi-Omics

A large open collection of scientific agent skills, tool specifications and prompt protocols for bioinformatics, genomics, drug discovery and multi-omics work. Compatible with Cursor, Claude Code, Antigravity and LangChain.

bioinformaticsgenomicsscienceskills
by YuliaNuzhnenko Aug 8, 2026 6/10
skill GitHub

biomedical-ai-skills: Agent Skills for Cancer Biology and Multi-Omics

A focused set of agent skills for cancer biology and multi-omics research, covering the analysis steps a lab actually repeats. Narrower than the general bioinformatics collections and correspondingly more opinionated.

biomedicalcancermulti-omicsskills
by zamushwani Aug 8, 2026 5/10
skill GitHub

ai-skills: Native CLI for Installing and Syncing Agent Skills

A native CLI for managing reusable prompt skills across AI coding agents, with install, list, read, update, sync and remove commands working over both project-local and global skill directories.

cliskillspackage-manager
by kevin-lee Aug 8, 2026 6/10
skill GitHub

codebase-cleanup: Three-Phase Dead Code and Module Consolidation Skill

A Portuguese-language Claude Code skill that cleans a codebase in three phases - removing dead code, consolidating shallow modules and reorganizing folders - with atomic commits per step and a test gate between phases.

refactoringcleanupskillportuguese
by CRangelP Aug 8, 2026 6/10
skill GitHub

biodiscovery-skills: Thinking Tools for Life-Science Discovery

Skills framed as thinking tools rather than task runners, for agents helping make discoveries in the life sciences. Focused on how to reason about a research question, not just how to run the pipeline.

sciencediscoveryskillsresearch
by dekan-aleksandr Aug 8, 2026 5/10
skill GitHub

superpowersplus: Spec-Driven Development Where Claims Cite file:line

A Superpowers-derived (MIT) spec-driven workflow with one hard rule: every claim the agent makes carries a file:line citation, and verifier steps re-run the search to confirm it. Pitched at non-programmers as well as developers.

spec-drivenverificationcitationsskills
by rodrigopaitach Aug 8, 2026 7/10
skill GitHub

databricks-agent: 17 Skills Over Unity Catalog, DLT and Spark SQL

The Databricks adapter for a platform-portable analytics delivery doctrine: 17 Claude Code skills plus a CLI covering Unity Catalog, DLT and Spark SQL. Sibling project to powerbi-agent.

databricksdata-engineeringskillssql
by santoshkanthety Aug 8, 2026 6/10
skill GitHub

powerbi-agent: 45 Skills for TOM, TMDL, PBIR and Fabric REST

The Power BI adapter for the same portable analytics doctrine: 45 Claude Code skills plus a CLI over TOM, TMDL, PBIR and the Fabric REST API, drawn from 20+ years of regulated, high-volume BI delivery.

powerbibiskillsfabric
by santoshkanthety Aug 8, 2026 6/10
skill GitHub

britcheck: Skill That Scores Whether AI Images Actually Look British

A small Claude Code skill that rates AI-generated images on how convincingly British they look, taking the minimum of two scores and shipping at 8 or above. Silly domain, but a tidy pattern for min-of-two-judges scoring gates.

image-evalscoringskillfun
by Theo7777 Aug 8, 2026 5/10
skill Reddit

Do You Write Your CLAUDE.md Yourself? This Author Doesn't

Amid the wave of Opus 5 complaints, the author reports no quality drop at all and suspects the difference lies in how project instructions are written. Their approach: don't hand-author CLAUDE.md - have the model produce and maintain it. A useful counterpoint on where perceived model regressions actually come from.

claude-mdconfigurationdiscussion
by minaminonoeru Aug 8, 2026 6/10
skill GitHub

bestdeejay/agent-skills: Skill Collection With Manifests and CI Checks

A skill collection covering github-repo-hygiene, test-graphics, reddit-karma, presentation-maker and docs-system, each shipped with a skill.json manifest, CI validation and full documentation rather than a bare markdown file.

skillscollectioncimanifests
by bestdeejay-design Aug 8, 2026 5/10
skill GitHub

ecom-a11y-audit: WCAG 2.2 AA Audits for Shopify Stores

An agent skill that scans a Shopify store for WCAG 2.2 AA issues, attributes each finding to the theme or to an installed app, and prioritizes the fixes. The theme-vs-app attribution is the part generic accessibility scanners miss.

accessibilityshopifywcagaudit
by kgelster Aug 8, 2026 6/10
skill GitHub

jurisdiction-latam: LATAM Legal Data Packs With Sourced, Dated Lines

A jurisdiction layer for Claude covering Latin America: neutral skills plus per-country legal data packs where every line carries its official source and a date. Explicitly not a substitute for a lawyer.

legallatamskillsspanish
by Danielmc09 Aug 8, 2026 5/10
skill GitHub

de-anthropocentric-research-engine: 900+ Markdown Research Skills

A large pure-markdown skill library for autonomous research, organized into 9 composable packages across a 4-layer hierarchy (Campaign, Strategy, Tactic, SOP). It supports non-linear orchestration with backtracking and wires in 6 MCP integrations including Semantic Scholar. Aimed at letting the agent drive literature review and hypothesis generation while you set direction.

skillsresearchorchestrationmcpliterature-reviewmarkdown
by yogsoth-ai Aug 8, 2026 8/10
skill GitHub

youtube-to-article: YouTube and Podcast Transcripts to Chinese Longform

A Claude Code skill that converts YouTube videos and podcasts into detailed Traditional Chinese articles, running fully local and offline with no API key required. It does chapter-aligned chunking plus a quality self-check pass, and can derive mind maps, highlight cards and self-quiz cards from the same transcript. Useful mainly for zh-TW users doing deep reading of video content.

skillyoutubetranscriptiontraditional-chineseoffline
by final90006-sketch Aug 8, 2026 5/10
skill GitHub

codeck: Generate Slide Decks from Claude Code Without Manual Layout

A Claude Code skill that turns written content into finished presentation decks, exporting to PPTX and related slide formats. The pitch is removing the manual parts of deck building — no Keynote, no dragging boxes around, no picking font sizes. Python-based and one of the more popular deck-generation skills at 200+ stars.

skillslidespptxpresentationsdocument-generation
by hiyeshu Aug 8, 2026 7/10
skill GitHub

academic-de-llm: Strip the Tells That Make Prose Read as Machine-Written

A ruleset for removing the stylistic markers that give away agent-written text, ordered by how often each marker actually shows up in measured samples — formatting habits first, older paste-era artifacts last. Claims are sourced, and anything unsourced is explicitly labelled as such. Handy as a final editing pass over drafts an agent produced for you.

writingeditingprosestyleacademic
by tae898 Aug 8, 2026 6/10
skill GitHub

wsqskills: Claude Code Skills and Hooks for WSQ Courseware Authoring

A bundle of skills, slash commands, subagents, and hooks aimed at producing WSQ training material — slide decks, lesson plans, learner guides, and assessments — against one academy's house standards. Very domain-specific to Singapore vocational courseware, but it is a concrete worked example of encoding a document house style into a Claude Code plugin.

skillshooksslash-commandscoursewaredocument-generation
by tertiarycourses Aug 8, 2026 5/10
skill GitHub

agent-skills: Autonomous Issue Runners, Adversarial Gates, and Parallel Bug Hunts

A personal collection of Claude Code skills, steering rules, and multi-agent workflows. The distinctive pieces are autonomous issue runners that pick up tickets end to end, adversarial review gates, and parallel bug-hunting fan-outs. Worth a look if you are designing your own multi-agent review patterns.

skillsmulti-agentcode-reviewautomation
by roufmlp Aug 8, 2026 5/10
skill GitHub

Zero-Lero: Strip Telltale AI Writing Patterns from Brazilian Portuguese Text

A skill that removes the giveaways of AI-generated pt-BR prose: filler openers like "e importante ressaltar", forced binary contrasts, and overuse of gerunds. It is calibrated against a corpus of real human writing rather than generic style rules. Niche, but a useful reference if you are building language-specific editing skills.

writingportugueseeditingskill
by ViniciusStanula Aug 8, 2026 5/10
skill GitHub

ea-skills: The Enterprise-Architecture Lifecycle as Agent Skills over a Deterministic Core

Turns unstructured architecture input into validated ArchiMate 3.2 models, generated views, and ISO 42010 documentation, all versioned in git. The agent skills sit on top of a deterministic core so the outputs are checkable rather than improvised. Aimed at teams that need living architecture governance instead of stale diagrams.

architecturearchimategovernanceiso-42010skills
by dithiothreitol Aug 8, 2026 6/10
skill GitHub

linkedin-animated-infographics: Deterministic Looping GIF Infographics from a Claude Skill

A Claude skill paired with a CLI pipeline that designs and renders lightweight looping GIF infographics sized for LinkedIn. Rendering is deterministic, so the same input produces the same output rather than a fresh improvisation each run. Includes RTL and Arabic text support.

infographicsgiflinkedinrenderingrtl
by imMamdouhaboammar Aug 8, 2026 6/10
skill GitHub

ConsolePlus-PromptPlus Plugin: Pick the Right .NET Console Control Without Guessing

A plugin that guides Claude Code through building .NET console apps with the ConsolePlus/PromptPlus libraries. It determines the correct layer, checks whether interactive controls can actually run in the target context, and narrows 21 available controls to the right one. Removes a class of API-choice mistakes an agent would otherwise make blind.

dotnetconsolepluginlibrary-guidance
by FRACerqueira Aug 8, 2026 5/10
skill GitHub

QAIA: Turn a User Story into an ISTQB Gherkin Test Book and Playwright Tests

Agentic QA for Claude Code that takes a user story and produces an ISTQB-grounded Gherkin test book plus runnable Playwright tests. It is delivered as markdown skills only, with no shipped code and no API key required. Attractive if you want test generation grounded in an actual testing standard.

qatestinggherkinplaywrightistqbskills
by QAIA-Project Aug 8, 2026 7/10
skill GitHub

rockfish-skills: Claude Skills for the Rockfish Synthetic Data SDK

A set of Claude skills covering the Rockfish synthetic data SDK. It gives the agent working knowledge of the SDK's API so it can generate and manipulate synthetic datasets without guessing at call signatures. Relevant mainly if you already use Rockfish.

skillssynthetic-datasdkvendor
by Rockfish-Data Aug 8, 2026 5/10
skill GitHub

workflow-secretary-suite: Skills That Keep a Project Record and Roadmap Honest

A suite of Claude Code skills for maintaining the project record, roadmap, documentation, and tooling. It deliberately stays out of the coding itself, acting as a secretary to the work rather than doing the work. A good fit if your docs drift out of sync with what was actually built.

documentationroadmapproject-managementskills
by qupunto Aug 8, 2026 6/10
skill GitHub

capforge: Just-in-Time Capability Forge for Coding Agents

Builds agent capabilities on demand instead of preloading everything into the system prompt. The idea is to keep startup context small and forge the specific capability when a task actually needs it.

capabilitiescontextjust-in-time
by SuperMarioYL Aug 7, 2026 5/10
skill GitHub

atlassian-browser-skills: Jira and Confluence Without an API Token

Reads and writes Jira and Confluence through your already-logged-in local browser (Safari, Chrome, or Edge) instead of the API. Built for corporate environments where security policy blocks the Atlassian MCP and API tokens.

jiraconfluencebrowseratlassianenterprise
by baekchangjoon Aug 7, 2026 7/10
skill GitHub

COG-second-brain: 33 Skills, 10 Agents, and a V-Model Verification Loop

A self-evolving second brain with skills, agents, and a people CRM, built around a closed-loop harness where the worker never grades its own homework. Includes paired anti-slop design skills for marketing and product UI. Works with Claude Code, Cursor, Kiro, Gemini CLI, and Codex.

second-brainskillsverificationcrm
by huytieu Aug 7, 2026 6/10
skill GitHub

skillmaxx: Auto-Detect and Install the Right Skills for Your Stack

Scans your project, ranks relevant agent skills with calibrated weights, removes near-duplicates via content similarity, and installs them with no configuration. Supports Cursor, Claude Code, Copilot, and other agents.

skillsinstallerdiscoveryautomation
by luckdevx Aug 7, 2026 7/10
skill GitHub

Ontotect: Ontology Engineering Skill for Design Through Governance

A skill covering the full ontology lifecycle: design, construction, review, repair, optimization, refactoring, validation, and governance. Niche, but thorough if you work with knowledge graphs or formal domain models.

ontologyknowledge-graphmodeling
by Moonweave-AI Aug 7, 2026 5/10
skill GitHub

simon-says: Playground Rules for Exact Execution and Less Bloat

A rule set covering exact execution, defensive testing, debugging, and alignment, aimed at making AI builders more predictable. Mainly a curated set of behavioral constraints you can drop into a project.

rulestestingdebuggingalignment
by jawsublime-byte Aug 7, 2026 5/10
skill GitHub

sales-framework: Seven Sales Principles as a Claude Code Skill

Packages a 20-year sales veteran's seven-principle framework plus CXO dealmaker insights into a Claude Code skill. Built by KudoMetrics for founders and sales teams working out of the terminal.

salesbusinessframework
by KudoMetrics-Techologies-Private-Limited Aug 7, 2026 5/10
skill GitHub

dig-deeper: Turn a Real Experience Into Social Content via Interview

A Claude Code skill that runs a guided interview over one of your actual experiences and turns the answers into social media content. The interview step is the point, since it keeps the output grounded in something that happened.

contentsocial-mediainterviewwriting
by felixofabio Aug 7, 2026 5/10
skill GitHub

security-review: Run Real Scanners, Then Verify Findings Against Source

A Claude Code skill that runs Semgrep, gitleaks, TruffleHog, Trivy, osv-scanner, and ZAP, then checks each finding against the actual source before reporting it. Covers SAST, secrets across full git history, SCA, IaC, and Supabase/Firebase RLS, in one report tagged to OWASP Top 10 2025.

securitysastsecretsowaspscanners
by cdmx-in Aug 7, 2026 8/10
skill GitHub

ai-audit-skill: Evidence-Backed Audit and Signed Release Approval

An audit workflow for AI-built software covering requirements, tests, evidence, and stated limitations, ending in a signed release approval. Includes iOS and MASVS coverage for mobile work.

auditevidencereleaseiosmasvs
by goonobu-dot Aug 7, 2026 5/10
skill GitHub

gauntlet-loop: Fresh Builder/Critic Rounds With Resumable Proof

An evidence-driven skill that alternates fresh builder and critic rounds against project context, keeping proof resumable across rounds and enforcing integration gates. Works with both Codex and Claude Code.

builder-criticevidencegatesresumable
by Yash-1511 Aug 7, 2026 6/10
skill GitHub

feature-sliced/skills: Official Agent Skills for Feature-Sliced Design

Agent skills for applying Feature-Sliced Design v2.1 in frontend projects, published by the Feature-Sliced organization itself. Worth having if your frontend already follows FSD and you want an agent to respect the layer boundaries.

fsdfrontendarchitectureskills
by feature-sliced Aug 7, 2026 7/10
skill GitHub

news-reviewer: News Item to Briefing With Devil's-Advocate Questions

A Claude Code skill that converts a news item into a research briefing: verified facts, historical parallels, and questions arguing the other side. The devil's-advocate step is what keeps it from being a summarizer.

researchnewsbriefingcritical-thinking
by mertcanciy Aug 7, 2026 5/10
skill GitHub

arena: Token-Driven Design System Built to Be Operated by Agents

A design system for React, Angular, and Tailwind shipped as two npm packages plus a Claude Code plugin and an Agent Skill. Designed so an agent can drive the tokens directly rather than guessing at your visual language.

design-systemtokensreacttailwindplugin
by dravensoft-dev Aug 7, 2026 6/10
skill GitHub

gophers: 26 Production-Grade Go Skills for Claude Code and Beyond

A set of 26 Go-focused skills covering production concerns, usable from Claude Code, Gemini CLI, and opencode. Worth a look if your agent keeps writing Go that compiles but does not read like Go.

goskillsproductionbackend
by muratmirgun Aug 7, 2026 7/10
skill GitHub

ai-video-prompt-skills: 31 Skills for Kling, Seedance, and Veo

A set of 31 Claude Code skills for prompting image-to-video models, written from production A/B measurements rather than intuition. The measurement provenance is what separates it from the usual prompt-tip lists.

videopromptingklingveoab-testing
by kanno321-create Aug 7, 2026 6/10
skill GitHub

agile-ledger: Plain-Markdown Scrum From Ideas to Releases

A product management skill that keeps ideas, backlog, sprints, releases, and bug tracking in plain Markdown inside the repo, driven by slash commands. Product management lives next to the code instead of in another tab.

product-managementscrummarkdownslash-commands
by nunoamorim99 Aug 7, 2026 6/10
skill GitHub

korean-writing: Fix the Awkward Korean That AI Writes

A Claude Code plugin that prevents translation-ese, AI slop, and double passives in Korean through rule skills, with a hook that automatically catches the obvious AI patterns.

koreanwritinglintinghooki18n
by HarryJhin Aug 7, 2026 6/10
skill GitHub

guide-your-ai-art: Diagnose the Output Instead of Rewriting the Prompt

Measures what an AI-generated image actually produced and diagnoses from there, rather than the usual loop of tweaking the prompt and hoping. Also covers getting the result onto a real app surface.

image-generationdiagnosticsdesignmeasurement
by wan-huiyan Aug 7, 2026 5/10
skill GitHub

CrowdStrike fusion-skills: Official Skills for Falcon Fusion Workflows

CrowdStrike's own agent skills for building Falcon Fusion workflows: action discovery, YAML authoring, deployment, execution monitoring, and best practices for triggers, conditions, loops, and HTTP Actions. Notable as a vendor-published skill set.

crowdstrikesecuritysoarofficialyaml
by CrowdStrike Aug 7, 2026 7/10
skill GitHub

awesome-chinese-ai-tools: 116 Verified Chinese-Language Skill Packs

A library of 116 skill packs, 57 in Chinese and 11 original to the project, all verified as real, plus a directory of 47 AI tools with links tested daily. The verification claim is the differentiator among skill-list repos.

skillschinesecollectioncurated
by sanhuang520-ship-it Aug 7, 2026 5/10
skill Reddit

Using ASD-STE100 Simplified Technical English to Curb Verbose Output

A CLAUDE.md block that asks for Simplified Technical English on coding work: sentences under 20 words, active voice, one instruction per sentence, one meaning per word, no idioms, explicit articles. Scoped to chat reports, PR titles and descriptions, and issue comments rather than everything.

claude-mdwritingverbositystyleste100
by henrypoydar Aug 7, 2026 6/10
skill GitHub

skills-agro: Agronomy Skills for Claude Built on Brazilian Standards

Agronomic skills encoding the Brazilian 5a Aproximacao (CFSEMG/MG) and Boletim 100 (IAC/SP) fertilizer recommendation standards. A good example of an agent skill built around a real domain reference rather than general advice.

agronomybrazildomain-skillportuguese
by guilherme-iaparaagronomos Aug 7, 2026 5/10
skill GitHub

brand-asset-art-director: Text-Free Image Prompts With Overlay Specs

Generates text-free image prompts plus overlay specifications for any brand asset, with adapters for Midjourney v7, FLUX, GPT-image, and SDXL. Keeping text out of the render and in the overlay is the useful part.

brandingimage-generationmidjourneyfluxdesign
by ChloeVPin Aug 7, 2026 5/10
skill GitHub

imagine-agy: Let Claude Code Generate Images via Antigravity CLI

An agent skill plus text-to-image CLI that turns Google's Antigravity CLI into an image generator for hero art, icons, and illustrations, callable from Claude Code or the terminal.

imagesantigravitytext-to-imagecli
by dyrok Aug 7, 2026 6/10
skill GitHub

dstack: A Design Review Stack for Claude Code Interfaces

A set of Claude Code skills that review, improve, animate and systematize UI work. Each critique cites a specific design rule and proposes a numeric fix rather than vague advice. Aimed at developers who ship interfaces without a designer on hand.

designuireviewskills
by AnimaEcho Aug 7, 2026 7/10
skill GitHub

think-like-a-pm: Agent Skills for Product Owners, Not Coders

Agent skills aimed at the person who owns the product rather than the codebase. The first skill, 'Context is Queen', focuses on framing product context for agents; three more are in progress. A useful angle if you use Claude Code for product work.

product-managementskillscontext
by hgambas Aug 7, 2026 6/10
skill GitHub

bookmark-this: Turn Scattered Links Into a Queryable Markdown Library

Converts saved links into a structured Markdown bookmark library that AI agents can query. Each entry is normalized so an agent can search and cite sources instead of re-fetching pages. Handy as a lightweight personal knowledge base for agent workflows.

bookmarksknowledge-basemarkdownresearch
by nikkogibler Aug 7, 2026 6/10
skill GitHub

glb-buildings-skill: Procedural Building Models From a JSON Spec

Turns a JSON document of floor bands into a validated low-poly glTF building for Unreal, Unity or three.js. Ships with a three.js blueprint editor and an agent-facing CLI so Claude can generate geometry directly. Useful for anyone prototyping 3D environments with an agent.

3dgltfgamedevthreejsprocedural
by hec-ovi Aug 7, 2026 6/10
skill GitHub

proveit: Validate Product Ideas Before You Build Them

Runs structured discovery on a product idea, scores confidence, dispatches a research swarm, and produces a technical handoff deck. The output is meant to be the input to an actual build rather than a standalone document. Aimed at pre-implementation validation.

productresearchvalidationdiscovery
by cla1redonald Aug 7, 2026 6/10
skill GitHub

rulebase-skills: 149 Agent Skills for Customer Support and CX Ops

A large library covering support QA, compliance, RevOps, forecasting and coaching, installable one at a time via 'npx rulebase-skills install <slug>'. Works with Claude Code, Codex and Cursor. Notable for being a non-engineering skill collection at real scale.

customer-supportskillscxoperations
by rulebase-co Aug 7, 2026 7/10
skill GitHub

infostyle-skill: Infostyle Editing for Russian Text in Claude Code

Applies the Russian 'infostyle' editing tradition — clarity, factual grounding, cutting filler — to text inside Claude Code. Targets writing quality rather than code. Niche but well-scoped for Russian-language writers.

writingrussianeditingskills
by Julianalost754 Aug 7, 2026 5/10
skill GitHub

claude-mentor-skills: Guardrails Earned From Real Repo Incidents

Three Claude Code skills — build discipline, review discipline, and an Opus 5 circuit breaker — each written in response to an actual incident where an agent session damaged a repo. The rules are specific rather than generic best practice. Useful if you run agents with broad write access.

guardrailssafetyreviewskills
by LilyCTM Aug 7, 2026 7/10
skill GitHub

agent-vision-toolkit: Give Text-Only LLM Agents Eyes

A vision toolkit and skill providing image Q&A, OCR, screenshot understanding, visual grounding and image-to-SVG for agents that have no native vision. Drops into Claude Code, Codex, OpenCode and Pi. Bilingual docs (Chinese/English).

visionocrscreenshotsmultimodalskills
by Anionex Aug 7, 2026 8/10
skill GitHub

performance-ads-ia: Auditable Meta Ads Optimization Agent

A Portuguese-language agent for Claude Code and Codex that plans, analyzes and optimizes Meta Ads campaigns with an audit trail for every recommendation. Every change is traceable back to the data that motivated it. Domain-specific but a good template for auditable marketing agents.

adsmarketingmetaanalytics
by davigraeff-v4 Aug 7, 2026 6/10
skill GitHub

governed-agent-skills: A Governance Constitution for Agent Work

Defines a constitution and working method covering both multi-agent and solo-agent workflows — what agents may decide, what needs escalation, how work is recorded. Aimed at teams that need agent output to be defensible. More policy than tooling.

governancemulti-agentprocessskills
by Ezra144israel Aug 7, 2026 6/10
skill GitHub

agentic-workstation: A 48-Pack Baseline for AI-Native Development

A workstation baseline with 48+ skill packs, sub-agents, MCP templates and loop-engineering primitives, targeting Claude Code, opencode, Cursor, Copilot and Gemini CLI. Meant as a starting configuration rather than a single tool. Large surface area — expect to prune.

skillsmcpsubagentsworkstationmulti-cli
by ulises-jeremias Aug 7, 2026 7/10
skill GitHub

acstack: Skills That Prove Their Work Instead of Describing It

Claude Code skills built around runnable exit criteria, honest evals, and guards that are demonstrated firing rather than merely declared. The premise is that a skill claiming success should show the check that passed. A useful pattern even if you don't adopt the pack.

skillsevalsverificationguards
by AaravChadha Aug 7, 2026 7/10
skill GitHub

skill-bill: Governed Skills on a Durable Kotlin Runtime

Packages engineering judgment into governed skills and executes them on a durable Kotlin runtime so agents follow the process consistently, resume after interruption, and stay within a bounded context. The durability angle is what separates it from prompt-only skill packs. Heavier setup than a Markdown skill.

skillskotlindurable-executiongovernance
by oila-gmbh Aug 7, 2026 6/10
skill GitHub

skillcast: Turn a Tutorial Video Into a Runnable Agent Skill

Feeds a tutorial video in and produces a skill a coding agent can actually execute, reading the screen rather than the transcript. Captures the steps that narration skips over. A neat way to convert tribal knowledge in recordings into agent instructions.

skillsvideoscreen-readingautomation
by obeskay Aug 7, 2026 7/10
skill GitHub

super-productivity-skill: Task and Time Tracking From Claude Code

A Claude Code skill that manages tasks, scheduling and time tracking in Super Productivity through the app's local REST API. Everything stays on your machine. Good example of wrapping an existing local API as a skill.

taskstime-trackingrest-apiskills
by rokokol Aug 7, 2026 6/10
skill GitHub

skillz: BPMN Diagramming, LinkedIn Pipeline, and Meta-Skills

Agent skills in SKILL.md format for Claude, OpenClaw and Codex, including BPMN-aware Mermaid diagramming, a voice-to-LinkedIn-post pipeline, and meta-skills that turn recurring work into new reusable skills. The meta-skill angle is the interesting part. Standards-conformant SKILL.md files.

skillsbpmnmermaidmeta-skills
by OKHP3 Aug 7, 2026 6/10
skill Reddit

Why Behavioural Skills Fail at Making Claude Less Chatty

Argues that skills are the wrong mechanism for always-on communication style: they're built to encode workflows and domain know-how for specific tasks, not to shape user-facing tone. Explains why the popular 'be concise' skills underdeliver and where that instruction actually belongs. Useful framing before you write another behavioural skill.

skillsverbosityoutput-stylediscussion
by ibn_larry Aug 7, 2026 7/10
skill GitHub

skill-latest-screenshot: Open Your Newest Windows Screenshot

A one-call skill for Claude Code and Grok Build that opens your most recent Windows screenshot without a directory hunt. Deliberately token-cheap. Small but removes a repetitive step in visual debugging.

screenshotswindowsskillsutility
by yoobrain Aug 7, 2026 5/10
skill GitHub

decision-canvas: Interactive HTML Canvases for Hard Decisions

A Claude skill that turns a complex decision into a self-contained interactive HTML canvas with evidence states, editable assumptions and a portable decision record. The artifact outlives the conversation. Useful for architecture choices you'll need to justify later.

decisionshtmldocumentationskills
by nicolas-diez Aug 7, 2026 6/10
skill GitHub

kill-slop: Audit AI Writing Against Your Own Voice

Two Claude Code skills that capture your writing voice, audit text against it, and rewrite only the passages that fail. Selective rather than a wholesale rewrite, so your original phrasing survives. Aimed squarely at the AI-tell problem.

writingvoiceeditingskills
by aixarizzo Aug 7, 2026 7/10
skill Reddit

A CLAUDE.md Communication Style Block That Tames Opus 5

A short communication-style section for CLAUDE.md asking for direct, plain British English, no consultant-speak, and radical candour including admitting uncertainty. The author reports a large improvement over default Opus 5 verbosity. Copy-pasteable in a few lines.

claude-mdverbositypromptingopus-5
by Schpickles Aug 7, 2026 6/10
skill GitHub

skilldrop: 51 Skills for Knowledge-Worker Deliverables

Skills for the artifacts knowledge workers actually ship — ADRs, design docs, PRDs, runbooks, decks, threat models, adversarial reviews — plus three reviewer subagents and six role-based packs. Conforms to the Agent Skills open standard and installs into Claude Code, Cursor, Codex, Copilot, Kiro and Antigravity. Broad coverage with a consistent format.

skillsdocumentationadrprdportable
by sananthanarayan Aug 7, 2026 7/10
skill GitHub

write-like-me: Build a Style Skill by Being Interviewed

A CLI that interviews you about your writing, captures the answers, and emits a Claude Code skill encoding your voice. Getting the style from an interview avoids needing a large corpus of prior writing. Complements the audit-based approach of other voice tools.

writingvoiceskillscli
by substantialityinhibition972 Aug 7, 2026 6/10
skill GitHub

cac-ciso-toolkit: NIST-Aligned Claude Skills for Security Leaders

Composable skills covering risk register maintenance and translating security posture for a board audience, aligned to NIST frameworks. Targets the CISO's writing and reporting load rather than technical scanning. Composable, so you can take just the pieces you need.

securitycisonistriskskills
by cyberaware-creations Aug 7, 2026 6/10
skill GitHub

breadcrumbs: Cue-Placement Templates and Guardrails for Agents

Provides memory and guardrail templates built on cue placement, plus a self-tested CI kit and the white paper explaining the approach. The CI kit tests the guardrails themselves, which is rarer than it should be. Good if you want the reasoning as well as the artifacts.

memoryguardrailscitemplates
by The-825 Aug 7, 2026 6/10
skill GitHub

pr-walkthrough-skill: Review Agent-Authored PRs One Layer at a Time

Walks you through a PR an agent wrote in layers rather than as one wall of diff, collecting your comments as it goes. Built for the case where you didn't write the code and need to build understanding before judging it. Works in Claude Code, Codex and Cursor.

code-reviewpull-requestsskills
by thekie Aug 7, 2026 7/10
skill GitHub

read-me-launcher: Agent Skill for Polished, Secret-Safe READMEs

Generates GitHub READMEs with real visual craft while scanning for secrets that shouldn't ship in documentation. Combines presentation with a safety check most README generators skip. Small scope, done properly.

readmedocumentationsecretsskills
by thatdudealso Aug 7, 2026 5/10
skill GitHub

consistent-naming: Name New Files by Surveying the Repo First

An agent skill that checks existing repo structure and conventions before naming a file or project, instead of inventing a fresh style each time. Prevents the naming drift that accumulates across many agent sessions. Very small scope.

namingconventionsskills
by thatdudealso Aug 7, 2026 5/10
skill GitHub

task-dispatch: Route Small Tasks Fast, Big Tasks Through Process

A triage layer built on mattpocock/skills that judges how heavy a task is: trivial work gets done directly, substantial work is routed through the full process. Avoids paying full-ceremony cost on one-line changes. Chinese-language documentation.

triageroutingskillsworkflow
by Number-2222 Aug 7, 2026 5/10
skill GitHub

VMware-AIops: Claude Code Skills for vCenter and ESXi Monitoring and Ops

Two Claude Code skills for VMware infrastructure: vmware-monitor is read-only and safe to point at production, while vmware-aiops enables full operations. Splitting them lets you grant an agent visibility without granting it the ability to change anything.

vmwareinfrastructuredevopsread-only
by vmware-skills Aug 6, 2026 6/10
skill GitHub

claude-code-docs: Live Anthropic Docs Inside Claude Code via Metadata Plugin

A 3 MB plugin that ships metadata only and fetches official Claude documentation from Anthropic's servers on demand, so nothing is redistributed or goes stale. Adds an auto-discovery skill, instant search, interactive HTML courses, and doc changelog reports.

documentationpluginsearchreference
by costiash Aug 6, 2026 7/10
skill GitHub

skillbox: A Hand-Polished Personal Collection of Claude Code Skills

An ongoing collection of Claude Code skills the author writes, uses long-term, and keeps refining, published in Chinese. Framed as a starting point rather than a finished library - the stated goal is that you build your own from it.

skillscollectionchinese
by zxc7563598 Aug 6, 2026 5/10
skill GitHub

comfyui-chenxin: Local-First ComfyUI Mega-Skill With 662 Workflow Templates

A large local-first ComfyUI skill for Claude Code bundling 80 model prompt recipes and 662 workflow templates, with hardware-aware model selection so it picks something your GPU can actually run. Includes a self-updating knowledge base and an end-to-end manga pipeline.

comfyuiimage-generationtemplateslocal-first
by cxin21 Aug 6, 2026 7/10
skill GitHub

ASI OS: Claude Code Starter Kit With /onboard, /audit, /level-up, /grill

An MIT-licensed starter kit that adds four commands to Claude Code: /onboard to get oriented in a repo, /audit to review it, /level-up to improve it, and /grill to interrogate your own assumptions. A reasonable opinionated default for a fresh setup.

starter-kitcommandsonboardingaudit
by sameerch1b Aug 6, 2026 6/10
skill GitHub

skills: Version-Controlled Agent Skills With Cross-Platform Installers

A personal skills repository organised for version control, paired with installers that work across platforms. The value is the packaging pattern - treating skills as versioned artifacts with a real install path rather than files you copy by hand.

skillsversioninginstaller
by dm1681 Aug 6, 2026 5/10
skill GitHub

graphsmith: Crash-Safe, Non-Duplicating Agent Workflows as a Single Skill

One skill that structures agent workflows so they survive crashes, never redo completed work, and stay grounded rather than inventing results. Portable across Claude Code, Codex, Gemini CLI, Cursor, Windsurf/Devin, Hermes, and Copilot.

workflowdurabilityidempotencyportable
by SathiaAI Aug 6, 2026 7/10
skill GitHub

ai-film-skills: Local AI Short-Film Pipeline Skills for a Single 12GB GPU

A Chinese-language skill suite for running a local AI short-film pipeline - LTX, Wan, and MiniMax H3 - on a single 12GB card. Includes 1600+ lines of documented failure modes and a mechanism to keep generated shots from converging on the same look.

videolocal-inferencegpuchinese
by L-Trunks Aug 6, 2026 6/10
skill GitHub

SciAgent-Skills: 197 Bioinformatics and Life-Science Skills for Claude Code

A 197-skill library covering RNA-seq, single-cell analysis, drug discovery, and proteomics, reporting 92.0% accuracy on BixBench. It powers OmicsHorizon and is one of the more substantial domain-specific skill collections published for Claude Code.

bioinformaticsscienceskillsbenchmarks
by jaechang-hits Aug 6, 2026 8/10
skill GitHub

apple-design-skill: Human Interface Guidelines Translated for the Web

A research-backed agent skill covering fluid motion, the Human Interface Guidelines, colour systems, dark mode, SF Symbols, layout, and accessibility - all mapped onto web implementation. A revamp of Emil Kowalski's MIT-licensed apple-design skill.

designapplehigaccessibility
by ChloeVPin Aug 6, 2026 7/10
skill GitHub

skills: Multi-Model Advisory Board Plus a Five-Skill Team Workflow Pack

Two portable skill sets: an advisory board that puts a hard decision to several models and reconciles their answers, and a five-skill pack for tracked, multi-session, agent-assisted development on a team.

multi-modeldecision-makingteamworkskills
by timharris707 Aug 6, 2026 6/10
skill GitHub

agent-pr-skills: Five Checks for Agent PRs, Built From 2,204 Merged PRs

Five checks to run against your coding agent's pull request before a human maintainer sees it, derived from analysing 2,204 real merged agent PRs. The empirical grounding is what distinguishes this from generic review checklists.

code-reviewpull-requestsqualityempirical
by sjh9714 Aug 6, 2026 8/10
skill GitHub

claude-code-laravel-starter: CLAUDE.md Is RAM, docs/ Is Disk

A lean documentation skeleton for Laravel projects using Claude Code, built on one memorable rule: CLAUDE.md holds what must always be in context, docs/ holds everything the agent can page in on demand.

laravelphpclaude-mddocumentation
by albertoarena Aug 6, 2026 6/10
skill GitHub

claude-laravel-event-sourcing: Generate Spatie Event-Sourced Laravel Code

A Claude Code skill for designing and generating event-sourced domain code in Laravel using Spatie's event sourcing package. Narrow scope, but event sourcing is exactly the kind of boilerplate-heavy pattern an agent handles well with guidance.

laravelevent-sourcingspatiephp
by albertoarena Aug 6, 2026 6/10
skill GitHub

data-analysis-skills: Turn CSV/Excel Into Interactive Single-File Reports

Confirms your industry and audience first, then cleans, analyses, and emits a single-file interactive HTML report in a conclusion-first six-section structure with every chart interpreted. Explicitly refuses to invent industry benchmarks, imply causation from correlation, or draw firm conclusions from small samples. Supports Claude Code, Codex, and WorkBuddy.

data-analysisreportinghtmlchinese
by cabbage2000-lab Aug 6, 2026 6/10
skill GitHub

liarjs-skills: Browser Fingerprint Consistency Testing From Your Agent

Runs liarjs from Claude Code, Codex, Cursor, or Copilot to score a browser against itself across 40 consistency checks spanning canvas, WebGL, WebGPU, audio, fonts, and WebRTC, cross-checked against the TLS/HTTP layer. Intended for Playwright and Puppeteer harness QA and CI regression gates.

testingbrowserfingerprintingplaywright
by liarjsdev Aug 6, 2026 5/10
skill GitHub

macos-disk-cleanup: Agent Skill for Diagnosing macOS 'System Data' Bloat

A macOS disk cleanup skill for Claude Code and Codex that diagnoses what is actually inside the opaque 'System Data' bucket, using read-only scan scripts. Documents 10 traps that lead to misdiagnosis or data loss - the safety notes are the real content.

macosdiskcleanupread-only
by himynameisben Aug 6, 2026 5/10
skill GitHub

mattpocock-skills-zh-tw: 35 Matt Pocock Agent Skills in Traditional Chinese

A full Traditional Chinese localisation of Matt Pocock's 35 agent skills with install and runtime behaviour preserved. Ships a bilingual GitHub Pages reading site with a skill overview map, a learning path, and OpenCode/TRAE install guides.

localizationchineseskillstypescript
by shumingyang-opencode Aug 6, 2026 6/10
skill GitHub

arge-tesvik-skills: TUBITAK Grant Tracking and 5746 Compliance Skills

A Claude Code plugin for Turkish R&D incentive work: tracking TUBITAK TEYDEB/ARDEB calls, pre-assessing project proposals, preliminary patent search, and checking compliance with law 5746. Unofficial and not affiliated with TUBITAK.

turkeygrantscomplianceresearch
by ibrahim-isikli Aug 6, 2026 5/10
skill GitHub

context-engineering-protocol: Source-Attributed, Approved Context Packages

Portable agent skills for assembling context packages where every claim carries a source attribution and a human approves the package before it is used. Aimed at stopping unsourced assumptions from entering the agent's working context.

context-engineeringattributionapprovalportable
by linkpranay-ai Aug 6, 2026 5/10
skill GitHub

Clean-Backend: Production-Hardening Skill for Endpoints, Payments, and Jobs

A Claude skill that applies production-hardening practices whenever you design, write, or review backend code, with specific coverage for endpoints, payment flows, destructive deletes, background jobs, and alerting. The failure modes it targets are the ones that only surface under real traffic.

backendproductionpaymentsreliability
by AllanOps Aug 6, 2026 7/10
skill GitHub

MindMirror: Agent-Agnostic Self-Knowledge Skill Pack in Chinese

A pure-markdown skill pack for self-reflection: a 22-question evidence-based profile, a ten-dimension digital twin, and a 90-day life-planning experiment. Written to run on any AI assistant rather than a specific harness.

personalreflectionmarkdownchinese
by Jianing1117 Aug 6, 2026 5/10
skill GitHub

awesome-agents: 109 Claude Code Subagents in 16 Enforced Engineering Teams

109 specialist subagents organised into 16 engineering teams, plus 11 commands and 10 skills, arranged along an architecture-build-verify-ship chain with the delegation order enforced rather than suggested. Installable as a plugin marketplace.

subagentsteamsmarketplacedelegation
by bakhod1r Aug 6, 2026 7/10
skill GitHub

resonate-skills: Agent Skills for Durable, Crash-Safe Resonate Workflows

Official agent skills for building with Resonate, the durable execution framework for long-running, crash-safe workflows. Useful when the thing you are asking an agent to build must itself survive restarts.

resonatedurable-executionworkflowsreliability
by resonatehq Aug 6, 2026 6/10
skill GitHub

claude-code-skills: 16 Skills for the Unglamorous Work That Ships Software

A curated pack of 16 Claude Code skills - ship-it, readme-forge, security-sweep, git-rescue, devlog and more - where each was researched first and included only if no prominent existing skill already solved it. Explicitly not a 40-skill kitchen sink.

skillscuratedshippingtooling
by 0xmortuex Aug 6, 2026 7/10
skill GitHub

video-prompt-builder: AI Video Prompts for Kling, Sora, Vidu, and Runway

A Chinese-language skill for constructing AI video generation prompts across text-to-video, image-to-video, and video-to-video, with three complexity tiers (L1/L2/L3) and platform-specific output for Kling, Sora, Vidu, and Runway.

videopromptingchinesegenerative
by BH2-4 Aug 6, 2026 5/10
skill GitHub

bearing: Cognitive Routines That Keep Agents Anchored to Your Project

An intel layer that keeps coding agents oriented on what the project actually is: authoritative north-star documents, a task-core that survives context compaction, and domain-expert review passes. Supports Claude Code, Cursor, Zed, and Codex.

contextcompactionanchoringreview
by ReidenXerx Aug 6, 2026 6/10
skill Reddit

Framing CLAUDE.md Rules as Introspection Beats Plain Instructions

Inspired by the emotion vectors paper, the author rewrites stubborn CLAUDE.md rules to ask Claude to introspect on its behavioral impulses rather than simply forbidding a behavior. Reports better control over verbosity and output bloat than direct instructions achieved.

claude-mdpromptingintrospectionverbosity
by trying2bLessWrong Aug 6, 2026 6/10
skill Reddit

A Progressively Disclosed Skill Index for Whole-Codebase Architecture Docs

A primary skill acts as an index over grouped architecture areas - plugins, agent stream, skills, db, service APIs - and each of those indexes a deeper documentation set. The agent updates the system whenever the architecture changes, cutting token waste since it looks up the right reference doc instead of searching the codebase.

skillsprogressive-disclosurearchitecturetoken-efficiency
by ZeroTwoMod Aug 6, 2026 6/10
skill Reddit

A Minimax H3 Video Skill Tested Across Claude Code, Kimi K3, and Qwen 3.8

A Claude Code skill automating Minimax H3 video creation: search for reference character images, generate them with Seedream 4.5 if none fit, upload, then write a structured script covering scene, lighting, mood, and three dialogue beats. The post compares how Claude Code, Kimi K3, and Qwen 3.8 Max each handled the same workflow.

videoskillsmodel-comparisonautomation
by marupelkar Aug 6, 2026 6/10
skill Reddit

A DAG Orchestration Skill for 24-72 Hour Semi-Supervised Agent Runs

A skill for semi-supervised execution of very long tasks - 24 to 72 hours - with a built-in verification loop, at a frankly acknowledged heavy token cost. The skills are written in Korean and will occasionally emit Korean; the author suggests just telling it which language you prefer. At least one Max 20x account required.

orchestrationdaglong-runningverification
by Competitive-Net-5306 Aug 6, 2026 6/10
skill GitHub

agent-skills-kit: Toolkit for authoring and packaging Agent Skills

A starter kit for writing your own Agent Skills, containing a meta skill that helps Claude author skills, plus templates and a worked sample. Includes scripts that validate a skill's structure and package it for distribution. Aimed at people who publish skills rather than just consume them.

skillsauthoringpackagingtemplatesvalidation
by bcastelino Aug 5, 2026 7/10
skill GitHub

claude-briefs: A lightweight focus system for working with Claude Code

A minimal convention for keeping Claude Code focused on one brief at a time instead of drifting across a whole repo. Deliberately small — no framework, just a working pattern. Worth a look if heavier planning systems feel like overkill.

focuscontextworkflowplanning
by naxoc Aug 5, 2026 5/10
skill GitHub

awesome-claude-skills-zh: Chinese-language curated list of Claude Skills

A curated index of Claude Skills, resources and tooling for customizing Claude workflows, maintained in Chinese alongside English. Covers skills for writing, analysis and development. Handy entry point for Chinese-speaking Claude Code users.

awesome-listskillschineseresources
by AICL-Lab Aug 5, 2026 6/10
skill GitHub

Skills_Curator: Evaluate skills before installing and remember the verdict

A Claude Code skill that reviews a candidate skill before you install it and records the decision permanently. The point is to decide once and never re-litigate whether a given community skill is worth trusting. Useful as the skill ecosystem grows faster than anyone can audit it.

skillssecuritycurationinstallreview
by captkernel Aug 5, 2026 7/10
skill GitHub

claude-red: Library of offensive security skills for the Claude skills system

A collection of SKILL.md files that prime Claude with structured methodology for specific security testing areas, from SQL injection to exploit development. Each skill encodes an expert workflow for one attack surface. Intended for authorized penetration testing and security research.

securitypentestingskillsred-teamresearch
by 0xwilliamortiz Aug 5, 2026 6/10
skill GitHub

opensearch-upgrade-navigator: Read-only agent skill for OpenSearch upgrades

An agent skill that plans and validates an OpenSearch version upgrade for any cluster, proving it will still work as-is on the newest release. Strictly read-only, so it never mutates the cluster it inspects. Built for the 2026 OpenSearch Agent Skills Hackathon.

opensearchupgradedevopsskillread-only
by madhankb Aug 5, 2026 6/10
skill GitHub

plainpaper skills: Agent Skills for the platforms marketers run campaigns in

A set of open-format Agent Skills covering the ad and campaign platforms marketing teams actually use. Works with Claude Code, Codex, Cursor, Copilot and Gemini CLI. One of the few skill collections aimed at marketing rather than engineering.

marketingskillsadscross-agentcampaigns
by plainpaperio Aug 5, 2026 6/10
skill GitHub

skillmeld: Discover and merge community Claude skills into one vetted set

Finds existing community skills, security-scans them, and melds the best parts into a single tailored set rather than installing dozens separately. Reduces both context bloat and the audit burden of third-party skills. Complements install-time evaluators.

skillsdiscoverymergesecurity-scancuration
by ifylab Aug 5, 2026 7/10
skill GitHub

FileMaker-AI-vocabulary: FileMaker 26 API compressed to ~7,000 tokens

Every FileMaker 26 function and script step condensed into a token budget small enough to keep resident in context: names, signatures, return types, step IDs and platform support. The goal is to stop Claude inventing functions and misordering parameters. A good example of the vocabulary-layer pattern for niche platforms.

filemakerreferencecontextskilllow-code
by andykear Aug 5, 2026 6/10
skill GitHub

ai-dev-toolkit-pt-br: Portuguese rules, skills and configs for coding agents

A Portuguese-language toolkit of rules, skills and configuration for Claude Code, Cursor and Windsurf. Removes the English-first friction for Brazilian teams. Straight translation-and-adaptation work rather than new tooling.

portugueseskillsrulescursorwindsurf
by LucasSantana-Dev Aug 5, 2026 5/10
skill GitHub

skill-mesh: 47 portable skills with parallel Claude and GPT adapters

A provider-neutral skill pipeline covering an autonomous plan, build, review and ship loop across Claude and GitHub Copilot/GPT. Includes judges, graders and scorers plus install and release tooling, with three Claude-native skills excluded from the portable set. Notable for treating portability as a first-class constraint.

skillsportablecopilotpipelineorchestration
by aberson Aug 5, 2026 7/10
skill GitHub

tdd-agent-skill: TDD skill with hard RED-GREEN-REFACTOR gates for agents

A research-backed TDD skill that enforces real red-green-refactor gates, discovers your stack, and uses mutation testing instead of coverage as the quality signal. Includes explicit anti-reward-hacking rules so the agent cannot game its own tests. Works with any SKILL.md-compatible agent.

tddtestingmutation-testingskillquality
by ChloeVPin Aug 5, 2026 8/10
skill GitHub

agent-smith: Tools, scripts, skills and agents for agent-driven development

A maintained collection of building blocks for agent-driven development, spanning scripts, skills and subagents. Broad rather than deep — useful as a source of individual pieces. Actively developed by a working developer.

skillsscriptscollectionsubagents
by s3rgiosan Aug 5, 2026 5/10
skill GitHub

nsauditor-ai-agent-skill: Agent skill for NSAuditor security audit tooling

Gives any MCP-aware coding agent built-in knowledge of NSAuditor's tools, schemas, plugins and audit workflows. Vendor-published, so it is essentially a documentation layer for their product. Works with Claude Code, Cursor and Windsurf.

securityauditmcpskillvendor
by nsasoft Aug 5, 2026 5/10
skill GitHub

software-quality-skills: Skills distilled from a software quality knowledge base

Claude Code skills derived from a structured software-quality knowledge base rather than written ad hoc. Encodes established practice on testing, review and maintainability. Useful if you want your agent's quality bar to come from somewhere defensible.

qualityskillstestingreviewpractices
by stereobooster Aug 5, 2026 6/10
skill GitHub

r3ckon-style: Six Claude Code skills that enforce one developer's house style

Six skills that make an agent write both code and prose the way their author does. A concrete worked example of encoding personal style as skills instead of a sprawling CLAUDE.md. Fork-and-adjust material rather than something to install as-is.

styleskillswritingconventions
by localhostd3veloper Aug 5, 2026 5/10
skill GitHub

open-source: Skill that generates a project's full open source governance

Generates README, LICENSE, REUSE/SPDX metadata, CONTRIBUTING and the rest of the open-source governance surface for any project. Works with Claude Code and OpenCode, and is written for hackathon-speed setup. Spanish-language documentation.

open-sourcelicensespdxgovernanceskill
by igarbayo Aug 5, 2026 6/10
skill Reddit

A Claude skill that asks 697 engineering questions before writing code

A skill front-loading 697 questions across 15 engineering domains to pin down what a task must actually resolve. Backed by 60 decision cards distilled from Kleppmann, Nygard, Evans, Ousterhout and others. An extreme take on the plan-before-you-code pattern.

skillrequirementsengineeringdesignplanning
by AffectionateSport135 Aug 5, 2026 7/10
skill GitHub

Subsidy Agent Skills: AI Skill Set for Japanese SME Grant Applications

A collection of AI agent skills that help Japanese small and medium businesses research subsidies, check eligibility requirements, and draft grant applications, built on the public jGrants API. Released under MIT license and useful as a reference for building domain-specific research-and-drafting skill workflows beyond Japan's subsidy system.

skilljapangrantsresearch
by yoshi2210 Aug 5, 2026 5/10
skill GitHub

Coinpaprika Skills: Query Crypto Market Data (CEX/DEX) from Claude Code

Official Claude Code skills for querying Coinpaprika and DexPaprika, covering CEX prices, DEX pools, tokens, and OHLCV data. Useful for anyone building crypto-market analysis or trading workflows directly inside Claude Code.

skillcryptomarket-data
by coinpaprika Aug 5, 2026 6/10
skill GitHub

auteur: A Claude Code Skill That Directs Website Builds Like a Film

Treats web design as film direction, producing a commit-sheet, generated assets, and a build, then gates every ship with an executable anti-slop linter. A structured, quality-gated pipeline for AI-driven website work rather than ad hoc prompting.

skillweb-designquality-gate
by agiwhitelist Aug 5, 2026 7/10
skill GitHub

nestjs-playbook-skill: Opinionated Claude Skill for NestJS Backends

A reasoned, opinionated Claude Skill encoding best practices for building small-to-medium NestJS backend projects. Useful for NestJS developers who want Claude Code to follow a consistent architectural playbook instead of ad hoc scaffolding.

skillnestjsbackend
by Kianibound Aug 5, 2026 6/10
skill GitHub

fornax: Read-only skills for coding agents to orient, map, plan, and review code

fornax is a set of portable, single-purpose skills that let an agent orient itself in a codebase, map dependencies, plan changes, and review code, strictly read/plan/report. Useful when you want an agent's analysis without risking unsupervised edits.

skillcode-reviewread-only
by tacticaldoll Aug 5, 2026 6/10
skill GitHub

gald3r: 22-agent framework with 100+ skills and 149 commands across 21 AI tools

A large AI dev framework bundling 22 agents, 100 core skills plus 142 addon skill packs, and 149 commands, portable across 21 tools including Claude Code, Cursor, Copilot, Windsurf, Cline, and Gemini. Uses file-based memory so context persists across sessions.

skillmulti-toolmemory
by Gald3r-Labs Aug 5, 2026 6/10
skill GitHub

observer-skill: Study a hard video with your coding agent via MCP transcription

A Node service that transcribes a video, serves a player page, and exposes MCP tools so your coding agent can answer questions at your exact pause point and render verified charts explaining the content. Combines a Claude skill, MCP server, browser TTS, and STT for an interactive study session.

mcpskillvideostudy
by hec-ovi Aug 5, 2026 7/10
skill GitHub

quant-agent-skills: 8,000 lines of quant research orchestration rules for CC

A set of Claude Code / Codex skills for quant research workflows: concept research, single-stock analysis, and industry analysis, distilled from 6 months of daily production use. Notable for the depth (8k lines of orchestration rules), suggesting real battle-testing rather than a quick scaffold.

skillquantfinance
by Howard-Jerry Aug 5, 2026 7/10
skill GitHub

pristine-skill: Agent Skill Enforcing First-Time-Right Code Changes

A cross-platform agent skill (Claude Code, Codex, OpenCode) that enforces the "First-Time Principle" -- every change must be written in its final form, with no patches, no "what changed" comments, no leftover code, and no drift between local and deployed state. Useful for teams who want agents to produce clean, complete diffs instead of incremental band-aid edits.

skillcode-qualitycross-platform
by newbanser Aug 5, 2026 6/10
skill GitHub

sovereign-skills: 20 Production-Grade Skills for Setup, Review, and Governance

A bundle of 20 skills covering project setup, scope discipline, code review, security, session management, governance, ops, and quality audits (including eval-leakage and doc-drift checks). Works across Claude Code, Codex, and Cursor, aiming to standardize agent discipline beyond just coding tasks.

skillgovernancecode-review
by AlexZio00 Aug 5, 2026 5/10
skill GitHub

video-reverse-engineering: Agent Skill to Reverse-Engineer How a Video Was Made

A Claude Agent Skill that extracts real keyframes, subtitles, and audio from a video, then produces a shot list, ready-to-paste AI image/video generation prompts, and a full replication guide covering both AI and live-action production paths. Useful for creators who want to replicate the style of an existing video or study how it was constructed.

skillvideocontent-creation
by whaojie797-design Aug 5, 2026 6/10
skill GitHub

adsense-compliance-auditor: Claude Skill for AdSense and AdMob Compliance

A dynamic skill engine that audits web and mobile apps for Google AdSense/AdMob monetization compliance, checking layout safety, ads.txt validation, and anti-CLS layout hooks against current live ad policies. Niche but useful for publishers who want an automated pre-flight check before enabling ads.

skillmonetizationcompliance
by kiraak-h Aug 5, 2026 5/10
skill GitHub

fabric-agent-skills: Agent Skills for Microsoft Fabric Connect, Load, and Model

A set of Agent Skills for working with Microsoft Fabric, covering connecting to data sources, loading, and modeling, with rules validated against a live Fabric environment. Useful for data engineers using Claude Code or similar agents inside a Microsoft Fabric/Power BI stack.

skillmicrosoft-fabricdata-engineering
by emirdegirmenci Aug 5, 2026 5/10
skill GitHub

immut-agent: Agent Skill and CLI for Notarizing Files with immut

An agent skill and CLI that has your AI agent locate important files -- contracts, IP, compliance records -- and send each one to the immut.io proof layer, producing a verifiable, tamper-evident timestamp of when the file existed and that it has not changed. Useful for teams needing lightweight, agent-driven document notarization.

skillcompliancenotarization
by enroh-ops Aug 5, 2026 5/10
skill GitHub

code-annotations: Write @anno Comments, Let Claude Execute Them in Batch

A skill that lets developers write lightweight "@anno" annotations directly in source code as inline instructions, which Claude then reads and executes in batch across the codebase. A neat pattern for queuing up many small, localized changes without writing a full prompt for each one.

skillcode-annotationbatch-editing
by zlj-zz Aug 5, 2026 6/10
skill GitHub

ai-code-review-skill: Pre-Merge Review Skill Targeting AI Code Failure Modes

A pre-merge code review skill specifically aimed at failure patterns common in AI-generated code: deleted historical patches, unverified assumptions written as comments, and over-engineering. Uses a six-stage review process plus 23 language-specific guides, and works with Claude Code, Cursor, and Codex.

skillcode-reviewai-generated-code
by casperkwok Aug 5, 2026 6/10
skill GitHub

Reader-First Writing Skills: 12-Skill Editorial System

A set of 12 editorial skills plus independent review agents for Claude Code and Codex that structure, draft, diagnose, and revise documents while preserving the authors original meaning. Aimed at long-form writing rather than code.

writingeditorialskill
by OC-NeuralSense Aug 5, 2026 6/10
skill GitHub

Bambu 3MF Export: Claude Code Skill for Sliceable Print Files

A Claude Code skill that exports STL meshes directly into sliceable Bambu Studio .3mf projects, with print settings baked in and parts auto-packed across named plates. Useful for anyone using Claude Code to automate 3D-printing prep.

3d-printingskillbambu-studio
by m-esm Aug 5, 2026 6/10
skill GitHub

Han-Communication: A Plugin to Make Claude's Output More Readable

An open-source (MIT) plugin with a custom agent and three skills -- general readability guidance, editing existing text for readability, and explaining technical detail clearly -- aimed at fixing Claude's dense, jargon-heavy output. Ships with a default writing voice you can override with your own, and the guidance docs are usable even without installing the plugin itself.

readabilitywriting-styleplugin
by mxriverlynn Aug 5, 2026 6/10
skill Reddit

Sweet Dream: A Free Recreation of Claude's Enterprise 'Dreams' Skill

An open-source attempt to recreate Claude's officially announced 'Dreams' managed-agent capability, which is currently limited to enterprise plans with extra usage cost. The author reports it works, though it hasn't been tested long-term, and it's free to use right now.

dreamsmanaged-agentsexperimental
by No_Combination_6429 Aug 5, 2026 7/10
skill GitHub

ui-review: automated UI/UX review skill for Claude Code

Uses the agent-browser CLI to catch UI/UX bugs — text overflow, wrapping bugs, horizontal scroll, overlapping elements, tap targets, dark-mode and WCAG zoom/reflow issues — across mobile through desktop viewports. Maps each finding to the source file responsible and supports baseline/diff regression runs that skip unchanged pages.

uiaccessibilitytestingskill
by cdmx-in Aug 5, 2026 8/10
skill Reddit

agent-dev-toolkit: one skills core, adapters for Claude Code, Cursor, Codex, and more

Maintains a single agent-neutral core of skills, policy, and spec-driven-development contracts, then uses per-agent adapters to publish it into Claude Code, Cursor, Codex, Copilot, and others, so a skill update doesn't need to be copied by hand into every tool.

skillscross-toolspec-driven-development
by walter-dexter Aug 5, 2026 6/10
skill GitHub

skills: deterministic Shopify/SEO/GEO checks backed by real-scan prevalence data

A set of agent skills that check Shopify, e-commerce, SEO, and GEO issues using deterministic checks backed by prevalence data from real scans rather than guesswork. Works with Claude Code, Cursor, Codex, and Gemini CLI via the open Agent Skills standard.

seoe-commerceshopifyskills
by maxbuildog Aug 5, 2026 6/10
skill GitHub

explain-it-to-me: Coding agent explains what it built as linked Obsidian notes

A Claude Code skill that has the agent write one Obsidian note per new concept after each delivery: why it appeared, an analogy, and what breaks if you change it. Aimed at people who need to understand agent-built code without reading it directly.

skillobsidiandocumentation
by JessieMeguro Aug 4, 2026 7/10
skill GitHub

skills: TDD, refactoring, and ensemble-review skills for disciplined coding agents

A skill collection for making agent-driven code cheaper and safer to change: continuous-specification (spec-driven TDD), nullables (mock-free testing of I/O code), bounded refactoring, micro-commits, and ensemble-review (three concurrent model reviews synthesized into one revision plan).

skilltddrefactoringcode-review
by jonfazzaro Aug 4, 2026 8/10
skill GitHub

claude-tier: /tier Skill for Cost-Efficient Model Tiering

A tiny Claude Code skill that installs a quality-first, cost-efficient model/effort-tiering rule into a project's CLAUDE.md via the /tier command. Lets teams standardize which model tier to use for which kind of task without hand-writing the rule each time.

skillclaude.mdcost-optimizationmodel-selection
by thephenyl02-creator Aug 4, 2026 6/10
skill GitHub

Claude Code Skill for Parametric FDM 3D-Print Modeling

A Claude Code skill for parametric FDM 3D-print modeling using trimesh/manifold3d/build123d, with a headless view-screenshot-iterate loop so the agent can visually check its own models. Useful for makers who want an agent-driven CAD workflow.

skill3d-printingcadheadless
by m-esm Aug 4, 2026 6/10
skill GitHub

Blink Build Studios: Open-Source Claude Skills Marketplace

A collection of open-source Claude Code skills from Blink Build Studios, published as an installable plugin marketplace. Description is thin on specifics but provides a ready-made source of skills to browse.

skillmarketplaceplugins
by Blink-Build-Studios Aug 4, 2026 5/10
skill GitHub

Lecture-to-Notes: Local Pipeline Turning Recordings into Synced Notes

A Claude Code skill plus CLI that converts lecture recordings into structured, grounded notes with a synced HTML viewer combining video, timestamped transcript, and summary. Uses a local GPU pipeline (Whisper ASR, slide extraction, OCR, VLM) so no cloud transcription is needed.

skilltranscriptionlocal-gpunotes
by drpwchen Aug 4, 2026 6/10
skill GitHub

Nen: Six Agent Skills Mapped to Performance, Refactoring, and More

Nen ships six installable agent skills themed around performance, refactoring, launch, reverse engineering, reliability, and orchestration. A playful but practical grouping of common engineering skill categories for Claude Code.

skillrefactoringperformanceorchestration
by rlaope Aug 4, 2026 6/10
skill GitHub

ship-guard-skills: Post-AI-Coding Safety Checks as Agent Skills

A set of MIT-licensed agent skills that act as guardrails after AI coding sessions — checking for leaked secrets, running pre-merge checks, triaging flaky tests, and detecting env/flag drift. Designed to catch mistakes before they ship.

skillsafetycisecrets
by Wanbinyu Aug 4, 2026 6/10
skill GitHub

dsl-skills: Cross-Agent Skills for Visual QA and Email Automation

A set of cross-agent skills covering visual QA and email automation workflows, usable across different coding agents including Claude Code. Provides ready-made skill definitions for two specific automation domains.

skillvisual-qaemail-automation
by dengshangli Aug 4, 2026 5/10
skill GitHub

Blender Industrial Kit: Parametric, Verifiable 3D Modeling Skill

A field-tested discipline for industrial-product 3D modeling in Blender that's parametric, headless, and verifiable, shipping docs, verification gates, and a Claude Code skill plus agent pipeline. Aimed at product designers who want an agent-driven, checkable Blender workflow.

skillblender3d-modelingheadless
by kai-chop Aug 4, 2026 6/10
skill GitHub

Curated Claude Code Skills for Image, Music, and Instructional Design

A curated collection of Claude Code skills covering AI image production, AI music production, instructional design, and general workflow improvement. Good starting point for creative and non-coding use cases of Claude Code skills.

skillcreativeinstructional-design
by phillipalcock Aug 4, 2026 6/10
skill GitHub

code-clipping: Claude Code Skill for Short-Form Video Editing

A Claude Code skill that inspects a source video clip, proposes short-form edit ideas, and exports finished vertical clips ready for TikTok, Reels, or Shorts. Brings agent-driven video editing suggestions into the Claude Code workflow.

skillvideo-editingshort-form-content
by phillipalcock Aug 4, 2026 6/10
skill GitHub

use-case: Verified-Only Use-Case Catalog Skill for Codebases

An agent skill that walks both the codebase and the live running app in a browser to build a verified use-case catalog, generating an in-app panel, a demo deck, and a report of dead/unused features. Useful for teams wanting an accurate, agent-verified map of what a product actually does.

documentationskillcodebase-analysis
by succtorlin Aug 4, 2026 6/10
skill GitHub

pillars: Tiered Convention Files to Keep Coding Agents Aligned

pillars is an open standard that decomposes a monolithic AGENTS.md/CLAUDE.md into tiered 'pillar' files describing a project's conventions, decisions, and constraints. Useful for keeping coding agents consistently aligned with project rules as codebases and instruction sets grow.

conventionsagents-mdproject-config
by hannsxpeter Aug 4, 2026 6/10
skill GitHub

research-lab-skills: Agent Skills for the Full Research Lifecycle

A composable set of Claude Code Agent Skills covering literature review, research logs, experiment tracking, analysis, lab presentations, manuscript writing, and peer review. Useful for academic and research teams wanting to apply Claude Code to the full scientific workflow, not just coding.

researchacademicskill-collection
by zi-yue-1129 Aug 4, 2026 6/10
skill Reddit

wiseman: Self-Building Codebase Wiki Plugin for Claude Code

wiseman is a Claude Code plugin that generates a human-and-agent-readable wiki for your project: a /wiseman-summon skill researches dependencies and builds wiki pages, a hook checks the wiki for relevant lessons before each coding task, and /wiseman-dashboard opens a readable view. Useful as a free, self-hosted alternative to paid context tools like context7, accumulating project-specific lessons over time.

pluginwikiproject-memory
by TGoddessana Aug 4, 2026 7/10
skill GitHub

Skill-Bazaar: Open Collection of Agent Skills (SKILL.md) by Category

An all-in-one, categorized open collection of AI Agent Skills in SKILL.md format, part of a broader 'Mega AI Bazaar' project. Useful as a browsable directory when looking for existing Claude Code skills to reuse rather than writing your own from scratch.

skill-collectiondirectoryopen-source
by Drvivek34 Aug 4, 2026 5/10
skill GitHub

course-quiz-builder: turn course markdown into a quiz webpage

A Claude Code skill and slash command that converts course markdown into a single self-contained HTML quiz page with randomized questions, an answer key, and pass/fail scoring, then publishes it to GitHub Pages. Handy for course creators wanting quick interactive assessments.

skilleducationgithub-pages
by the3ma Aug 4, 2026 6/10
skill GitHub

Skill for iterative review/revision of design and planning docs

A Claude Code skill that runs repeated rounds of review and revision over design and planning documents until all flagged issues are resolved and closed. Simple structured process for tightening specs before implementation.

skillplanningreview
by MarkAsir Aug 4, 2026 5/10
skill GitHub

ux-writing: Claude Code skill for interface microcopy

A Claude Code skill encoding interface microcopy rules plus an 'AI-tell' strip pass to make button and error text read as human-written rather than obviously AI-generated. Useful for teams wanting consistent, natural UI copy from agent-driven design work.

skilluxcopywriting
by humbleteam Aug 4, 2026 6/10
skill GitHub

Skill for auditing codebases against the EU AI Act

A Claude Code skill for answering questions about the EU AI Act (Regulation 2024/1689) and running static/dynamic compliance audits on codebases to flag prohibited practices, missing transparency controls, and unmet high-risk safeguards. Useful for teams needing AI regulatory compliance checks baked into their dev workflow.

skillcomplianceeu-ai-act
by DirtyBeastAfterTheToad Aug 4, 2026 6/10
skill GitHub

claude-code-plugins: opinionated plugin and workflow extension pack

A collection of opinionated plugins and workflow extensions for Claude Code from a single maintainer. Useful as a grab-bag of ready-made customizations for users who want pre-built conventions rather than authoring their own from scratch.

pluginsworkflow-extensionscustomization
by bengous Aug 4, 2026 5/10
skill GitHub

ai-agent-skills: goal-mode skill keeps agents working until CI is green

A skill for Cursor and Claude Code that puts the agent into 'goal-mode,' keeping it iterating until tests, lint, and CI all pass rather than stopping after a single attempt. Installable via npx skills add for a quick drop-in addition to a project's skill set.

skillsgoal-modecitesting
by shenwell Aug 4, 2026 6/10
skill GitHub

practicaltypography: typography skill based on Practical Typography

A Claude Code / AI agent skill that encodes Matthew Butterick's Practical Typography rules so agents can audit and produce publication-grade text formatting. Useful for anyone generating documents, reports, or web copy where typographic quality matters.

typographywritingskilldocuments
by danium Aug 4, 2026 6/10
skill GitHub

skilldrift: Dependabot-style drift detection for Claude Code Skills

Monitors installed Claude Code Skills for upstream changes, re-scores risk using SkillSpector, and auto-opens GitHub Issues when drift is detected — supply-chain security for the growing Skills ecosystem. Ships as both a GitHub Action and a Go CLI.

securitysupply-chainskillsgithub-action
by kpab Aug 4, 2026 7/10
skill GitHub

skills-workflows: pipeline-orchestration skill pack for Claude Code

A set of pipeline-orchestration skills for Claude Code covering publish-post, agents-md-generator, work-tracking, feature-spec, and stage-draft tasks. Useful as ready-made building blocks for structuring multi-step content and dev workflows.

skillspipelineorchestrationcontent
by slogsdon Aug 4, 2026 6/10
skill Reddit

Keep CLAUDE.md stable by moving changing info out of it

A practical technique for stopping CLAUDE.md from going stale: keep only rarely-changing facts (verification commands, hard limits, known-problem notes) in the file, and move volatile session state to a handoff note, live status to a script the file points to, and project history to a separate memory index. Also separates planning and coding into distinct session files to keep each one focused.

claude-mdcontext-managementbest-practices
by Euphoric_Daikon_3582 Aug 4, 2026 6/10
skill GitHub

pdp-audit: Claude skill for ecommerce product-page UX audits

A Claude Code skill that runs research-backed UX and conversion audits of ecommerce product detail pages, producing prioritized, evidence-based reports. Useful for teams wanting a repeatable, agent-driven conversion-rate review process.

ecommerceux-auditskillconversion
by llizell Aug 4, 2026 5/10
skill GitHub

Claude Code Skill: Map AI-Assistant Visibility (AI Mindshare)

A Claude Code skill that measures how visible a company or market is to AI assistants like ChatGPT, mapping which brands get recommended and why. Useful for marketers or founders wanting to understand and improve their presence in AI-generated answers.

skillseoai-visibility
by unfamiliar-city Aug 4, 2026 6/10
skill GitHub

Battle-Tested Claude Code Skills: Ship-to-Babysit Pipeline

A collection of Agent Skills for Claude Code including a 'ship → babysit' pipeline for taking work from implementation through monitoring. Distributed via positronick.com for developers wanting reusable, proven skill workflows.

skillpipelineautomation
by nsollazzo Aug 4, 2026 6/10
skill GitHub

rook-claude: Claude Code Plugin Marketplace for Rook Maintainers

A Claude Code plugin marketplace tailored to maintainers of the Rook storage project, bundling code review, triage, and systemic-PR skills. A concrete example of building a project-specific plugin marketplace on top of Claude Code.

plugin-marketplaceskillmaintainer-tools
by jhoblitt Aug 4, 2026 5/10
skill GitHub

sshlg-skills: Umbrella Installer for the ssheleg Skill Family

A single installer for six agent skills (super-ux, task-pipeline, agent-sync, make-skill, sheleg-design, seo-aeo-audit) that work across Claude Code, Cursor, Codex, and 70+ other agent tools. Simplifies setting up a curated skill set across multiple coding agents at once.

skillinstallermulti-agent
by ssheleg Aug 4, 2026 6/10
skill GitHub

agent-toolkit: Composable Skills, Agents, Loops and MCP Templates

A composable toolkit of skills, subagents, loop patterns, and MCP templates that works across Claude Code, Cursor, OpenCode, Copilot, Windsurf, and Pi. Aimed at developers who want reusable building blocks for constructing agent workflows rather than starting from scratch each time.

skillmcptoolkit
by ulises-jeremias Aug 4, 2026 6/10
skill GitHub

consult: Engineering-Quality Skills That Keep Humans in the Loop

A set of skills for AI coding agents focused on engineering quality, designed to keep a human reviewer in the loop rather than letting the agent act fully autonomously. Targets teams wary of unchecked agentic changes to production code.

skillcode-qualityhuman-in-the-loop
by kreek Aug 4, 2026 5/10
skill Reddit

A Curated List of Claude Code Skills and Tools Actually Used Daily

A practitioner's roundup of the Claude Code skills, plugins, MCPs, and companion tools that stuck as part of a real workflow rather than just looking good in a demo, including Ponytail (minimal-diff discipline), OldHand (full-flow QA), React Doctor (React anti-pattern scanner), Trail of Bits security skills, Muster (unified process/log runner), Ruflo (multi-agent coordination), Serve Sim (iOS Simulator control), and ScrapeGraph AI (LLM-based web extraction). Useful as a filtered starting point for discovering tools worth trying instead of sifting through every new release.

skillrounduptooling
by not_bsb7838 Aug 4, 2026 7/10
skill GitHub

Claude Code Skill for MiniMax H3 Open-Weight Video Model

A Claude Code skill providing a prompt framework and ComfyUI model/quantization reference plus troubleshooting for MiniMax H3, an open-weight omni-modal video model, covering text-to-video, image-to-video, first-last-frame, and reference-to-video generation. Useful for developers using Claude Code to drive local video-generation pipelines.

skillvideo-generationcomfyui
by teskor-hub Aug 4, 2026 6/10
skill GitHub

21-Skill Discipline Pack for Claude Code with Global Rules and Guardrails

A Chinese-language collection of 21 Claude Code skills plus global 'iron rules' and physical guardrails meant to make Claude Code follow engineering discipline consistently, with one-click install. Aimed at teams wanting a stricter, more standardized Claude Code workflow out of the box.

skillguardrailsstandardization
by xcodethink Aug 4, 2026 7/10
skill GitHub

ForgeCat: Registry of Production-Ready Agent Profiles

A registry and marketplace for production-ready AI agent profiles usable with Claude Code, Cursor, and Codex, letting users search, install, and contribute packages. Useful for quickly bootstrapping agent configurations instead of writing them from scratch.

skillregistryagent-profiles
by nota-america Aug 4, 2026 5/10
skill GitHub

agent-plugins: durable agent memory + adversarial multi-agent review

A set of Claude Code plugins covering agent memory and verification: a second-brain for durable domain-agent knowledge, apiary for multi-contributor knowledge bases, and a scout-generator-critic-mediator pattern for adversarial multi-agent review.

pluginmemorymulti-agentreview
by ahartzog Aug 3, 2026 7/10
skill GitHub

marketing-strategist: ad strategy skill before campaign setup

A Claude skill that builds ad strategy before campaign setup — covering research, hypotheses, platform selection, phased budgeting, and KPI definition. Documentation is in Russian.

skillmarketingstrategy
by ai-hub-open Aug 3, 2026 5/10
skill Reddit

Attention Control: terse, action-first output style for coding agents

A skill/output style for Claude Code (and Codex, Cursor, Gemini CLI, Copilot, Zed) built around ADHD-friendly, air-traffic-control-style terseness — replacing hedged, wordy responses with direct action statements like exact commands and file:line references.

output-styleskilladhdclarity
by aaddrick Aug 3, 2026 7/10
skill GitHub

juanjuan-team: adversarial-collaboration multi-agent skill

An adversarial-collaboration multi-agent skill for Claude Code with 7 specialized agents (leader, convener, architect, frontend, coder, reviewer, docs-researcher) that independently audit every decision to counter single-agent cognitive tunneling. Includes an 11-phase workflow, 4 operating modes (Safe/Normal/Auto/YOLO), a weighted decision engine, and automatic backups.

multi-agentskillreviewworkflow
by dxkjuanjuan Aug 3, 2026 7/10
skill GitHub

el-estudio: full game-studio plugin for Claude Code (Spanish)

A Claude Code plugin that turns the agent into a complete game studio covering design, Unity, 3D/2D art, animation, and audio — with 159 knowledge files, 7 agents, and 7 skills. Documentation is in Spanish.

game-devunitypluginskill
by MichaelH14 Aug 3, 2026 7/10
skill GitHub

pwnloop: autonomous pentest-lab engagement loop for Claude Code

An autonomous lab-machine engagement loop for Claude Code that runs Kali Linux in a container, drives it via a skill, and rewrites its own methodology notes after each run — useful for practicing/automating CTF-style penetration testing labs.

securitypentestskillkali
by euriconicacio Aug 3, 2026 7/10
skill GitHub

claude-instruction-ablation: cut always-on CLAUDE.md/skill bloat

A rubric and footprint-measurement tool for identifying always-on instruction bloat — CLAUDE.md content, rules, and skill descriptions — that degrades coding agent performance as a setup ages, with a multi-repo workflow for trimming it.

skillclaude-mdtoken-efficiencycontext
by evolsb Aug 3, 2026 7/10
skill Reddit

Skills vs MCP: two different layers, not competitors

Argues that skills and MCP solve different problems rather than one replacing the other: MCP is the capability layer giving an agent access to external tools/resources, while a skill is operational knowledge about when and how to use that access, loaded only when needed. Proposes a three-layer split: CLAUDE.md for persistent facts, skills for on-demand procedures, MCP for external access.

skillmcpconcepts
by Particular_Luck80 Aug 3, 2026 6/10
skill GitHub

docflow: ADR-driven documentation workflow for coding agents

A skill set for scaffolding and managing Architecture Decision Records, a plan queue, and AGENTS.md conventions for the Claude Code and pi coding agents — includes a bootstrap skill plus lifecycle skills to author, queue, ship, and audit ADRs.

skilladrdocumentationworkflow
by EvolveHQ Aug 3, 2026 7/10
skill GitHub

clean-my-code: approval-gated code-quality audit skill

An approval-gated code-quality audit skill covering Clean Code, SOLID, DRY, KISS, YAGNI, design-pattern justification, maintainability, testability, and scalability — requires explicit approval before making changes.

skillcode-qualityaudit
by PabloViniegra Aug 3, 2026 6/10
skill GitHub

charles-claude-skills: context handoff, bootstrap, and catalog skills

Production-quality Claude Code skills for context handoff between sessions, project bootstrap, and a skill catalog, evaluated against Anthropic's writing-skills and skill-creator rubric with 100% trigger accuracy.

skillcontext-handoffbootstrap
by cabaynes Aug 3, 2026 6/10
skill GitHub

OmniRank — SEO/AEO/GEO Growth Engine Skills

A growth-engine skill set for Claude Code and Cursor covering SEO, AEO, GEO, and social growth. v0.1.0 ships an audit skill that scores crawl-hygiene and AI-visibility gates, plus a geo-artifacts skill that generates llms.txt, llms-full.txt, and facts.json for AI crawlers.

seogeomarketing
by bemoshiur Aug 3, 2026 6/10
skill GitHub

llm-council-cc — Multi-Advisor Decision Review Skill

A Claude Code skill adapted from Karpathy's LLM Council concept: five advisors independently analyze a decision, blind peer-review each other with a forced ranking, and a chairman delivers one final verdict. Useful for stress-testing important decisions from multiple angles.

decision-makingmulti-agent
by Carlos-Padilla-Bravo Aug 3, 2026 7/10
skill GitHub

human-prose — Readability Rules Grounded in Psycholinguistics

A Claude Code skill encoding sentence-level readability rules for prose meant to be read by humans, with each rule pinned to psycholinguistics research. Helps rein in overly dense or unnatural AI-generated writing.

writingreadability
by homeowmorphism Aug 3, 2026 6/10
skill GitHub

CommonTrace — Shared Knowledge Base Plugin

A Claude Code plugin bundling slash commands, hooks, and a skill for working with CommonTrace's shared knowledge base. Lets a team query and contribute to a common knowledge store from within Claude Code.

knowledge-baseplugin
by commontrace Aug 3, 2026 5/10
skill GitHub

hubspot-license-fit — Right-Size Your HubSpot License

A Claude skill and CLI that reads a HubSpot portal read-only and reports the minimum tier its actual usage requires, citing the specific feature and verification date behind each claim. Deliberately avoids asserting what you currently pay, since the API can't see billing. Pure Python, no dependencies.

hubspotcost-optimization
by meticulosity Aug 3, 2026 6/10
skill GitHub

janaabg-operations — Growth-Ops Skills for Local Businesses

Twenty growth-operations skills plus industry playbooks for local service businesses, agencies, and B2B, built for Claude Code and Hermes Agent. Pure markdown with no executable code.

growth-opsmarketing
by On-mission96 Aug 3, 2026 5/10
skill GitHub

ads-skills — Ad Campaign Skills for Google, Meta & TikTok

A set of Claude skills covering advertising and marketing strategy, campaign structure, targeting, creative, and budgeting across Google Ads, Meta Ads, TikTok, and more. Aimed at marketers running paid campaigns with Claude's help.

advertisingmarketing
by adkit Aug 3, 2026 5/10
skill GitHub

claude-seo-geo — SEO & GEO Skills for Ranking in Search and LLMs

A set of Claude Code skills covering technical SEO audits, backlinks, AI-optimized content, local SEO, and social amplification — aimed at ranking in both Google and LLM answers like ChatGPT, Perplexity, and Gemini.

seogeo
by Thibaultbm Aug 3, 2026 5/10
skill GitHub

alex-style — Vendored Design Reference Skill

A self-contained design arsenal skill for Claude Code that vendors 20 curated design sources into grep-able local indexes covering components, marketing sections, application UI, shaders, brand logos, color ramps, and review rulebooks. Lets Claude search real design references locally instead of guessing.

designui
by worldofhacks Aug 3, 2026 6/10
skill GitHub

claude-skills (dzivkovi) — Branded Docs, Prose Review & EPUB Export

A set of Claude skills that make output look and read right by default: branded Word and PowerPoint generation, a logic-and-slop prose reviewer, a guided read-along tour of overnight AI work, and Markdown-to-Kindle-EPUB or plain-print-PDF conversion with working links, tables, and local Mermaid diagrams. Usable either as a claude.ai upload or dropped into Claude Code.

documentsexport
by dzivkovi Aug 3, 2026 6/10
skill GitHub

skill-conductor — Architecture-First Skill Lifecycle Tool

Manages the full lifecycle of Claude Code skills through six modes — CREATE, IMPROVE, VALIDATE, REVIEW, OPTIMIZE, PACKAGE — using binary BinEval scoring with threshold-blind, cross-family-calibrated judges. Includes a gated self-update loop, pressure testing, and ten authoring principles grounded in empirical research.

skill-authoringevaluation
by smixs Aug 3, 2026 6/10
skill GitHub

plan-preflight — PASS/FAIL Gate for Implementation Plans

A Claude Code skill that runs preflight checks on implementation plan documents, gating them with a binary PASS/FAIL verdict before work begins. Helps catch weak or incomplete plans before they turn into wasted execution time.

planningquality-gate
by jw1222 Aug 3, 2026 6/10
skill GitHub

codex-handoff — Hand Tasks From Claude Code to OpenAI Codex

A Claude Code skill that delegates tasks to OpenAI Codex — via shell or macOS GUI computer-use — and returns evidence of what was done. Useful for splitting work across coding agent vendors within one session.

codexcross-vendordelegation
by LucasDuys Aug 3, 2026 6/10
skill GitHub

ground-my-ui — Verify UI Contracts Before Redesigning

An agent skill built on the premise that 'ugly' UI is often code quietly lying to its framework: it verifies every prop, slot, enum value, token, icon, and i18n key against the installed source before redesigning, audits who actually owns layout, and locks the contracts into tests.

uiverification
by silkyland Aug 3, 2026 6/10
skill GitHub

handover — Enforced Agent-to-Agent Handover Documents

Defines an enforced handover document format for agent-to-agent handoffs — a strictly validated header plus prose body — with deterministic linting and repo-aware verification. Ships with a trap-based benchmark that measures whether a handoff actually transfers the needed context.

handoffdocumentationverification
by geekidharsh Aug 3, 2026 6/10
skill GitHub

respeak — Humanize AI-Sounding Prose

An editing method and Claude Code/Codex skill for making prose sound like a person wrote it, without changing the underlying facts. Targets the common 'obviously AI-written' tell in drafts.

writingediting
by quietmill Aug 3, 2026 6/10
skill GitHub

gmira — 21 Skills for UI That Doesn't Look AI-Generated

Twenty-one Claude Code skills for building web interfaces that don't read as AI-generated: forces a written visual direction before any element is placed, wires in seven shadcn registries (514 components), sets a GPU performance floor for WebGL/canvas work, and gates every build with Playwright checks across 5 viewports. Targets Next.js, React, and Tailwind v4.

uidesign-quality
by OthmanAdi Aug 3, 2026 7/10
skill GitHub

claude-security-skills — 25 Defensive Security Skills for Claude Code

Twenty-five production-tested defensive security skills covering WordPress, VPS, and Cloudflare/Next.js hardening, AI agent guardrails, MCP security, prompt-injection defense, the OWASP LLM Top 10, LLM-specific failure modes like slopsquatting and hallucinated APIs, incident response, and GDPR/DACH compliance. MIT licensed and described as battle-tested.

securitydefensive
by GoldenWing-360 Aug 3, 2026 8/10
skill GitHub

academic-pdf-translation — Rebuild Translated, Searchable Academic PDFs

An agent skill for translating academic PDF papers into another language while rebuilding them as readable, searchable, page-by-page-verifiable documents. Handles complex tables and figures and finishes with Zotero integration.

translationpdfacademic
by ezra-y Aug 3, 2026 6/10
skill GitHub

cc-handoff — Cross-Machine Session Handover for Claude Code

Creates a handover summary so you can continue a Claude Code task on a different machine, working around the fact that Claude Code's session-resume feature doesn't work across machines.

handoffsessioncross-machine
by clever-cc-plugins Aug 3, 2026 6/10
skill GitHub

ponyatnost — 'Понятность' Explainer-Writing Skill

A Russian-language skill that turns a draft explainer article into text a newcomer can actually understand, running 41 checks across 7 phases with a final gate before it's considered done. Part of the RixAI system.

writingrussian
by morf3uzzz Aug 3, 2026 5/10
skill GitHub

Claude Skills for SaaS Compliance and Trust Operations

Five Claude Skills automating SaaS compliance and trust workflows: security questionnaires, SOC 2 readiness, vendor risk assessment, audit evidence collection, and trust page audits. Aimed at teams that need to move faster through vendor security reviews.

skillcompliancesoc2saassecurity
by mercydeez Aug 2, 2026 6/10
skill GitHub

Claude Skill Generates Narrated Mythic Short Films as Paper Dioramas

A Claude skill that turns a single request into a narrated mythic short film styled as a layered cut-paper diorama, complete with three-colour cardstock worlds and paper-wipe transitions. Outputs one assembled MP4 from a text prompt.

skillvideocreativegenerative
by sadekxD Aug 2, 2026 5/10
skill GitHub

Battle-Tested Claude Skills: Notion GTD, Book Printing, PrusaSlicer

A personal collection of battle-tested Claude skills covering Notion GTD sessions, a book print pipeline, PrusaSlicer profiles, and a language tutor. A grab-bag of real-world automation examples beyond typical dev tooling.

skillnotion3d-printingproductivity
by makukhin-ie Aug 2, 2026 6/10
skill Reddit

Rewriting CLAUDE.md Instructions to Suit Opus 5 Behavior

A developer used Anthropic's Opus 5 prompting guide to audit and rework their CLAUDE.md, finding that many instructions told Opus 5 to do things it already does by default, which Opus 5 then compounded into slower, less accurate runs. Highlights that coding guidelines shared with other tools like Copilot may need to diverge from Opus-5-tuned CLAUDE.md content.

skillclaude-mdopus-5prompting
by our_sole Aug 2, 2026 6/10
skill GitHub

awesome-claude-security: Curated Skills and Agents for Cybersecurity

A curated list of Claude Code skills, agents, memory setups, and profiles for accomplishing cybersecurity tasks, projects, and jobs. An awesome-list style entry point into the security-focused Claude Code ecosystem.

skillsecurityawesome-listcybersecurity
by jassics Aug 2, 2026 5/10
skill GitHub

Claude Code Skill for Designing Mathlib Definitions

An evidence-driven Claude Code skill for designing good Mathlib (Lean 4) definitions, covering precedent excavation, design axes, and compiling example sheets. A niche but rigorous example of a domain-specific research skill.

skillmathliblean4formal-math
by homeowmorphism Aug 2, 2026 5/10
skill GitHub

Claude Code Skill for Adaptive Teaching with a Persistent Learner Model

A Claude Code skill for adaptive teaching on any topic, maintaining a persistent learner model and an evidence-pinned answer protocol across sessions. Aims to tailor explanations to what the learner already knows rather than restarting from scratch each time.

skilleducationadaptive-learning
by homeowmorphism Aug 2, 2026 6/10
skill GitHub

ignite: Shared Claude Code Team Bootstrap Kit

A shared bootstrap for Claude Code teams that bundles skill packages, review hooks, MCP servers, and a common CLAUDE.md into one setup. Aims to keep configuration consistent across a team's repos instead of each developer hand-rolling their own.

bootstrapteamskillshooksmcpclaude.md
by farofy Aug 2, 2026 6/10
skill GitHub

strava-run-analysis: Coaching-Grade Run Analysis in Claude

A Claude skill that analyzes Strava running data to compute decoupling, heart-rate zone time, and pace-at-HR trends that Strava's own dashboards don't surface. Scores execution honestly rather than just reporting raw stats.

skillstravafitnessdata-analysis
by alexandre-thiry Aug 2, 2026 5/10
skill GitHub

monetization-audit: Agent Skill for Finding Revenue Gaps

An agent skill that scans a project, researches its market with sourced evidence, and identifies monetization gaps. Outputs action specs an agent can execute directly, turning research into actionable next steps.

skillmonetizationmarket-researchbusiness
by succtorlin Aug 2, 2026 6/10
skill GitHub

open-geo: Measure Brand Visibility in AI Answers

A Claude Code skill that measures how visible a brand is across AI answer engines (Google AI Overview, ChatGPT, Claude, Gemini, Yandex Alice) by driving a logged-in browser agent to read the actual rendered answer rather than an API response. MIT licensed.

geoseobrand-monitoringai-search
by Pupok462 Aug 2, 2026 6/10
skill Reddit

PROMPTING.md: A Ruleset for Writing and Auditing AI Prompts

A researched framework covering how to write CLAUDE.md/AGENTS.md files, prompts, and plans so instructions actually reach and hold up in the model — including authority conflicts, instruction overload, prompt injection, and compaction survival. Ships as a standalone Markdown file or a packaged skill for Claude Code, Codex, Cursor, and OpenCode. MIT licensed.

promptingclaude.mdskillprompt-engineering
by Anbeeld Aug 2, 2026 7/10
skill GitHub

engineering-excellence: Generated Doctrine and Gates for AI Coding Agents

A one-command setup that turns a repository into a place where AI coding agents follow enforced conventions — generating agent instructions, golden-path examples, and machine-enforced gates for stacks like FastAPI, React, TypeScript, containers, AWS CDK, and GitHub Actions.

agent-instructionsci-gatesconventionsscaffolding
by samar1066 Aug 2, 2026 6/10
skill Reddit

79 CLAUDE.md Rules Tested Against Boris Cherny's 'Delete Every 6 Months' Advice

A practitioner sorted all 79 rules in their CLAUDE.md against advice from Claude Code creator Boris Cherny, who suggests periodically deleting CLAUDE.md/skills/hooks and re-adding instructions only when the model actually struggles without them. Only 22% of the rules turned out to be genuine delete candidates, highlighting how much of typical CLAUDE.md content may be unnecessary bloat.

CLAUDE.mdbest-practicesprompt-engineering
by Bulky_Ad738 Aug 2, 2026 7/10
skill GitHub

oogway: Agent Skill That Traces Every Bug Back to the Change That Caused It

A Claude Code / Codex / Cursor skill that generates a project report reviewing what shipped, tracing every problem back to the specific change that introduced it, and pricing out the cost of each next step. Framed as a post-mortem tool for teams running agentic development.

skillpostmortemreporting
by tensorboy Aug 2, 2026 6/10
skill GitHub

skill-comply: Behavioral Compliance Testing for Claude Code Skills

A Claude Code skill that measures whether agents actually follow the skills, rules, and agent definitions they're given, rather than assuming instructions are being followed. Automated behavioral testing for a problem many CLAUDE.md authors only discover the hard way.

skilltestingcompliance
by shimo4228 Aug 2, 2026 7/10
skill GitHub

claude-harness: Curated MIT-Licensed Agent Skills, Subagents & Rules

A curated, MIT-licensed collection of Agent Skills, subagents, and rules built against the open Agent Skills standard rather than being Claude-Code-only. Intended as a pick-and-choose library rather than an all-or-nothing framework.

skillssubagentsopen-standard
by shimo4228 Aug 2, 2026 6/10
skill GitHub

claude-translation-agency: Portable Skills for Codebase and Doc Translation

A set of portable Claude Code skills plus an agent panel that translates entire projects or individual files into any language, covering codebase i18n, WordPress/gettext, and documentation. Includes adversarial QA, per-run domain specialization, and terminology research to keep translations consistent.

translationi18nskill
by roshaw Aug 2, 2026 6/10
skill GitHub

book-to-skill: Turn a Book You Own Into a Claude Skill

Converts a book you already own into a Claude skill — a short index plus one file per chapter, loaded only when needed — so an agent can reference the book's content on demand. Free, MIT-licensed, and requires no coding.

skillknowledge-baseno-code
by shaunmarsden Aug 2, 2026 6/10
skill GitHub

skill-author: Turn a Repeated Task Into a Properly Bounded Skill

Helps convert a task you keep re-prompting for into a proper Claude skill with real guardrails and stop conditions, instead of leaving it as an ad hoc one-off prompt. Free, MIT-licensed, no coding required.

skillmeta-toolingno-code
by shaunmarsden Aug 2, 2026 7/10
skill GitHub

osint-skills: 28 OSINT Agent Skills for Coding Assistants

A set of 28 open-source-intelligence skills that turn Cursor, Claude, and other AI coding agents into a research platform for reconnaissance, attribution, GEOINT, and breach checks. Described as ethical, sourced, and passive-first.

osintskillresearch
by useosint Aug 2, 2026 6/10
skill GitHub

google-slides-skill: Redesigns a Google Slides Deck and Checks Its Own Work

A Claude Code skill that redesigns a Google Slides deck to match branding you point it at, then renders every slide it touches and inspects the resulting image before calling the job done — closing the loop between editing and visual verification.

skillgoogle-slidesvisual-verification
by eranw2000 Aug 2, 2026 6/10
skill GitHub

figure-extractor: Pull Complete Figures Out of PDFs and arXiv Papers

An agent skill for Claude Code, Codex, and Kimi that extracts complete figures and images from PDF, arXiv, and HTML papers, using caption-bounding-box detection with high-DPI PyMuPDF cropping and a contact-sheet QA step to verify the crops.

skillpdfresearch-tools
by Sunrich-HT Aug 2, 2026 6/10
skill GitHub

ctx404: Durable Project Context That Survives the AI Forgetting

Stores project context in the repository itself rather than in the model's memory, so context that would otherwise be lost between Claude Code sessions persists as part of the codebase.

context-managementmemoryskill
by claudneysessa Aug 2, 2026 6/10
skill GitHub

Agent-Memory-Starter: A Memory Vault That Ships Empty on Purpose

A starter memory vault for coding agents that ships completely empty, built around the idea that the hard part of agent memory isn't storing what an agent learned — it's stopping the store from filling up with stale facts over time.

memorystarter-kitskill
by BrinShadewater Aug 2, 2026 6/10
skill GitHub

Shadewater-SEO-Skill: SEO Audits That Show Their Work

An SEO audit skill that leads with evidence and reasoning before producing fixes, aiming to give an agent implementable fixes instead of generic boilerplate advice like 'your meta description is too long.'

seoskillaudit
by BrinShadewater Aug 2, 2026 5/10
skill GitHub

claude-skills-chart-generator: Scientific Chart Generation Skill

A Claude skill for generating scientific charts — bar, line, scatter, box plot, heatmap, and more — via Python/matplotlib, aimed at papers, lab reports, and academic publications.

skilldata-visualizationmatplotlib
by Defani Aug 2, 2026 5/10
skill GitHub

second-brain-setup: Obsidian as External Memory for Claude Code

A personal knowledge management setup for Claude Code that uses an Obsidian vault as external memory, growing with every session. Ships 5 slash commands and AI-first note conventions, built on the ideas in Karpathy's LLM Knowledge Bases writeup.

obsidianmemorypkm
by dmitrax Aug 2, 2026 7/10
skill GitHub

paper-review-and-digest: Journal-Club-Style Review and Fast-Read Skills for One Paper

Two Claude Code skills for working through a single academic paper: /paper-review does a journal-club-style appraisal with a deterministic GRADE + CrossRef gate, and /paper-digest does fast content absorption. Designed to pair with separate paper-radar (discovery) and paper-fetch (download) skills.

skillacademic-papersresearch
by drpwchen Aug 2, 2026 7/10
skill GitHub

hard-won-claude-skills: 8 Skills Distilled From One Production Incident History

A set of 8 Claude Code skills distilled from a single real production project, covering verification discipline, spreadsheet (xlsx) surgery, async task UI, and more — each rule written up as having been paid for by an actual incident.

skillproduction-lessonsverification
by poloplay0114 Aug 2, 2026 7/10
skill GitHub

cloud-finops-skills: FinOps Foundation-Aligned Cost Knowledge for AI Assistants

An open-source FinOps knowledge skill and MCP covering 28 reference files across AWS/Azure/GCP/OCI cost management, AI inference economics, Kubernetes, data platforms, allocation, chargeback, anomaly management, waste detection, and GreenOps. Installs into 11 AI tools and refreshes monthly.

finopscloud-costskill
by OptimNow Aug 2, 2026 7/10
skill GitHub

capcut-agent-kit: AI agent kit for CapCut video editing

Lets an AI agent build and edit CapCut desktop projects via edit-list driven generation, including split-screen vertical layouts and surgical timeline cuts. Ships with a Claude Code skill for direct integration.

skillvideo-editingcapcut
by manproai Aug 2, 2026 6/10
skill GitHub

Pangaea Labs Claude Code plugin marketplace

A plugin marketplace bundling several Claude Code skills: docsmith (markdown to on-brand PDFs), testcraft (user flows to test-case suites), dkv (graphic-design critique with measured WCAG contrast), and production-ready Go/ElysiaJS service scaffolding. Add the marketplace once, or use the npx installer to bring any skill to any agent.

skillmarketplaceplugins
by labspangaea Aug 2, 2026 7/10
skill GitHub

ai-research-skills: SKILL.md catalog for research workflows

A universal catalog of SKILL.md files covering literature review, research design, project memory, and manuscript writing, plus cross-agent delegation patterns for Claude Code, Codex, Gemini, Cursor, and other clients. 183 stars.

skillresearchcross-agent
by WenyuChiou Aug 2, 2026 8/10
skill GitHub

wenqu-skills: Content-Creation Skill Set for AI Agents

A collection of Claude Code skills covering the full content pipeline: research/material gathering, structuring, drafting, review/optimization, and publishing. Aimed at agent-assisted writing workflows.

content-creationwritingskill-collection
by gogoingai Aug 2, 2026 5/10
skill GitHub

audit-with-plans: Consistency Auditor for planning-with-files

A companion skill to the planning-with-files methodology that checks whether code actually matches what is recorded in .planning docs, using fresh-context subagents to avoid bias from the implementing session's context.

planningauditsubagentsconsistency
by JunbaoLiang Aug 2, 2026 6/10
skill GitHub

belay: A Safety-Net Skill for Vibe Coding

A Claude Code skill styled as a climbing belay: it holds the rope while non-developers vibe code, adding guardrails intended to make AI-driven coding safer for people without a software background.

safetynon-developervibe-coding
by thanathe Aug 2, 2026 5/10
skill GitHub

claude-for-hardware: Claude Code Skills for Hardware Design

A skill set for hardware design, validation, and bring-up work with Claude Code, extending agentic coding workflows into electronics and hardware engineering tasks.

hardwarevalidationengineering
by Midstall Aug 2, 2026 6/10
skill GitHub

ux-audit-skill: 16-Dimension UX Audit Skill for Claude Code

An agent skill that audits the UX of an existing product -- website, web app, mobile, or desktop -- across 16 dimensions. Every finding is backed by evidence, a severity rating, and a confidence score.

skilluxauditdesign
by paulunemoon Aug 2, 2026 7/10
skill GitHub

Skill-Sentinel: Behavioral Scanner for Claude Skills

Sandboxes a Claude Skill and traces what it actually does at runtime rather than trusting its stated description, aimed at catching skills that behave differently from what they claim before you install them.

securityskillssandboxaudit
by handcraftedbygod Aug 2, 2026 8/10
skill GitHub

plori skills: Teach Claude Code to Drive plori Cloud Agents

Agent Skills that teach Claude Code and other coding agents to create and control plori cloud computers -- remote sandboxed environments purpose-built for AI agents to operate in.

skillcloudsandboxplori
by plori-ai Aug 2, 2026 5/10
skill GitHub

claude-quartermaster: Audit Your Entire Claude Code Setup

Audits and improves your Claude Code setup -- extensions, CLAUDE.md files, permissions, and project structure -- across every project on your machine, treating context cost as a first-class metric to optimize.

auditclaude-mdpermissionscontext-cost
by dean815 Aug 2, 2026 7/10
skill GitHub

elves: Autonomous Multi-Batch Development Skill for Claude Code and Codex

A skill that queues and runs multiple autonomous development batches across Claude Code and Codex sessions, designed to keep making progress unattended, e.g. overnight. Aimed at extending agentic coding beyond a single supervised session.

skillautonomousmulti-agentcodex
by aigorahub Aug 1, 2026 7/10
skill GitHub

personal-finance-vault-skill: Archive-First Private Finance Vault

An agent skill for building a private, machine-readable personal finance vault using deterministic parsers rather than LLM guesswork for the numbers. Takes an archive-first approach with arithmetic reconciliation and explicitly flags unknowns instead of fabricating totals.

financeskillprivacyparsing
by su7811659 Aug 1, 2026 6/10
skill GitHub

rlm-claude: Recursive Language Models Bring Infinite Memory to Claude

Brings Recursive Language Models to Claude Code as an approach to effectively infinite memory, inspired by the MIT CSAIL RLM paper. Lets the agent recursively query over context that wouldn't otherwise fit in a single window.

memoryrecursiveresearchcontext
by EncrEor Aug 1, 2026 7/10
skill GitHub

deep-research: Evidence-Driven Research Pipeline for AI Agents

deep-research decides how deep to investigate a question only after weighing the evidence, using source-grade weighted scoring and thresholds hidden from the worker doing the research, plus investigation frames tailored to the type of question. Aimed at agent research pipelines that need more rigor than a single fixed number of research phases.

researchfact-checkingagent-skills
by treylom Aug 1, 2026 6/10
skill GitHub

写作理论技能集 (Writing Theory Skill Set) for Claude Code

A Chinese-language Claude Skills collection covering adaptation workflows, original screenplay writing, novel-theory review, and performance-layer prompting. Packages established writing theory into a structured skill set aimed at turning story ideas into finished works.

creative-writingchinesescreenwritingclaude-skills
by juemin4-source Aug 1, 2026 6/10
skill GitHub

dot-claude: A Maintained Public Claude Code Config

PaulRBerg's personal Claude Code configuration, designed to be cloned directly into ~/.claude via a Just-based install flow with Bun/uv dependencies and CI. Includes a custom ccc commit wrapper and Husky/lint-staged automation — a reference for structuring a maintained Claude Code dotfiles setup.

dotfilesclaude-code-configci
by PaulRBerg Aug 1, 2026 5/10
skill GitHub

issuekit: Issue-Driven Development Skills for AI Agents

issuekit is an Agent Skills bundle that treats each GitHub issue as the canonical rich plan for a unit of work, keeping volatile specs out of the repo so only durable code gets versioned. It's Japanese-oriented: skill bodies and docs are in English, but the skills expect Japanese section headers (e.g. 受け入れ条件) hardcoded into issue bodies.

issue-trackingagent-skillsjapanese
by hirokisakabe Aug 1, 2026 6/10
skill GitHub

Winning Writing: 31 Claude Skills from a Stanford GSB Course

An agentic writing toolkit built from Glenn Kramon's Winning Writing course at Stanford GSB and Rachel Konrad's cold-outreach lectures, packaged as 31 Claude skills. Includes a browser-based Coach with span-level inline critique and a refinement chat, plus a Chrome MV3 extension that runs the same critic inside the Gmail side panel.

writingclaude-skillschrome-extensionstanford-gsb
by kalyvask Aug 1, 2026 8/10
skill GitHub

k-fable-opus-claude-md: A Token-Lean CLAUDE.md Tuned for Opus 4.8

A CLAUDE.md configuration rewritten to cut token usage for Opus 4.8, built after the author was surprised by how many tokens Fable 5 was burning. Korean-language, but a useful reference for anyone trying to trim their own CLAUDE.md.

claude-mdtoken-optimizationopusfable
by habinsong Aug 1, 2026 5/10
skill GitHub

socratic: 697 Questions a Senior Engineer Asks Before Writing Code

Packages a senior engineer's pre-coding question checklist — 697 questions — as a Claude/Codex skill and a portable prompt, meant to catch design and edge-case gaps before implementation starts.

code-reviewchecklistcodexdesign
by m4vic Aug 1, 2026 7/10
skill GitHub

ultra11y: WCAG 2.2 AA Accessibility Audits With Anti-Hallucination Gates

Audits HTML/CSS/JSX against WCAG 2.2 AA and produces a dated compliance report, combining a zero-dependency static engine with agent judgment plus check/verify gates to catch hallucinated findings. Also usable to author or review accessible markup directly.

accessibilitywcagauditanti-hallucination
by maxgfr Aug 1, 2026 6/10
skill GitHub

salesforce-core-skills: Eleven Claude Skills for Salesforce Admin and Dev Work

Eleven general-purpose Salesforce skills — Apex, Flow, SOQL/Data, LWC, Metadata, Permissions, Diagrams, Org Audit, Tests, Security, and Debug — that work with any Salesforce MCP server. Installable as a Claude Desktop/Cowork plugin marketplace.

salesforceapexsoqlenterprise
by kugamon Aug 1, 2026 7/10
skill GitHub

system-analyst-skill: Markdown-to-PDF/DOCX With Mermaid Rendering

A system-analysis skill set (SRS, use cases, data dictionaries, architecture, RTM) built for a Thai-language project, paired with an md-to-docs converter that renders Mermaid diagrams into PDF/DOCX with Thai-language support.

documentationmermaidmarkdownthai
by UMIN1703 Aug 1, 2026 5/10
skill GitHub

eu-ai-act-skill: An EU AI Act Compliance Advisor Skill

A Claude skill covering EU AI Act Article 50 labeling duties, all exemptions, a no-label decision playbook, and DACH-specific Abmahnung (warning-letter) risk — first release in a planned AI governance skill family.

complianceeu-ai-actlegalgovernance
by dankofly Aug 1, 2026 6/10
skill GitHub

bullshit-detector: Claim-by-Claim Fact-Checking With a 0-10 BS Score

Fact-checks any YouTube video, article, tweet, or PDF claim by claim, citing sources and producing a 0-10 "BS score" — a skill for quickly sanity-checking content before trusting or sharing it.

fact-checkingverificationcontent-analysis
by SerhiiKorniienko Aug 1, 2026 7/10
skill GitHub

claude-compass: A Job-Search Plugin Pack for Visa-Sponsorship Countries

Slash commands for Claude Cowork that help IT/tech job seekers find visa-sponsorship and remote-hire countries, calculate realistic salaries, locate verified job portals, and screen job descriptions against a resume — grounded in real listings rather than guesses.

job-searchvisasalarycowork
by myowinthein Aug 1, 2026 5/10
skill GitHub

redact-pii-skill: A Reusable Skill for Redacting PII From Text

Identifies and redacts personally identifiable information in text — a drop-in skill for agents that need to scrub sensitive data before it's logged, shared, or sent to a model.

piiredactionprivacy
by scholarly360 Aug 1, 2026 5/10
skill GitHub

docs-skills: AI Agent Skills for Documentation Analysis

A collection of agent skills focused on analyzing documentation, compatible with Claude Code, Cursor, Codex, and Copilot. Helps agents review and reason about docs across multiple coding-agent hosts.

documentationskillsmulti-agentanalysis
by Docsbook-io Aug 1, 2026 6/10
skill GitHub

folder-structure-protocol: Skills for Evaluating Folder Architecture

Claude skills for auditing folder and project architecture and running staged AI workflows, built on a five-layer context hierarchy (ICM). Helps agents reason about codebase organization before making changes.

architecturefolder-structurecontextskills
by mcmespinaa Aug 1, 2026 5/10
skill GitHub

wilbeibi-skills: 16 Agent Skills for Claude Code and Codex

A skill pack covering code review, test writing, docs, planning, codebase onboarding, repo evaluation, paper search, and Obsidian capture/search. Installable via npx skills.

skillscode-reviewonboardingobsidian
by wilbeibi Aug 1, 2026 6/10
skill GitHub

How One Founder Runs a B2B GTM Function on Claude Code

A sanitized writeup of a real production setup: 14 skills, 4 MCP servers, and 14 scheduled agents running a B2B go-to-market function, including the memory layer and cron scheduling architecture.

gtmskillsmcpscheduled-agents
by romanmagdalenko Aug 1, 2026 7/10
skill GitHub

writer: Anti-Neuroslop Prose Editor Skill for RU/EN

A Claude Code skill that edits prose to strip AI-sounding patterns in Russian and English, organized into 23 rewrite categories with structural rewriting rules and an offline linter.

writingeditingrussian
by Mikefluff Aug 1, 2026 5/10
skill Reddit

brass-tacks: A Claude Code Skill to Cut Opus/Fable 5 Verbosity

Forces Claude to lead with the actual next step instead of preamble, breaks multi-step work into numbered bite-sized actions, and cuts filler like 'let me know if you need anything else.' Calibrated to explain jargon on first use without over-explaining basics. Toggle on with /brass-tacks, off by saying so.

skillconcisenessverbosity
by SkytheWitcher Aug 1, 2026 7/10
skill GitHub

billow: Self-Hosted Next.js App Foundation With Claude Code Release Skills

A self-hosted app foundation for Next.js with Better Auth, Prisma/Postgres, multi-arch Docker releases, and health diagnostics — tuned for Umbrel but runs anywhere Docker does. Ships Claude Code skills for handling releases and issues.

nextjsself-hosteddockerskills
by chepetime Aug 1, 2026 5/10
skill GitHub

property-deep-dive: Pre-Purchase Property Due-Diligence Skill for 126 Countries

A large Claude skill covering property due diligence across 126 countries with 41 invocable sections plus cross-cutting layers for tax, visas, mortgages, scams, and title-fraud monitoring. Every claim is sourced from primary government data, dated, and confidence-labeled.

skillreal-estatedue-diligence
by soreavis Aug 1, 2026 5/10
skill GitHub

my-llm-kit: A Personal, Versioned Claude Code Setup

One author's versioned personal Claude Code setup: a writing system (unslop), a research system, a global CLAUDE.md, and a single idempotent install script.

personal-setupclaude.mdwriting
by badmuriss Aug 1, 2026 5/10
skill GitHub

rig: A Multi-Agent Harness Packaged as a Skill

A multi-agent coding harness from GitHub Next, packaged as an installable Skill rather than a standalone tool.

multi-agentgithub-nextskill
by githubnext Aug 1, 2026 7/10
skill Reddit

697 Questions a Senior Engineer Asks Before Writing Code (Claude/Codex Skill)

A Socratic pre-coding checklist packaged as a Claude/Codex skill and portable prompt, designed to make the agent interrogate requirements and edge cases before writing any code rather than after. Aimed at teams wanting more upfront rigor than a quick one-shot implementation.

skillsocraticrequirementsplanning
by AffectionateSport135 Jul 31, 2026 6/10
skill Reddit

Dip-dip-dip-dip: Turns a GitHub PR Review Into 19th-Century Correspondence

A novelty Claude Code skill that rewrites PR review requests as ornate 19th-century letters, inspired by a Family Guy bit. A lighthearted example of using skills for tone and style transformation rather than pure productivity.

skillnoveltyhumorpr-review
by schrodingershit Jul 31, 2026 5/10
skill Reddit

feature-recon: multi-lens Claude Code plugin for codebase audits

A Claude Code plugin that sweeps your codebase through four lenses -- Product Engineer, UI/UX, Security, and QA -- producing JSON and HTML reports with charts. Includes a helper command to turn findings into task documents for follow-up work.

plugincode-reviewqasecurityaudit
by iSerter Jul 31, 2026 7/10
skill GitHub

Solana Skills: Claude Code plugin marketplace for DeFi agents

An open marketplace of Claude Code skills for Solana development, covering DeFi protocols (Jupiter, Kamino, Raydium), infrastructure (Helius, QuickNode), and more. Install via /plugin marketplace add; skills auto-activate based on context.

solanadefiblockchainmarketplaceskill
by sendaifun Jul 31, 2026 6/10
skill GitHub

naver-ads-expert: RAG-grounded Claude Skill for Naver Ads

A Claude Skill that turns an AI agent into a Naver Ads expert, grounded in all 1,148 official Naver Advertiser Center help documents with zero-dependency local search. Installable as a Claude Code plugin in two lines.

skillragkoreanadvertisingplugin
by JaceProgramming Jul 31, 2026 6/10
skill GitHub

Bilingual Annotator Toolkit: Dual-Column Translation Study Pages

A set of Claude Skills that turns any text into a color-coded, dual-column HTML page with side-by-side translation and structural analysis. Includes interactive study-visual generators, aimed at language learners and bilingual readers.

skilltranslationlanguage-learninghtml
by si-kui-a Jul 31, 2026 5/10
skill GitHub

iOS Architecture Expert Skill: Clean Architecture for Swift 6

A Claude Code Agent Skill for building modular, testable iOS apps using composition roots, protocol boundaries, and generic presenters. Targets Swift 6 concurrency patterns for clean architecture.

skilliosswiftarchitecture
by SwiftyJourney Jul 31, 2026 6/10
skill GitHub

Architecture Drawer: Text-to-Editable PowerPoint Diagrams

A skill for Claude Code and Codex that turns a text description of a system architecture into an editable PowerPoint diagram with native shapes, rather than a flat image export.

skilldiagramspowerpointarchitecture
by Andy1314Chen Jul 31, 2026 6/10
skill Reddit

SuperCMO: Open-Source AI Agent Skills for Creative Campaigns

A chain of Agent Skills that plans, generates, edits, and ships full creative campaigns (UGC video, product launches, content) using your own API keys. Routes each step to the right image, video, or audio model and includes a dry-run cost preview; works in Claude Code, Cursor, Codex, and other Agent-Skills-compatible tools.

skillmarketingcreativemedia-generation
by Key_Significance1880 Jul 31, 2026 6/10
skill GitHub

Claude Code <-> Codex Collaboration Skill

A global Claude Code skill enabling reliable collaboration with OpenAI Codex through MCP, for teams or individuals mixing both agents in one workflow.

skillcodexmcpmulti-agent
by iajihga Jul 31, 2026 6/10
skill GitHub

Book Capsule: One-Click Book Summary Cards (Chinese)

A Claude Skill that condenses a book into a card-style HTML summary, running entirely locally with no dependencies. Aimed at Chinese-language readers who want quick, shareable book digests.

skillsummarizationhtmlchinese
by zhouq2039-lang Jul 31, 2026 5/10
skill GitHub

ci-speedup: Audit Why Your GitHub Actions CI Is Slow

A free, MIT-licensed agent skill from StarSling that analyzes real GitHub Actions run history and reports concretely why CI is slow, rather than giving generic advice.

skillci-cdgithub-actionsperformance
by starslingdev Jul 31, 2026 6/10
skill GitHub

godplans: Emit a Complete Master Plan Before Any Code Is Written

A single-command Agent Skill that produces a complete, audit-proof, agent-executable master plan (PLAN.mdx) before implementation starts. Works across Claude Code, Codex, Cursor, OpenCode, and other Agent Skills clients.

skillplanningworkflow
by hannsxpeter Jul 31, 2026 5/10
skill GitHub

claude-code-skill-creator: Measure Whether Your Skills Actually Help

A rewritten derivative of Anthropic's skill-creator that adds trustworthy measurement of whether a skill actually improves outcomes: no silent zeros, one canonical workspace layout, target-aware validation, and 574 tests.

skillskill-creatortestingmeta
by OpenCnid Jul 31, 2026 7/10
skill GitHub

crun-agent-skills: Route Media Generation Across 138 Models

Agent skills that route, estimate cost for, create, and retrieve image, video, speech, and music generation across 138 models via the Crun API. Works with Claude Code, Codex, Cursor, and any SKILL.md-compatible platform.

skillmedia-generationapi
by Sean190828 Jul 31, 2026 6/10
skill GitHub

Bouncer: 13-Check Security Scanner for AI-Built Prototype Apps

A Claude Agent Skill that audits AI-built and prototype apps before real users see them, running 13 checks for exposed secrets, open databases, and missing auth, aimed at the common failure mode of vibe-coded apps shipping with basic security holes.

skillsecurityaudit
by punitsnaik Jul 31, 2026 7/10
skill GitHub

GA4 Analytics Data Quality Suite: Enterprise Tracking Plan Auditor

A GA4 tracking-plan auditor and UTM taxonomy enforcer built with custom Claude Agent Skills and Python, automatically catching schema drift, nested-parameter errors, and attribution breaks.

skillanalyticsga4
by samikshapattanaik-cmyk Jul 31, 2026 5/10
skill Reddit

7 Skill Improvements Learned the Hard Way

Practical lessons from building Claude Code Skills: ask clarifying questions before starting, add a verification step, use SKILL.md as a router to lazy-load resources, write triggering descriptions, promote proven skills to personal/plugin scope, pick the cheapest adequate model, and delegate context-heavy work to a sub-agent.

skillbest-practicestips
by Dear-Mix7726 Jul 31, 2026 6/10
skill GitHub

prompt-workflow-architecture: Turn a Rough Idea Into a Structured Prompt

A Claude Code skill that interviews you to convert a rough task idea into a high-level prompt with explicit outcome, guardrails, and self-verification, then picks the right execution mode: single agent, workflow, loop, or routine.

skillpromptingworkflow-design
by promptmetrics Jul 31, 2026 6/10
skill GitHub

plain-ko: A Korean Tech-Writing Rhetoric Linter

A Claude Code skill that flags excessive Sino-Korean abstract vocabulary and rhetorical padding in Korean technical writing, suggesting concrete alternatives, and grows its own dictionary from your git correction history over time.

skillkoreanwritinglinter
by IMMINJU Jul 31, 2026 6/10
skill GitHub

multi-agent-delegation: stop silent no-op failures in subagent handoffs

An agent skill for Claude Code and Codex that prevents subagents from silently failing to do the work they were delegated. It enforces mandatory prompt clauses, verifies artifacts actually exist after delegation, supports resume-based recovery, and uses a ledger-as-spec approach for parallel delegation.

skillsubagentsdelegationverification
by h8nc4y Jul 31, 2026 6/10
skill GitHub

india-itr-skills: Claude Code skills for filing Indian income-tax returns

A set of Claude Code skills for filing ITR-1 and ITR-2 Indian income tax returns, covering AIS/TIS/26AS reconciliation, Schedule AL, Schedule 112A CSV generation, and end-to-end portal filing, distilled from the author's real filings.

taxindiadomain-skill
by ankitkr Jul 31, 2026 6/10
skill GitHub

sdd-skills: spec-driven development skills with contract-based auto-fix

Claude Code skills implementing spec-driven development: turning a PRD into a spec/contract, implementing against it, then running contract-based evaluation with automatic fixes when the implementation drifts from the contract.

spec-drivenskillcontracts
by dayvisonassis Jul 31, 2026 6/10
skill GitHub

claude-dataroom-prep: structure messy folders into M&A-ready datarooms

A Claude Code skill that classifies, deduplicates, and version-detects files in a messy folder to build an M&A-ready dataroom, including a contextual missing-documents checklist. Supports French, English, German, Italian, and Spanish.

m&adocument-managementskillmultilingual
by Hectelion-SA Jul 31, 2026 6/10
skill GitHub

cc-delegate: WorkBuddy Skill for Reliably Delegating Long Tasks to Local Claude Code

A Claude Code skill that uses claude-code-mcp with stateful --resume to hand off long-running tasks to a local Claude Code instance without losing context. Supports cross-call handoff so work can be picked back up across multiple invocations without re-explaining state.

skillmcptask-delegation
by gugug168 Jul 30, 2026 6/10
skill GitHub

codex-image-skill: Image Generation/Editing via Codex CLI with Pin-Comment Review Loop

A Claude Code skill that generates and edits images using Codex CLI's gpt-image-2 model, with a pin-comment review loop for iterative feedback and a CJK label overlay pipeline. Useful for teams needing AI-generated imagery with localized text overlays reviewed in-context.

skillimage-generationcodex
by bbiyakfather Jul 30, 2026 6/10
skill GitHub

slop-metrics: Score Your Codebase for AI Slop Against SlopCodeBench Baselines

An agent skill that scores any codebase for slop (structural erosion and verbosity) and compares the result against SlopCodeBench's published human and agent baselines, giving a benchmarked way to judge whether AI-assisted code is degrading in quality.

skillcode-quality
by dontbanmeplz Jul 30, 2026 5/10
skill GitHub

Cambrian: Claude Code Plugin for Generating Diverse, Non-Cliche Ideas from a Brief

A domain-agnostic Claude Code plugin that generates varied ideas from any brief by combining blind variation, MAP-Elites, novelty search, DPP selection, and human guidance, without needing extra LLM API keys. Aims to avoid the generic ideas plain LLM brainstorming tends to produce.

skillideationplugin
by sergiparpal Jul 30, 2026 7/10
skill GitHub

ux-proofsheet: Benchmark a UI/UX Design Against How Real Apps Ship

A Claude Agent Skill that benchmarks a UI/UX design against how comparable real apps actually ship, both within your industry and outside it, giving concrete precedent-based feedback instead of generic design critique.

skillux-design
by mananritwik Jul 30, 2026 6/10
skill GitHub

ENLOOP.Skill: Self-Grading Prompt Refinement Loop with a Bounded Stop Condition

A Claude Skill that rewrites your prompt, runs it, and grades the result against its own success criteria in one turn. The loop is bounded to a max of 2 refine passes, with a separate stop condition and a no-progress halt to prevent runaway iteration.

skillself-refinement
by keymessagesstudio-design Jul 30, 2026 6/10
skill GitHub

visual-vibes: Evidence-Backed Architecture Diagrams as a Claude Skill

A Claude Agent Skill that builds one grounded model of a repository and renders it as consistent C4, UML, ERD, DFD, sequence, deployment, and security diagrams using Mermaid and draw.io. Keeps diagrams evidence-backed and consistent across views instead of hand-drawn and drifting from the code.

architecture-diagramsmermaiddocumentation
by yash0208 Jul 30, 2026 7/10
skill GitHub

Five Claude Skills for Humanities Students (Law, History, Lit, More)

A set of five ready-made Claude Skills for students in close-reading, argument, and citation-heavy fields: law, political science, history, sociology, and literature. No programming knowledge needed to install or use them, bringing Claude Code-style tooling to non-technical disciplines.

humanitieseducationnon-coding
by Poisoneddiety Jul 30, 2026 5/10
skill GitHub

exceptd-skills: AI Security Skills Grounded in 2026 Threat Reality

A collection of security-focused Claude Skills built around current (mid-2026) threat patterns rather than stale framework documentation. Aims to keep security guidance for AI-assisted development up to date as the threat landscape shifts.

securityskillsthreat-modeling
by blamejs Jul 30, 2026 6/10
skill GitHub

feature-map: Business-Flow Memory That Audits Cross-Layer Drift

Maintains a FEATURE-MAP.yaml registry that tracks how features touch client, backend, admin, and docs layers, then audits drift between them as GAP/DRIFT/IMPACT/OK. Ships as both a Claude Code plugin and a Codex skill, helping agents keep cross-layer changes in sync instead of silently diverging.

drift-detectionplugincodebase-mapping
by ade-syofyan Jul 30, 2026 7/10
skill GitHub

sai-poster-studio: Describe a Poster in English, Get Print-Ready Art

A local studio plus a keyless Claude Skill that turns a plain-English description into a finished, on-brand poster as print-ready PNG or SVG. Useful for quick promotional or event graphics without opening a design tool.

poster-designgraphicslocal-studio
by wyuee912-ops Jul 30, 2026 6/10
skill GitHub

launchworthy: Production Readiness Audits for AI-Built Apps

A Claude Code skill that audits AI-built apps (from Lovable, Bolt, v0, Cursor, and similar builders) across five production-readiness domains and returns a scored punch list with copy-paste fixes. MIT licensed; targets apps built across multiple AI builders rather than one specific stack.

production-readinessauditmit-license
by Wunderlandmedia Jul 30, 2026 6/10
skill GitHub

skill-interviewer: Turn Expert Interviews into Portable AI Skills

Runs structured interviews with a domain expert to extract tacit judgment, workflows, exceptions, and acceptance criteria, then compiles the result into a portable AI skill usable by Claude and Codex. A meta-tool for capturing expertise that would otherwise stay undocumented.

skill-authoringexpert-knowledgemeta-tool
by eritowu Jul 30, 2026 7/10
skill GitHub

video-to-skill: Turn Videos and Courses into Grounded Agent Skills

Converts videos and course material into evidence-grounded Agent Skills for Claude Code and Codex, extracting procedural knowledge from video content instead of requiring it to be written up by hand. Extends the video-to-skill idea to full courses, not just single videos.

skill-authoringvideoeducation
by Lum1104 Jul 30, 2026 6/10
skill GitHub

Univer Skill: Git-Style Diffs and Review for AI Spreadsheet Edits

A Claude Skill (and CLI) that lets AI tools work directly with spreadsheets, Excel workbooks, and CSV files, adding Git-style diffs, reviews, approvals, and rollbacks to spreadsheet edits. Makes human-AI collaboration on spreadsheets structured and reviewable instead of a black box.

spreadsheetsgit-diffexcel
by dream-num Jul 30, 2026 7/10
skill GitHub

bochi: Idea Expansion Skill Using Socratic Questioning and SCAMPER

A Claude Code skill that transforms a raw idea seed into structured hypotheses through Socratic questioning, SCAMPER, ReAct-style research, E-E-A-T scoring, and first-principles critique. Useful for turning a vague idea into something rigorously examined before committing time to it.

ideationsocratic-methodresearch
by fideguch Jul 30, 2026 7/10
skill GitHub

plain-language-skill: Write Documents to the ISO 24495-1 Standard

An agent skill that writes documents conforming to ISO 24495-1:2023, the international Plain Language standard. Works with Claude Code, Cursor, Codex, and any harness that supports the Agent Skills standard, useful for anyone who needs clear, accessible writing output by default.

plain-languagewritingiso-standard
by nikdumroese Jul 30, 2026 6/10
skill GitHub

token-optimiser: Pick Model, Surface, and Budget Before You Run

A Claude skill that routes a task before execution, surfacing the right model choice, interface, and token budget in one card. Aimed at spending tokens deliberately rather than defaulting to the most expensive model for every task.

token-optimizationroutingcost-control
by jamiecooper4-netizen Jul 30, 2026 6/10
skill GitHub

Context-Engineering: Repo Skeleton and Skills to Audit CLAUDE.md

A context-engineering standard for Claude Code combining distilled Anthropic guidance, a replicable repo skeleton, and skills that install and audit adherence to it. One of several context-engineering entries in this space, focused specifically on installable and auditable structure rather than token reduction.

context-engineeringclaude-mdaudit
by BriarDevv Jul 30, 2026 5/10
skill GitHub

dev-toolkit: Platform Engineering Kit of Actions, Skills, and Configs

A platform-engineering toolkit bundling reusable GitHub Actions, AI Skills, and shared TypeScript configs. A grab-bag utility repo useful mainly to teams standardizing tooling across multiple projects.

platform-engineeringgithub-actionstypescript
by kin0992 Jul 30, 2026 5/10
skill GitHub

Plugins-Weave: 7-Plugin Claude Code Marketplace incl. Hierarchical RAG Memory

A Claude Code plugin marketplace offering seven plugins: ContextPreloader (initial context loading), EpisodicRAG (hierarchical long-term memory), EmailingEssay (AI-driven essay delivery), VisualExpression (expression layer), EmotionPulse (emotion indicator), TelegramSecretary (serverless AI secretary), and ConsiderateCoder (AI-delegated development). A varied, personality-driven plugin set built around an assistant persona.

plugin-marketplacerag-memorypersona
by Bizuayeu Jul 30, 2026 6/10
skill GitHub

MyR2D2: Astromech-Droid Claude Code Skillset (zh-TW, Bilingual)

A Claude Code skillset styled as a personal astromech droid assistant, with bilingual Traditional Chinese/English triggers. A fun, persona-driven skill pack aimed at Traditional Chinese-speaking users.

personabilingualzh-tw
by tingyulu Jul 30, 2026 5/10
skill GitHub

dotnet-lean-arch-skill: Pragmatic Clean Architecture for .NET

An Agent Skill that packages a pragmatic Clean Architecture approach for .NET backends. Gives Claude Code a consistent structural pattern to follow when scaffolding or reviewing .NET services.

dotnetclean-architecturebackend
by jbrambilla Jul 30, 2026 5/10
skill GitHub

Apiiro Security Plugins for Claude Code and Cursor

Official security plugins from Apiiro adding secrets detection, threat modeling, and prompt enrichment to Claude Code and Cursor. Brings enterprise application-security tooling directly into the agent workflow.

securitysecrets-detectionthreat-modeling
by apiiro Jul 30, 2026 7/10
skill GitHub

Google AppSheet Agent Skill with Doc Grounding and Security Gates

A production-ready Agent Skill for building on Google AppSheet, grounded in official documentation with built-in security gates, templates, and validation helpers. Reduces hallucinated AppSheet APIs when an agent scaffolds an app.

appsheetgooglelow-code
by Yash-Kavaiya Jul 30, 2026 6/10
skill GitHub

degardis-skills: Production-Ready Skills for Common Dev Workflows

A curated collection of AI agent skills covering bug fixing, code review, testing, refactoring, documentation, dependency upgrades, performance optimization, feature implementation, and tech migration. Authored with the Degardis toolset.

skillsdev-workflowtestingrefactoring
by Khojasteh Jul 30, 2026 6/10
skill GitHub

claude-skills-templates: Five Reference SKILL.md Patterns

Five production-ready Claude Skill templates, a one-pager writer, code reviewer, brand voice keeper, CSV cleaner, and decision-doc generator, each demonstrating a different SKILL.md pattern. MIT licensed and drops into Claude Code or Claude.ai.

skill-templatesexamplesmit-license
by 0xelitesystem Jul 30, 2026 7/10
skill GitHub

Claude Code Power Pack Lite: CLAUDE.md Template and TDD/PR-Ship Skills

The free lite edition of the Claude Code Power Pack, bundling an engineering-grade CLAUDE.md template, TDD and PR-ship skills, and a balanced permission preset. Bilingual English/Chinese documentation.

claude-mdtddpermissionsskills
by huangxiaojian Jul 30, 2026 6/10
skill GitHub

s3-temp-share: Agent Skill for Expiring S3/R2 File Links

An Agent Skill and CLI for sharing files privately via temporary, expiring S3 or Cloudflare R2 URLs. Lets an agent generate a short-lived shareable link instead of exposing a permanently public bucket.

s3r2file-sharingcli
by jweaker Jul 30, 2026 6/10
skill GitHub

seo-client-report-skill: Automated Branded SEO Client Reports

A Claude Code / Codex skill that turns Search Console, GA4, and rank-tracker exports into a branded, live monthly SEO client report using a consistent template with no fabricated metrics. Publishes the report via the ReportRoom MCP.

seoreportingautomation
by dashaworks Jul 30, 2026 6/10
skill GitHub

share-as-link-skill: Turn Any AI Output into a Live Public Link

A Claude Code / Codex skill that converts any chat reply, artifact, or markdown output into a live public URL in about 10 seconds, with view-count tracking. A lightweight DocSend-style alternative for quick sharing, published via the ReportRoom MCP.

sharingpublishingtracking
by dashaworks Jul 30, 2026 6/10
skill GitHub

data-room-skill: Build a Due-Diligence Data Room from Your Agent Session

A Claude Code / Codex skill for building an M&A or fundraising due-diligence data room, with email/passcode/allowlist access, NDA gating, expiry, instant revoke, and per-viewer analytics. Runs on the ReportRoom MCP's paid Business plan.

data-roomfundraisingdue-diligence
by dashaworks Jul 30, 2026 5/10
skill GitHub

AlemTuzlak/skills: Turn a PR or Idea into Marketing Content and Videos

Personal agent skills for Claude Code, Copilot, Codex, Gemini, and Cursor that turn a pull request or idea into marketing copy, technical Slidev presentations, courses, changelogs, and rendered videos. Useful for developers who need to communicate technical work to a broader audience.

marketingslidevvideochangelog
by AlemTuzlak Jul 30, 2026 6/10
skill GitHub

A 20-Plugin, 160-Skill Multi-Harness Marketplace

A public marketplace bundling 20 plugins and 160 skills for Claude Code, Claude Cowork, and Codex. One of the larger community skill/plugin collections available for quick installation.

marketplacepluginsskills
by Israelmusondaayliffe Jul 30, 2026 5/10
skill GitHub

amlei-resume: End-to-End Resume-Building Agent Skill

An Agent Skill (agentskills.io spec) that walks you through building a resume from raw material to a finished A4 PDF, including role-targeted rewrites and outreach messages for job platforms. Compatible with Claude Code, Cursor, Codex, and other agent runtimes.

resumecareerpdf
by amlei Jul 30, 2026 5/10
skill GitHub

aiv-mini-audit: Free Claude Skill for AI Visibility Audits

A free Claude skill that checks whether AI assistants mention your business when a buyer asks for a recommendation, an early take on AI visibility auditing. Useful for businesses trying to understand how they show up in AI-generated answers.

seoai-visibilityaudit
by autojate Jul 30, 2026 6/10
skill GitHub

skills: Cross-Agent Skill Collection for Claude Code, Cursor & Codex

A collection of agent skills installable via npx skills add stewartcelani/skills, compatible with Claude Code, Cursor, Codex, and similar coding agents. Provides a quick way to pull in a curated skill set without manual setup.

skillscross-agentinstaller
by stewartcelani Jul 30, 2026 5/10
skill GitHub

distro-skills: Agent Skills for Launching Dev Products

Agent Skills that automate distributing developer and indie products across Show HN, Product Hunt, awesome-lists, dev.to, GitHub, Reddit, X, and npm/PyPI. Positioned as the release/marketing counterpart to build-focused skills.

skillsmarketinglaunchdistribution
by royalpinto007 Jul 30, 2026 6/10
skill Reddit

memU: Mines Claude Code Session Logs into Persistent Memory

An open-source (Apache-2.0) memory skill that installs itself by having Claude Code fetch its SKILL.md, then mines your session transcripts into editable memory files and patches your setup to retrieve relevant memories before answering. Aimed at replacing a hand-maintained CLAUDE.md that has grown into a stale junk drawer of half-remembered rules.

memoryskillsession-logsopen-source
by AcanthisittaOk1699 Jul 30, 2026 7/10
skill GitHub

agent-workspace: lifecycle skills for agent workspace hygiene

A set of lifecycle skills that give a coding agent a persistent sense of where a project stands across sessions — tracking state, decisions, and next steps as ongoing workspace memory and hygiene.

skillmemoryworkspace-hygiene
by conorbronsdon Jul 30, 2026 6/10
skill GitHub

agent-skill-builder: a skill that builds skills — with drift validation

A skill that scaffolds new agent skills with spec-current frontmatter, paired with a validator that fails the build when a skill's structure drifts out of spec. Aims to keep a growing skill library consistent instead of rotting over time.

skillvalidatormeta
by conorbronsdon Jul 30, 2026 6/10
skill GitHub

skill-matting: AI background removal for images and video

A Claude Code skill for AI-powered image and video background removal using the BiRefNet GGUF model, outputting transparent PNG, MOV, or WebM. Useful for quickly matting assets without leaving the agent workflow.

skillimage-processingvideomatting
by xiaowu89 Jul 30, 2026 5/10
skill GitHub

rote: compile agent skills into deterministic, LLM-free pipelines

Compiles AI agent skills into cheap, fast, deterministic pipelines that run without an LLM in the loop once compiled. Useful for turning a skill you've validated with an agent into a repeatable script that doesn't need inference to execute.

skilldeterminismpipeline
by trevhud Jul 30, 2026 6/10
skill GitHub

conversation-digest: turn long threads into a decision-ready digest

A Claude Code skill that condenses long Slack threads, tickets, incident logs, and announcements into a decision-ready digest plus a clear list of what you personally need to do next. Available in Vietnamese and English.

skillsummarizationslackdigest
by Rayloveyou Jul 30, 2026 6/10
skill GitHub

handover: a disposable end-of-session handover skill

A Claude Code skill for tight, disposable end-of-session handovers: it routes durable facts to permanent memory stores and keeps only what the next session actually needs to resume, instead of dumping the whole transcript.

skillmemorysession-handover
by ami-bu Jul 30, 2026 7/10
skill GitHub

academic-homepage-cv-sync: Keep Your Website and LaTeX CV in Sync

A YAML-based maintenance kit for academic homepages: one script regenerates a Jekyll website and a LaTeX CV from the same source data, so the two can never drift apart. Ships with a CLAUDE.md that teaches Claude Code the update workflow, so adding a new paper is as simple as asking the agent to add it.

claude-mdtemplateacademicautomation
by kw1jjang Jul 30, 2026 5/10
skill GitHub

pmm-os: 45 Product Marketing and GTM Skills for the Terminal

A skill pack covering product marketing and go-to-market work directly from the terminal: positioning, messaging, personas, pricing, battlecards, and launches, plus an interactive launch kit. Built for Claude Code and Codex.

marketinggtmskill-pack
by buildingwithai Jul 30, 2026 5/10
skill GitHub

novel-to-game: A 7-Skill Pipeline That Turns a Story Into a Playable Game

Adapts any novel or story into a playable game through a 7-skill pipeline, distilling narrative into game mechanics and content rather than just generating a generic game shell. Built for Claude Code, Codex, and Kimi Code.

game-devnarrativeskill-pipeline
by worldwonderer Jul 30, 2026 6/10
skill GitHub

Kudosity Skills: Send SMS, MMS, WhatsApp, and RCS from Any Agent

Agent skills for the Kudosity messaging platform, letting Claude Code, Cursor, Copilot, Windsurf, or any SKILL.md-reading agent send SMS, MMS, WhatsApp, and RCS messages. A vendor-specific messaging integration for agents that need to notify or reach users directly.

messagingsmswhatsappintegration
by kudosity Jul 30, 2026 5/10
skill GitHub

ui-ux-laws: A Claude Code Skill That Enforces UI/UX Best Practices

Packages priority-ordered UI/UX laws, cognitive-psychology principles, Nielsen heuristics, and accessibility non-negotiables into a Claude Code skill. The model actively checks and enforces these rules on its own generated UI output rather than just referencing them as documentation.

ui-uxaccessibilitydesignskill
by AmirGhl Jul 30, 2026 6/10
skill Reddit

/call-me: Let Your Claude Agent Call Your iPhone (Free)

A Claude Code skill plus companion iPhone app that lets your agent place a phone call to you when it needs input, using internal iPhone APIs so there are no external calling fees. Aimed at long-running tasks, scheduled jobs, and cron sessions where you might not check chat for hours.

notificationsiphonehuman-in-the-loopskill
by radressss Jul 30, 2026 6/10
skill GitHub

devops-skills: Multi-Tool DevOps Skills for Claude Code, Cursor, and Codex

Covers Terraform, Kubernetes, Docker, GitHub Actions, GitLab CI, AWS FinOps, and OWASP security as skills usable across Claude Code, Cursor, and Codex. A broad DevOps skill pack rather than a single-tool integration.

devopsterraformkubernetessecurity
by anmolnagpal Jul 30, 2026 6/10
skill GitHub

firma: Anti-Slop Design Skill for Spanish-Speaking Coding Agents

A design skill built for developers who ship in Spanish ("quienes shippean en espanol"), enforcing voseo language conventions, treating honesty as a hard rule, and rotating memory between builds to avoid design drift. Fills a gap for non-English-first Claude Code skill packs.

spanishdesignanti-sloplocalization
by stgomoyaa Jul 30, 2026 5/10
skill GitHub

duet: Reflection, Writing, and Design Skills for Claude Code

A Claude Code plugin bundling slash commands, agents, and workflow tools centered on reflection, writing, and design work rather than pure coding tasks. Installs as a standard plugin under the Claude Code plugins directory.

writingreflectionplugin
by tslateman Jul 30, 2026 5/10
skill GitHub

AgentAlertsSkill: iPhone Live Activity and Notification Alerts for Coding Agents

A Codex/Claude skill that sets up automations pushing iPhone Live Activity, widget, notification, and Control Widget updates directly from your agent session. Lets you glance at your lock screen or Dynamic Island to see agent status instead of checking a terminal.

iphonelive-activitynotificationsskill
by AndreasInk Jul 30, 2026 6/10
skill Reddit

Sol-skill: Fable 5 as orchestrator, Sol 5.6 as worker

A Claude Code skill/plugin that lets Fable 5 hand off implementation tasks to Sol as a worker model, then reviews the results afterward to save tokens. Installable via plugin marketplace; supports both implementation and research delegation commands.

skillorchestrationmulti-modelplugin
by kasikciozan Jul 29, 2026 6/10
skill GitHub

agent-skills: laravel-filament skill for Claude Code

A version-aware Claude Code skill covering Laravel Filament best practices across versions 1 through 5, including upgrade guides — useful for teams maintaining Filament admin panels across version bumps.

skilllaravelfilamentphp
by majdghithan Jul 29, 2026 5/10
skill Reddit

A CLAUDE.md emphasizing terse final replies and mandatory fact-checking

A shared global CLAUDE.md focused on response style (match length to task, no play-by-play narration, structured root-cause/fix/verification summaries for debugging), code quality defaults (root-cause fixes, appropriate data structures, unsolicited error handling where needed), and a fact-checking policy that bans citing external numbers from memory and requires labeling claims as verified/recalled/inferred.

claude.mdconventionsfact-checking
by DeliciousGorilla Jul 29, 2026 5/10
skill Reddit

Keeping CLAUDE.md "keeper" rules alive across /doctor trims and model changes

A convention for surviving /doctor's CLAUDE.md trimming: since /doctor keeps no diff of what it cut, snapshot CLAUDE.md before running it. More notably, store the pitfalls/rationale/conventions /doctor preserves as named, versioned files in a prompt library outside any single repo (rather than only inline in one CLAUDE.md), with per-model variants where guidance genuinely differs between model generations — CLAUDE.md then just references what the current repo needs.

claude.mddoctorconventionsversioning
by Dry-Lavishness-2909 Jul 29, 2026 6/10
skill GitHub

neatcontext-plugins: Reusable Domain Knowledge From AI Chats

neatcontext-plugins turns long AI conversations into reusable domain knowledge that carries across sessions, packaged as Claude Code and Codex skills/plugins. It's aimed at cutting down repeated context-setting when working the same domain over multiple sessions.

context-managementskillclaude-code-pluginknowledge-management
by XTSoftwareLabs Jul 29, 2026 6/10
skill GitHub

codex-image-gen: Image Generation Skill via Local Codex CLI

codex-image-gen is an agent skill that generates images by shelling out to a locally installed, OAuth-authenticated Codex CLI, avoiding separate API keys. It enforces exact output sizes and archives every prompt for reproducibility.

skillimage-generationcodexclaude-code
by stephenlzc Jul 29, 2026 5/10
skill GitHub

Living Docs: A No-Drift Documentation System as an Agent Skill

Living Docs is an agent skill that runs project documentation -- constitution, ADRs, BDRs, PRDs, issues, research notes, and Mermaid diagrams -- as a living system under five governance invariants meant to prevent drift from the actual code. It's stack-agnostic and works across Claude Code, Cursor, Copilot, OpenCode, and Pi.

documentationskillgovernanceclaude-code
by ejklock Jul 29, 2026 6/10
skill GitHub

skillshilp: Meta-Skills for Building Production-Quality Agent Skills

skillshilp is a set of meta-skills for creating, reviewing, and maintaining production-quality Agent Skills, spanning Claude, Codex, Copilot, Cursor, and more. It brings consistency and quality control to the growing pile of skill files teams accumulate.

skillmeta-skillqualityclaude-code
by ViGi-P Jul 29, 2026 6/10
skill GitHub

ko-official-doc-style: Korean Official Document Writing Skill

A Claude Code skill that enforces Korean official-document writing standards — article numbering, date and currency formats, punctuation, and spacing conventions — for generated formal documents.

skillkoreandocumentationlocalization
by dltkddns833 Jul 29, 2026 5/10
skill Reddit

gtm-cofounder: 18 Open-Source Go-To-Market Skills for Technical Founders

A set of 18 agent-agnostic GTM skills (plain SKILL.md files) for technical founders who can build but struggle with positioning, first users, and pricing. Interviews the founder, then writes a founder brief and prioritized roadmap into the repo as markdown.

skillgtmstartupmarketing
by ShoddyReference2163 Jul 29, 2026 6/10
skill GitHub

start-working-template: Claude Skill Template for Starting a Work Session

A skill template for launching one focused Claude Code work session — parallel information gathering, a clean-up sweep, a three-question interview, a human/Claude task split, a session card, and close-out logging.

skilltemplatesession-management
by jason8-8 Jul 29, 2026 5/10
skill GitHub

pre-mortem-skill: Pressure-Test a Plan Before Its Next Irreversible Action

Runs a pre-mortem on a concrete plan, surfacing decision-critical failure paths with evidence status, control assessment, and a residual-risk classification (Tiger/Open/Paper). Built for irreversible-action review, not vague intentions or after-the-fact root-cause analysis.

skillriskplanning
by ReedLiner Jul 29, 2026 6/10
skill GitHub

predictdog_skill: Trade on Polymarket via Predictdog

A Claude Code skill for trading on Polymarket through Predictdog — search markets, view your portfolio, check PnL, and place trades from the agent.

skilltradingprediction-markets
by HQSV-Labs Jul 29, 2026 5/10
skill GitHub

azure-lean-stack-skills: Azure Apps That Cost Nothing When Idle

A Claude Code skill pack of 14 composable skills for building Azure apps that scale to zero cost when nobody's using them, documenting 37+ gotchas along with branch-per-environment CI/CD.

skillazurecost-optimizationcicd
by alexpizarro Jul 29, 2026 6/10
skill GitHub

guided-tour: A Live, Interactive Guided Tour of Any Codebase

A Claude Code skill that turns Claude into a hands-on tutor for a codebase — a live, interactive tour with real checkpoints, grounded in file:line citations rather than generic explanations.

skillonboardingdocumentation
by jonascript Jul 29, 2026 6/10
skill GitHub

Divan: Turkish Skill Packages for Claude Code, Cursor, and Codex

A council of vibe-coding skill packages (Turkish) for Claude Code, Cursor, and Codex — an end-to-end orchestrator (Sadrazam), plus planning, TDD, debugging, and UI/UX-React skills.

skillorchestrationturkish
by trugurpala Jul 29, 2026 5/10
skill GitHub

mcp-audit-skill: Systematic MCP Server Audits Against Best Practices

A Claude skill for systematically auditing MCP servers against a curated best-practices corpus — 68 checks across 8 categories covering OAuth 2.1, OWASP, the Lethal Trifecta, and Swiss compliance (DSG/ISDS).

skillmcpsecurity-auditoauth
by malkreide Jul 29, 2026 7/10
skill GitHub

html-explainer-skill: Turn Markdown Answers Into a Single HTML File

An agent skill that swaps a markdown response for a single-file HTML page — tabbed content, dark theme, Bootstrap 5 plus highlight.js via CDN with SRI, a copy button on every block, and tab deep-linking through the URL. Includes a linter that rejects broken ARIA, unescaped code, and floating CDN versions. No npm, no build.

skillhtmldocumentation
by frederico-kluser Jul 29, 2026 6/10
skill GitHub

advisory-panel: A Named Advisory Panel With a Mandatory Dissent Rule

A panel of 3 to 5 named advisory voices for thinking through a decision, with a mandatory-dissent rule so someone always has to disagree with you. Works in Claude chat, Cowork, and Claude Code.

skilldecision-makingadvisory
by MonicaOrtizM Jul 29, 2026 5/10
skill GitHub

Awesome Skills & Plugins for Students (IB, IGCSE, College)

A curated list of Claude Code, Cursor, and Copilot skills and plugins built specifically for students, covering IB, IGCSE, and college-bound coursework. A useful starting point for anyone studying alongside an AI coding agent.

skillsstudentseducationcurated-list
by StudentSuite Jul 29, 2026 5/10
skill GitHub

Deslop: Skills That Strip AI-Sounding Patterns From Writing

Two editing skills for Russian and English text that remove common AI-generated writing tells without flattening the author's voice. Explicitly not a detector-bypass tool, it's aimed at making AI-assisted writing read naturally.

skillwritingediting
by spyrae Jul 29, 2026 5/10
skill GitHub

code-webdesign: Website + Design System Skill With Blocking Checks

A Claude Code skill that builds a website alongside the design system that governs it, enforcing checks that block rather than merely advise. Keeps generated UI consistent with a project's design tokens instead of drifting per page.

skilldesign-systemwebquality-gate
by jaenicket Jul 29, 2026 6/10
skill GitHub

many-ppt-skills: Benchmarked Catalog of 26 AI Slide-Deck Skills

Surveys every AI slide-deck skill worth knowing on one page, covering both HTML and native-PPTX routes, bilingual (English/Chinese). Ranks them with a reproducible benchmark instead of relying on star counts.

skillslidesbenchmarkpresentation
by brycewang-stanford Jul 29, 2026 7/10
skill GitHub

claude-roadmap-skill: Keeps ROADMAP.md Always Current

A Claude Code skill that maintains a ROADMAP.md with live priorities and a revision history, explaining changes as they happen rather than leaving the roadmap to go stale.

skillroadmapdocumentationproject-management
by code-katz Jul 29, 2026 6/10
skill GitHub

svelte-edge: Production-Safe Skill for Svelte 5 and SvelteKit 2

A future-first, production-safe skill for writing modern Svelte 5 and SvelteKit 2 code with AI agents, keeping generated code aligned with current Svelte idioms instead of outdated patterns baked into model training data.

skillsveltesveltekitfrontend
by fifidayone Jul 29, 2026 6/10
skill Reddit

How Much of a Skill Catalog Should an Agent See Before Loading It?

A concrete look at the SKILL.md lazy-loading problem in the open-source OpenHarness agent SDK: every skill's name and description sits in the tool schema on every turn, so a large skill catalog still adds real token overhead even though full skill content only loads on demand. The author is weighing search-based skill discovery over exposing the whole catalog once it grows past a handful of entries.

skillskill-loadingcontextopen-harness
by mgfeller Jul 29, 2026 6/10
skill GitHub

TLDR: Verdict-First Output for AI Coding Agents

A tiny prompt and installer that makes an agent lead with its verdict/conclusion before the reasoning, across Claude Code, Codex, Gemini, Cursor, opencode, and 30+ other agents.

skilloutput-formatconciseness
by 0p9b Jul 29, 2026 6/10
skill GitHub

slow-powers: Eval-Backed Agent Skills

Agent skills for Claude Code, Codex, and OpenCode that are validated with evals rather than shipped on vibes, for developers skeptical of unverified skill claims.

skillevalsverification
by slowdini Jul 29, 2026 6/10
skill GitHub

archivist: Canonical, Auto-Synced Claude Ecosystem Reference

A reference repo that auto-syncs Anthropic's official docs alongside curated team insights, paired with an ask-archivist skill for deterministic local lookup inside Claude Code instead of relying on model memory.

skilldocumentationreferencelookup
by coroboros Jul 29, 2026 7/10
skill GitHub

skillit: Generate SKILL.md From TypeScript API Docs

A TypeDoc plugin, CLI, and Docusaurus/VitePress integration that auto-generates SKILL.md files directly from a TypeScript library's API documentation, keeping agent-facing docs in sync with the actual API surface.

skilltypescripttypedocauto-generation
by pradeepmouli Jul 29, 2026 7/10
skill GitHub

Novera-AI-pipeline: four-agent Specifier→Coder→Refactorer→Architect pipeline

An agent skill that turns a vague requirement into gate-verified code using Gherkin acceptance specs and quality gates on coverage, complexity, duplication, and mutation score, with automatic failure routing between four specialized agent roles. Includes a zero-dependency Python scaffolder, MIT licensed.

multi-agentquality-gatesskillpython
by whaojie797-design Jul 28, 2026 7/10
skill GitHub

claude-smart: turns corrections into reusable preferences and skills

A tool that converts corrections you give an agent into persistent preferences, project-specific skills, and shared skills, working across Claude Code, Codex, and OpenCode. Aims to make an agent learn from feedback instead of repeating the same mistakes.

skillspreferenceslearning
by ReflexioAI Jul 28, 2026 6/10
skill GitHub

vibe-code-efficiency: skill for repo-aware, non-duplicating agent edits

An agent skill for Claude Code, Codex, Cursor, and Gemini/Antigravity that has the agent understand a repo before changing it, so it avoids duplicating schema or dependencies and keeps performance-consistent code. A reasonable pre-edit-discipline pattern, if somewhat generic.

skillcode-qualityrepo-analysis
by tissueeeee Jul 28, 2026 5/10
skill GitHub

lexigram-framework-skills: 14 skills for the Lexigram framework

A set of 14 AI agent skill files covering DI, async SQL, CQRS, caching, resilience, CLI code generation, and testing, targeted at the Lexigram framework but usable with any markdown-aware coding agent including Claude Code.

skillsframeworkbackend
by dbtinoy- Jul 28, 2026 5/10
skill GitHub

Idempotent Markdown Section Merge Skill for Agents

A Claude Code/Codex agent skill that replaces or appends a Markdown section idempotently without corrupting code fences, using fence-aware heading scans and fixed-marker boundaries. Includes a tested reference implementation and an apply-twice-diff-zero verification recipe.

skillmarkdownidempotencydocumentation
by h8nc4y Jul 28, 2026 7/10
skill GitHub

Paper Tutor: 25-Command Academic Research Skill Suite for Chinese Researchers

A Claude Code/Codex skill suite guiding Chinese graduate students and researchers through the full academic pipeline -- topic selection, literature search, writing, review, and submission -- across 25 commands. Citations are verified against real API responses rather than the model's memory.

skillacademic-researchcitation-verificationchinese
by cabbage2000-lab Jul 28, 2026 7/10
skill GitHub

Almagest Survey: Claude Skills for Automated Literature Surveys

A set of Claude skills that automate literature surveys by building verified source corpora, reporting honest metrics, using minimal figures, and producing a short PDF state-of-the-art report.

skillliterature-reviewresearchpdf-report
by DanieleMosh Jul 28, 2026 6/10
skill GitHub

OSS-Kit: Agent Skills for Open Source Maintainers

A curated set of agent skills aimed at open source project maintainers, though the repo description doesn't detail which specific maintainer tasks are covered.

skillopen-sourcemaintainers
by svyatov Jul 28, 2026 5/10
skill GitHub

SQL Server Performance Tuning Skills: 829 Checks Across 26 Skills

A large skill set for LLM-driven SQL Server performance tuning, covering T-SQL, execution plans, wait stats, deadlocks, Query Store, indexes, encryption, Always On AG, WSFC, error logs, memory, disk I/O, config drift, and migration readiness, backed by a remote MCP server on Cloudflare Workers.

skillmcpsql-serverperformance-tuning
by vanterx Jul 28, 2026 7/10
skill GitHub

AgentSkills: Large Community-Driven Library of SKILL.md Agent Skills

A community-maintained collection of Agent Skills (SKILL.md files with scripts, references, and examples) usable across Claude, Codex, Gemini CLI, Cursor, and similar tools, positioned as one of the largest such libraries.

skilllibrarycommunitymulti-tool
by JayRHa Jul 28, 2026 6/10
skill Reddit

Webcmd: turn any website into a CLI skill for Claude Code

Webcmd lets Claude explore a website once, then compiles the learned navigation into a named CLI command so future sessions get structured output instead of re-exploring the page. Installs as a Claude Code skill, supports named login profiles, and falls back through public endpoints, session cookies, and replayed requests before using a browser.

skillcliweb-scrapingautomation
by Opening-Profile6279 Jul 28, 2026 7/10
skill GitHub

hwpx: Claude Code skill for generating and editing Korean HWPX documents

An agent skill that reads, writes, and edits HWPX (.hwpx) files — the Hancom Office Hangul word processor format — and auto-converts Markdown, text, or URLs into HWPX documents. Fills a specific localization gap for Korean-language document workflows.

skillkoreandocument-generationhwpx
by imsebeom Jul 28, 2026 6/10
skill GitHub

Brand Agency Skill: full brand strategy engagements for AI agents

An Agent Skill for running large-scale brand strategy and identity work, structured as 10 evidence-backed research workstreams with iterative cross-team debate, producing 7 implementation-ready deliverables. Works across Claude Code, Codex, Cursor, and Copilot.

skillbrandingstrategyresearch
by simone-sestili Jul 28, 2026 6/10
skill GitHub

Prompt Engineering Skill: research-grounded prompt writing for LLMs

An Agent Skill that helps write prompts by matching techniques to the target model class and separating evidence-backed practices from folklore. Aimed at making prompt engineering more systematic rather than trial-and-error.

skillprompt-engineeringllm
by k-vaca Jul 28, 2026 5/10
skill GitHub

ux-motion-skills: production UX motion judgment skills for Claude Code

A set of Claude Code skills (motion-judgment, motion-guide, handoff, design-critique, ai-slop-detector, concept-gate) distilled from 11 years of production UX motion design work. Aims to give agents professional design judgment rather than generic 'make it nice' output.

skilldesignuxmotion
by kjooncho Jul 28, 2026 7/10
skill GitHub

flow-lean: a minimal, action-first output mode for Claude Code

A Claude Code output style that fuses caveman, ponytail, and 'i-have-adhd' modes into one rule set: minimal solution, action-first structure, zero-fat density. For users who want terser, less verbose agent responses.

output-styleverbositycommand
by FlorianBruniaux Jul 28, 2026 5/10
skill Reddit

Hierarchical Agent System: a Claude Code skill that designs its own agent teams

Given an objective, a central 'Designator' agent decides how many hierarchy levels a task needs, which specialist sub-agents to create, and which model tier each runs on, so cheap or local models handle most work and expensive models only make decisions that need to crystallize. A single mapping.json is the source of truth, read cheaply before each task so the design agent doesn't wake up unnecessarily.

skillmulti-agentcost-optimizationorchestration
by Aggravating_Bid1129 Jul 28, 2026 7/10
skill GitHub

seo-aeo-audit: evidence-first SEO and answer-engine audit skill

An audit skill covering ten tracks for both traditional search and AI answer engines, with every finding backed by an observation and every recommendation tiered into a prioritized change plan. Includes a dated Google update timeline, 59 growth plays, and 29 refuted SEO myths.

skillseoauditmarketing
by ssheleg Jul 28, 2026 6/10
skill GitHub

Interlinear: agent skill for reading technical papers with Chinese annotations

A Claude Code skill for reading technical papers that adds inline Chinese annotations, reader-adaptive explanations, and geometric intuition to help readers work through dense material. Niche but concrete use case for research reading workflows.

skillresearchtranslationpapers
by BladeDancer743 Jul 28, 2026 6/10
skill GitHub

manimgl-skill: Claude Code skill for 3Blue1Brown's original ManimGL

An agent skill specifically for ManimGL, the original 3Blue1Brown animation engine, as distinct from the more commonly supported Manim Community Edition. Fills a specific compatibility gap for people using the original library.

skillmanimanimationmath
by do-gongil Jul 28, 2026 6/10
skill GitHub

feynman-technique: an Agent Skill that explains like Richard Feynman

A Claude Code skill structuring explanations as mechanism-before-name with one honest analogy stating its limits, plus a difficulty ladder from kitchen-table to specialist level. Built from an ~88k-word corpus of primary-source material on Feynman's teaching style.

skillteachingexplanation
by guicortei Jul 28, 2026 7/10
skill GitHub

md-paper: Word-Markdown-Word revision workflow for academic manuscripts

A Claude Code skill workflow converting Word manuscripts to Markdown and back while preserving live Zotero citations and cross-references. Useful for academics editing papers with AI assistance without breaking their citation manager.

academic-writingzoteromarkdown
by pwya Jul 28, 2026 7/10
skill GitHub

sheleg-design-skill: cinematic scroll-driven landing page design skill

A stack-agnostic Claude Code skill teaching agents a cinematic, scroll-driven design methodology for landing pages and hero sections, plus style packs for product UI. Positioned as a 'taste layer' of design judgment rather than a component library.

skilllanding-pagesdesign
by ssheleg Jul 28, 2026 7/10
skill GitHub

liustack: a lighter Superpowers alternative — four skills, one loop

A compact Claude Code skill set positioned as a lighter alternative to Superpowers, built around four skills covering a full working loop: shape it, code it, dig it, snapshot it. Aimed at people wanting a simpler skill stack than larger frameworks.

skillworkflow
by liustack Jul 28, 2026 6/10
skill GitHub

vishwakarma: 21 Claude Code skills for design judgment and accessibility

A set of 21 skills covering design judgment, colour, motion, accessibility, layout, and theming for coding agents, compatible with Claude Code, Cursor, Windsurf, Cline, and more. Aimed at giving agents structured design taste rather than just component templates.

skilldesignaccessibility
by yogvidwankhede Jul 28, 2026 6/10
skill GitHub

claude-code-deep-review: 14-lens iterative code review methodology

A structured deep-review methodology for Claude Code that runs code through 14 distinct review lenses iteratively; the author reports it found 14 production bugs, including 2 ship-stoppers, on its first real use. Useful as a reusable review skill for catching issues a single-pass review misses.

code-reviewskillquality
by aksheyw Jul 28, 2026 8/10
skill GitHub

Axle Keys Skills: Design Manufacturable Hardware with Claude

Free, open Claude skills that teach an AI agent to design real, manufacturable things using Axle Keys' engineering conventions. Aimed at hardware/mechanical design workflows rather than pure software.

skillhardwaremanufacturingdesign
by AxleKeys Jul 28, 2026 5/10
skill GitHub

MailChannels Official Claude Code Plugin for Email Deliverability

Official MailChannels skills for Claude Code and Codex, giving agents direct access to MailChannels' email API/tools. Useful for teams already on MailChannels who want agent-driven email deliverability workflows.

pluginemailmailchannels
by mailchannels Jul 28, 2026 5/10
skill GitHub

dibble: Guardrails and Craft Checks for Coding Agents

A set of portable skills, Claude Code plugins, and zero-dependency CLI checks covering design tokens, supply-chain safety, evidence-backed writing, and UI verification for agent-tooling workflows. Aimed at teams wanting lightweight, dependency-free guardrails around agent output quality.

skillguardrailssupply-chainui-verification
by connordibble Jul 28, 2026 6/10
skill GitHub

HackerNews-Brief: Personalized Hacker News Digests Inside Claude Code

A zero-dependency tool that generates personalized Hacker News briefs inside Claude Code, learning your interests from what you click over time. A lightweight way to get a curated tech news feed without leaving your terminal.

skillnewspersonalization
by ArchitektApx Jul 28, 2026 6/10
skill GitHub

socialforge: Agency-Grade Social Media Production Plugin with AI Image/Video and C2PA Signing

An open-source social media production plugin with 16 skills and 25 commands covering AI image (Nano Banana Pro) and video (Kling v3.0 Pro) generation, plus C2PA content-provenance signing for EU AI Act Article 50 compliance. Installs across Claude Code, Codex, Cursor, Copilot CLI, and more.

skillsocial-mediacontent-generationcompliance
by indranilbanerjee Jul 28, 2026 6/10
skill GitHub

Praxis: 16-Skill Methodology Library for Disciplined AI-Driven Development

A Claude Code skill methodology library establishing rules for AI-driven development: seven-layer documentation governance, adversarial review, and a task-control triad, plus skills for legacy-code archaeology and construction blueprints. Aimed at keeping AI-written code fast without losing control.

skillgovernancecode-reviewdocumentation
by BackToCimaCoppi Jul 28, 2026 6/10
skill GitHub

god-of-the-void: A Claude Code Skill with Persistent Memory, Semantic Search, and a Local Dashboard

A heavily built-out Claude Code skill offering persistent cross-session memory, near-zero-token semantic search, an 'errarium' that flags repeated mistakes before you make them again, caged autonomy controls, and a local dashboard — organized into 16 'organs' and 54 commands, with 1,650 tests and zero dependencies.

skillmemorysemantic-searchdashboard
by CHAOSX-SPACE Jul 28, 2026 6/10
skill Reddit

itr-wala: Claude Code Skill That Prepares Indian Tax Returns with Deterministic Python Math

A free, MIT-licensed Claude Code skill for filing Indian income tax returns (AY 2026-27): Claude reads your Form 16/AIS/broker statements and interviews you for deductions, but every calculation — both tax regimes, capital gains, surcharge marginal relief, interest, and loss set-off — runs in tested, deterministic stdlib Python rather than the model. Backed by 47 golden tests and a 350,000-run property fuzzer that caught real rounding and marginal-relief bugs before release, and it explicitly refuses cases outside its scope (NRI, F&O, audits) and never touches your portal password or submit button.

skilltaxindiadeterministic-computation
by karanb192 Jul 28, 2026 8/10
skill Reddit

Auto Memory System: A Scheduled Task That Teaches Claude Code to Remember Things on Its Own

A Windows scheduled task that runs Claude Code every morning to scan the prior day's session files and write anything worth keeping into a persistent memory directory, with no manual 'remember this' prompts required. Guardrails prevent emotional content, fabrications, and deletions; five days of real use produced six new memories with zero duplicates.

skillmemoryautomationscheduled-task
by ZingLam0924 Jul 28, 2026 6/10
skill GitHub

vibe-ship: Turn Any Codebase into a Hardened, Deployable App in One Pass

A Claude Code / Claude.ai skill that makes any codebase deployable via `docker compose up` and shippable through CI/CD, generating hardened defaults in a single pass. Aimed at closing the gap between 'it runs locally' and 'it's actually deployable.'

skilldeploymentdockerci-cd
by sudais-khalid Jul 28, 2026 6/10
skill GitHub

van-rental-search: Claude Code Skill for Vancouver Rental Search

A Claude Code skill that searches vanpeople and vansky rental platforms for Vancouver listings, filtering by city, bedrooms, price, and facilities. It deduplicates results, classifies units as above-ground, and exports contact lists as Markdown or HTML. A concrete example of building a domain-specific search skill with structured output.

skillsearchreal-estatevancouvermarkdownhtml
by gaoxiaowei2117 Jul 27, 2026 5/10
skill GitHub

skill-adherencia-reglas: Measure Claude Code Agent Rule Compliance

An installable Claude Code skill that reads session history from disk and computes a compliance percentage per configured rule — no network, no dependencies beyond the standard library. Helps you quantify how reliably your Claude Code agent follows the rules defined in CLAUDE.md or other instruction files. Useful for debugging agent drift in long sessions.

skillcompliancerulesCLAUDE.mdsession-analysisaudit
by jleonceo Jul 27, 2026 8/10
skill GitHub

awwwards-skill: Claude Code Skill Encoding the Awwwards Design Rubric

A Claude Code skill that encodes the Awwwards judging rubric (Design 40 / Usability 30 / Creativity 20 / Content 10) as an 8-phase build method with 16 curated references, working templates, and a runnable real-browser audit step. Designed to systematically raise the quality bar of AI-generated web UIs against a professional design scoring system.

designuiwebskillauditawwwards
by SandroHub013 Jul 27, 2026 7/10
skill GitHub

PRD-First Multi-Model Agent Skills for Claude, Gemini, and Codex

A portable set of agent skills that start from a Product Requirements Document and propagate architecture and design-system context throughout the development process. Works across Claude, Gemini, and OpenAI Codex with verified multi-model development support.

skillsprdmulti-modelarchitecturedesign-system
by Cartograf666 Jul 27, 2026 6/10
skill GitHub

46 Tested DevOps, Security, and Engineering Skills for Claude Code

A large, maintained collection of 46 Claude Code skills covering DevOps, security, infrastructure, and software engineering. Skills are quality-controlled through lint/spec checks, behavioral test coverage, and a Karpathy-style autoresearch loop — one of the most systematically tested skill packs available.

skillsdevopssecurityinfrastructuretesting
by iuliandita Jul 27, 2026 7/10
skill GitHub

29 Drop-In Claude Code Skills: Model Routing, Debugging, and Laws of Software

A curated set of 29 skills covering cost-tier model routing, debugging patterns (rubber-duck, test-first bugfix, trust-but-verify), and 24 software-law reference skills. Installs with a single npx command. Practical and opinionated about when to use each model tier.

skillsmodel-routingdebuggingsoftware-lawsnpx
by The-Artificer-of-Ciphers-LLC Jul 27, 2026 7/10
skill GitHub

Bangers: Nine Skills for Cross-Platform Social Media Content Creation

A social media content studio built on the playbooks of popular creator-educators like Matt Pocock, Theo, and ThePrimeagen. Nine skills turn a single idea into platform-specific content across multiple channels. Opinionated about voice and format.

skillssocial-mediacontenttwittercreators
by Jeff-Kazzee Jul 27, 2026 6/10
skill GitHub

bs-check: Two-Lane Confidence Audit Skill for Claude Code

A skill that runs two parallel verification lanes: a reasoning audit (checking premise, approach, and fresh thinking) and a claim-verification pipeline that passes or blocks each assertion through context-isolated judges. Designed to catch overconfident or unsupported claims before they reach your codebase.

skillsverificationconfidenceauditclaims
by GemSpecter Jul 27, 2026 7/10
skill GitHub

Multi-Agent System Architect: Design, Build, Audit, and Port Agent Systems

An agent skill that first questions whether an agentic system is needed at all, then walks through design, construction, auditing, verification, and porting across frameworks. Covers the full lifecycle from simple workflows to governed agent teams, with sanity checks at each stage.

skillsmulti-agentarchitectureauditagent-design
by ingcontartese-netizen Jul 27, 2026 7/10
skill GitHub

Autonomy: Issue-to-Clean-PR Skill with Self-Review and CI Monitoring Loop

A Claude Code skill that takes a GitHub issue and drives it all the way to a clean pull request: plan, validate, implement, self-review, ship, then monitor CI and review feedback and iterate until the PR passes. Designed to operate unattended while maintaining a high quality bar.

skillsgithubprciautonomousissue-driven
by jakozloski Jul 27, 2026 8/10
skill GitHub

Resume Skills: Offline Context Migration Across 9 Agent Sources and 9 Hosts

Skills for migrating session context between 9 different coding-agent sources (Claude Code, Codex, Cursor, etc.) and 9 target host environments — 81 source/dest combinations in total. Uses only stdlib, no dependencies. Generates a static context handoff artifact for the next session rather than a live restore.

skillscontextmigrationsessionmulti-agent
by ImL1s Jul 27, 2026 6/10
skill GitHub

7 UX and Product Design Skills for Claude Code

A set of 7 skills covering UX research, product design, and user experience work in Claude Code sessions. Provides structured approaches to design tasks that would otherwise require custom prompting each time.

skillsuxproduct-designuiresearch
by JoaoMonteiro100 Jul 27, 2026 6/10
skill GitHub

Open Skills: Readable Agent Skills with Declarative YON Protocol Validation

A personal, field-tested skill pack prioritizing human readability. Skills optionally include declarative YON (yes/or/no) protocol specifications that can be inspected and validated independently. Prioritizes transparency and auditability over magic.

skillsreadablevalidationprotocolopen-source
by allemaar Jul 27, 2026 6/10
skill GitHub

Twitr Skills: Pay-Per-Call X/Twitter API for AI Agents via USDC Wallet

Agent skills for twitr.sh, a pay-per-call X/Twitter API service for AI agents. No developer API key required — a USDC wallet pays per call. Enables Claude Code agents to query Twitter data on a usage basis without a developer account.

skillstwitterxapicryptousdc
by lnvestor Jul 27, 2026 5/10
skill GitHub

Headless GTM: Full Outbound Sales Chain as Claude Code and Codex Skills

A set of skills implementing the complete go-to-market outbound pipeline — discover, qualify, extract, signal, judge, resolve — directly on raw vendor APIs with no SaaS layer. Designed for teams that want full control over their prospecting stack without paying for middleware.

skillsgtmsalesoutboundcrmb2b
by Zevenue Jul 27, 2026 5/10
skill GitHub

Research Agent Pitfalls: Standing Rules to Keep AI Research Agents Honest

A Claude Code skill that installs standing rules guarding against common AI research agent failure modes: reward hacking, fabricating results after failed runs, data leakage, undertuned baselines, single-seed claims, LLM-judge bias, and premature completion. Applies to Claude Code, Codex, and Cursor.

skillsresearchintegritysafetyanti-hallucinationscience
by jackiectl Jul 27, 2026 7/10
skill GitHub

open-claude-all: Claude Code Skills and Hooks for Clean PRs and Impact Pre-Verification

Claude Code skills and hooks focused on shipping clean PRs and pre-verifying the impact of changes on existing code. Covers PR quality gates, Kotlin/JVM Spring, React/Next.js, and NestJS stacks. Useful for multi-stack teams who want consistent PR quality across different tech stacks.

skillshooksPRscode-reviewmulti-stack
by BK202503 Jul 27, 2026 7/10
skill GitHub

DeepPaperNote: Agent Skill for Deep-Reading Papers and Generating Obsidian Research Notes

An agent skill that deep-reads a single research paper and generates high-quality Obsidian-style research notes from it. Works with Claude Code, Codex, Cursor, Copilot, and Gemini CLI. Useful for researchers and academics who want structured, reusable notes from paper reading sessions.

researchObsidiannotesacademicskill
by 917Dhj Jul 27, 2026 6/10
skill GitHub

stylewright: Anti-Slop Writing Skills for Claude Code and Codex

Writing skills for Claude Code, Claude Cowork, and Codex grounded in real style standards rather than generic LLM defaults. Designed to produce technical writing that reads as deliberate and human rather than AI-generated. Install as any standard agent skill.

writingstyleskillsqualityanti-slop
by rookslog Jul 27, 2026 6/10
skill GitHub

Generative-Media-Skills: Multi-Modal Image, Video, and Audio Generation for Claude Code

A multi-modal generative media skill pack for Claude Code, Cursor, and Gemini CLI that enables high-quality image, video, and audio generation from within coding agent sessions. Useful for building media-rich applications or generating assets during development.

image-generationvideoaudiomulti-modalskills
by SamurAIGPT Jul 27, 2026 6/10
skill GitHub

lit-review-agent-tools: 70+ Open-Source Tools for AI-Assisted Literature Review

A curated catalog of 70+ open-source AI agent tools for academic literature review, organized across 11 categories including Claude Code skills, deep research, MCP servers, PDF parsing, and systematic review. A comprehensive starting point for researchers using AI coding tools for literature work.

academicliterature-reviewMCPresearchskills
by brycewang-stanford Jul 27, 2026 6/10
skill GitHub

book-writing-skill: Claude Code Skill That Turns a Drafts Folder Into a Produced Book

A Claude Code skill that takes a folder of draft content and produces a complete book: structural blueprint, hand-paginated chapters, and a verified PDF. Automates the book production pipeline from rough drafts to finished output without a dedicated publishing workflow tool.

writingbookPDFpublishingskill
by swiftugandan Jul 27, 2026 6/10
skill GitHub

marketing-skills: 100 Open-Source Claude Code Skills for SEO, Content, and GEO

A collection of 100 markdown skill files across 9 categories covering SEO, content creation, and Generative Engine Optimization (GEO) for Claude Code, Cursor, and compatible tools. GEO focuses on optimizing content for AI-generated search responses rather than traditional search engines.

marketingSEOGEOcontentskills
by dahiyaakshay Jul 27, 2026 6/10
skill GitHub

engineering-diagram-toolkit: AI-Powered Architecture Diagrams for Claude Code and Codex

A skill that generates evidence-grounded software architecture diagrams from actual codebases using Claude Code and Codex. Covers features, data flows, patterns, system design, and engineering decisions. Diagrams are grounded in real code rather than hallucinated from documentation.

architecturediagramsdocumentationskillCodex
by amirtaherkhani Jul 27, 2026 6/10
skill GitHub

docforge: Claude Code Skill to Generate Documentation From Source Code

A simple Claude Code skill that reads your source code and generates structured documentation from it. Install as a plugin and invoke to produce documentation for your codebase. Straightforward automation for the documentation task most developers put off.

documentationskillautomationcode-docs
by jonaskahn Jul 27, 2026 6/10
skill GitHub

design-lagann: Design Agent Skill for Claude Code, Codex, and Cursor

A design agent skill that plans first, finds visual references, builds intentional interfaces with considered motion design, and proves the result. Targets the gap in AI coding tools where generated UIs work functionally but lack deliberate design decisions.

designUIskillmotioninterfaces
by Oldiiik Jul 27, 2026 6/10
skill GitHub

claude-code-optimizer: Skills, Rules, Hooks, and Templates to Cut Token Use

A curated collection of skills, rules, hooks, and templates specifically designed to reduce token consumption and accelerate shipping with Claude Code. Bundles optimization techniques from the community into an installable package targeting developers who want faster and cheaper Claude Code sessions.

tokensoptimizationskillshookstemplates
by pupillary-rosewater603 Jul 27, 2026 7/10
skill GitHub

sitesmith: Coding Agent Skill for Building Non-Generic-Looking Websites

A skill that routes website-building tasks through a mode-specific workflow, enforces a 12-step build loop, and actually renders and measures the result instead of stopping at the code. Designed to prevent the generic AI-generated website look by embedding quality gates into the build process.

webdesignskillsworkflowquality
by byensitmagnus Jul 27, 2026 7/10
skill GitHub

claude-saas-readiness: Agent Skill for Auditing SaaS Production Readiness

A Claude Code skill that audits any SaaS application for production readiness across security, scalability, reliability, testing, observability, and compliance. Reports findings first and only proposes fixes after you approve, with no scripts that execute automatically. Works with any tech stack.

SaaSauditsecurityreliabilityskill
by smiladinov Jul 27, 2026 7/10
skill GitHub

claude-academic-workflow: 14 Claude Code Skills for Academic Research Workflows

A suite of 14 Claude Code skills covering academic research tasks: paper reading, literature review, bibliography auditing, preregistration, referee reports, replication packages, LaTeX, and TikZ generation. Also includes a Quarto reveal.js slide system with render-time quality gates. Built as a proof-of-concept with Claude Code itself.

academicresearchLaTeXliterature-reviewskills
by ericluo04 Jul 27, 2026 7/10
skill GitHub

agent-skills: Dev Cycle Skills Covering Ticket Intake, ATDD, Code Review, and PRs

A skill pack that wraps the full development cycle for Claude Code: ticket intake, acceptance-test-driven development planning, code review, doc-drift audits, PR writing, and changelog generation. Designed to bring structure to agentic development from spec to shipped PR.

skillsATDDcode-reviewPRsdev-cycle
by Flagrare Jul 27, 2026 7/10
skill GitHub

ui-craft: Design Engineering System for AI Coding Agents to Ship Craft-Level UI

An agent skill that brings design engineering principles to AI coding agents for building high-quality UI. Enforces visual hierarchy, interaction design, and accessibility standards through the skill workflow. Targets the gap between functional and polished UI in AI-generated code.

UIdesigncraftskillfrontend
by educlopez Jul 27, 2026 7/10
skill GitHub

claude-ship-skills: Shipping Skills for Claude Code with PR Fan-out and Pre-ship Critic

A Claude Code skill pack covering single PRs, parallel PR fan-out, multi-phase epics, and a ruthless pre-ship critic. One session chairs the entire release so context never splits across agents. Ideal for teams shipping iterative features with AI-powered review gates.

shippingPRsfan-outskillsworkflow
by davidtheproduct Jul 27, 2026 8/10
skill GitHub

swarm-skill: Autonomous Multi-Agent Orchestrator for Claude Code

Fans out sub-agents to explore, diagnose, fix, review, and verify a codebase in parallel. Uses a cross-checked, ledger-backed approach and keeps iterating until the code is production-ready. A skill-based drop-in for Claude Code projects needing thorough automated remediation.

multi-agentorchestrationskillautomationcode-review
by SaarthurR Jul 27, 2026 8/10
skill GitHub

Claude Code Skill for Hardening Formally Verified Code Over FFI

Provides a Claude Code skill and worked Rocq→Rust→Python example for hardening formally verified code extracted to native libraries: proved input domains, checked-arithmetic builds, panic containment, and differential tests. Targets teams using formal methods who need to verify safety across the FFI boundary.

formal-verificationffirustsafetyskill
by cosmindxu Jul 27, 2026 6/10
skill GitHub

engineer-writing: Claude Code Skills for Engineers Who Write

Opinionated skills that force you to give Claude your actual voice and the real work behind a piece of writing, rather than a generic prompt. Intended for engineers publishing blog posts, documentation, or technical essays who want output that sounds like them.

writingskilldocumentationvoicecontent
by foxontheerun Jul 27, 2026 6/10
skill GitHub

Skills-Atlas: Searchable Catalog and Auto-Curator of AI Agent Skills

Indexes and auto-curates skills for Claude Code and Codex so you can search rather than browse scattered repos. Helps teams discover relevant community skills before writing new ones from scratch.

skillcatalogdiscoverycodexcommunity
by Zita-Go Jul 27, 2026 6/10
skill GitHub

dewey-decimal-skill: Rename and Reorganize EPUB Libraries by Dewey Decimal

Claude Code skill that classifies and renames EPUB ebooks using Dewey Decimal numbers, reorganizing a messy library into a consistent structure. A practical single-purpose skill for researchers or heavy readers with large ebook collections.

skillepublibraryorganizationbooks
by brege Jul 27, 2026 5/10
skill GitHub

ai-central: Central Library of Steering Files, Skills, and Scaffold Scripts

Provides a curated, reusable set of AGENTS steering files, Claude Code skills, and project scaffold scripts so teams can configure AI coding context consistently across projects. Includes guided setup for both new and existing codebases.

skillagentsscaffoldconfigurationcontext
by dills122 Jul 27, 2026 7/10
skill GitHub

loadout: Manage Claude and Codex Skills From a Git Repo You Own

Lets you store and version your Claude Code and Codex skills in a personal git repo, then load them into any project. Keeps skills portable, reproducible, and under your own version control rather than scattered across machines.

skillgitversion-controlcodexmanagement
by sethdeckard Jul 27, 2026 7/10
skill GitHub

compass-core: Reusable Governance Engine for Claude Code — SOPs, Validators, Subagent

compass-core is a drop-in governance layer for Claude Code projects with standard operating procedures, input validators, and a governance skill backed by a dedicated subagent. Designed to be shared across projects so teams enforce consistent behavioral guardrails.

skillgovernancesopsvalidationsubagent
by the-metafactory Jul 26, 2026 7/10
skill GitHub

laravel-ai-sdk-toolbox: Claude-Compatible Skills and CLI Tools for Laravel AI Agents

Extends the Laravel AI SDK with Claude Code-style skills, CLI tools, and knowledge bases for agent-powered Laravel apps. Adds a security-first trust model and an opt-in HTTP management layer. Useful for teams building Claude-powered backends in the PHP/Laravel ecosystem.

skilllaravelphpagentsecurity
by andreagroferreira Jul 26, 2026 6/10
skill GitHub

vibe-rules: Context-Aware AI Coding Standards That Load Only When Relevant Files Are Open

vibe-rules delivers coding standards to AI agents only when a matching file is open, keeping the context window small. Hooks block unsafe patterns that tests cannot catch. Ships 20 modules covering PHP, JS, Python, SQL, and ops — built to reduce the risk in AI-generated code.

skillstandardsruleshookscontext
by DanielLetto2020 Jul 26, 2026 8/10
skill Reddit

Community Advice: What Actually Works in CLAUDE.md Instead of "Make No Mistakes"

Reddit discussion asking what practitioners actually put in their skills and CLAUDE.md to prevent bugs and poor decisions. Responses surface real-world configurations, mental models, and specific instructions that have worked. Useful for anyone looking to improve their system prompt or skill configuration beyond generic platitudes.

claude.mdskillprompt-engineeringcommunity
by bluespiritgg Jul 26, 2026 6/10
skill Reddit

Skills vs MCP Servers vs Plugins: The One Test That Clarifies Every Case

Detailed Reddit guide that explains the practical distinction between Claude Code skills, MCP servers, and plugins with one decisive test: if Claude already has access but does the job wrong, use a skill; if it genuinely cannot reach the system, use MCP; if you want distribution, use a plugin. Includes a real example of a wasted weekend building an MCP that should have been a SKILL.md, plus the real context-cost of over-connecting servers.

skillmcppluginarchitecturebest-practicesdecision-framework
by Bulky_Ad738 Jul 26, 2026 8/10
skill GitHub

Uscha: 9 Agent Skills and Evidence Engine for Spec-Driven LLM Development

Provides 9 agent skills and a stdlib evidence engine that distinguishes facts from guesses. Known facts block progress until resolved; guesses surface as advisory notes; humans approve before proceeding. Adds a structured, evidence-backed workflow layer to LLM coding agents targeting overconfident output.

spec-drivenevidenceskillverificationguardrails
by andresmassello Jul 26, 2026 7/10
skill GitHub

Agent Handoff Docs: Multi-Session Documentation Framework for Claude Code and Codex

Documentation framework with split REQUIREMENTS, ARCHITECTURE, REPORT, and HANDOFF files plus START_HERE kickoff files for multi-session, multi-agent development. Task ledgers double as delegation specs so an incoming agent knows exactly what to pick up. Includes bilingual (EN/JA) templates.

handoffmulti-sessiondocumentationmulti-agentskillbilingual
by h8nc4y Jul 26, 2026 7/10
skill GitHub

Wireframe Skills: Complete Wireframing Discipline as 7 Agent Skills

Distills the wireframing methodology from Wireframing for Everyone (A Book Apart) into 7 agent reference skills plus a /wireframe dispatcher for Claude Code. Covers the full workflow from concept to handoff as Claude Code slash commands. Useful for product teams using Claude Code for design documentation and UX planning.

wireframingdesignskilluxdocumentationproduct
by jpoindexter Jul 26, 2026 6/10
skill GitHub

Agent Skill Bootstrap: Auto-Detects Project Stack and Installs Only Relevant Skills

Detects the project tech stack and installs only the agent skills that Claude Code, Codex, and Grok actually need for that specific stack. Avoids bloating context with irrelevant skills and provides a clean, targeted skill set from project start. Good for onboarding Claude Code into existing projects.

skillbootstrapproject-setupstack-detectioninstallationonboarding
by lucascharao Jul 26, 2026 7/10
skill GitHub

Agent-DB: Intraagent Instruction, Skill, and Config Manager for Claude and Codex

Manages agent instructions, skills, and configurations across Claude and Codex sessions from a single interface. Provides structured storage and retrieval of agent-specific knowledge within a session. Useful for teams maintaining consistent skill sets and configurations across multiple AI coding agents.

skillconfigagentmanagercodexmulti-agent
by brege Jul 26, 2026 7/10
skill Reddit

claude-nextsession: Schedule Claude tasks to run after session limit resets

A Claude Code skill that defers tasks and automatically launches them when the 5-hour usage window resets. Supports scoped permissions, generates catch-up reports, and handles the common problem of being interrupted mid-task by session limits.

skillsessionschedulinglimits
by pcx_wave Jul 26, 2026 7/10
skill Reddit

Humanizer: Agent skill that removes AI prose patterns at the structural level

A Claude Code skill that edits AI-generated prose by targeting structural patterns — repeated list formats, punctuation pivots, vague attribution, and predictable conclusions — not just swapping out buzzwords. Includes separate German and English editing rules and preserves numbers and uncertainty. MIT-licensed.

skillwritingprosehumanizerediting
by Quick_Cartoonist_441 Jul 26, 2026 7/10
skill Reddit

GrugDone: Agent skill for keeping Claude reasoning traces compact

A small open-source Agent Skill for Claude Code that prompts the model to keep exposed reasoning traces compact — targeting reasoning narration, obvious decision announcements, and prompt repetition. A preliminary run showed 32% fewer reasoning words, though broader quality impact is still being evaluated by the community.

skillreasoningtoken-efficiencycompact
by FlatCarrot3943 Jul 26, 2026 6/10
skill Reddit

Claude Code optimization: CLAUDE.md, permissions, and stateless sessions explained

A practitioner shares key mental models for optimizing Claude Code — understanding the model/hands split, stateless sessions requiring fresh context each turn, and CLAUDE.md as the highest-leverage configuration file. Covers using allow/deny permission lists to reduce babysitting and why session hygiene matters.

CLAUDE.mdpermissionssessionsconfiguration
by Talley-Ho Jul 26, 2026 7/10
skill Reddit

/einstein: Force Claude to prove code understanding before acting

A Claude Code skill that requires the agent to explain code in numbered steps (one structural fact per step, dependency order, no jargon, source anchor for every claim) before planning or implementing anything. Prevents vague "trust me" explanations and catches fake understanding hidden behind jargon.

skillunderstandingverificationcode-review
by NotEvenSweaty Jul 26, 2026 8/10
skill GitHub

Arabic skills atlas for Claude Code

An Arabic-language skills atlas providing Claude Code skills and documentation for Arabic-speaking developers.

arabicskillsatlaslocalization
by unknown Jul 26, 2026 5/10
skill Reddit

Skills that make Opus 5 more reliable

After my previous post about my first impressions with Opus 5 I tried to improve it's reliability. These skills and Claude.md changes seem to be working for me and I hope they might prove useful fo...

skillclaude.md
by ShaneeNishry Jul 25, 2026 8/10
skill Reddit

How can I get Claude to stop spamming?

Hey, long time listener first time caller. I'm running into a problem that I know we've all faced but it's getting much worse, Claude instances are using chat as a scratch pad for every random thin...

skillworkflow
by SnooblesIRL Jul 25, 2026 6/10
skill GitHub

true-skills:

true-skills:

skill
by katalon-labs Jul 24, 2026 5/10
skill Reddit

When are we banning the “[model] feels nerfed” posts

I see one of these posts on my feed literally every day. 1) they’re probably bots 2) if they’re not bots then it’s a skill issue submitted by /u/LivingFrosting6680 [link] [comments]

skill
by LivingFrosting6680 Jul 24, 2026 5/10
skill Reddit

Prompt engineering was the beginning.

AI engineering is moving toward loops, graphs, harnesses, skills, memory, and agent fleets. I wrote a practical breakdown of how these layers combine—and when each one earns its complexity. https:/...

skill
by ivasuy Jul 24, 2026 6/10
skill Reddit

Self improvement loops

Hey guys wanted to check if self improvement loops for your setup skills, agents, project instructions actually work? I have a feeling this is a risk for garbage piling up - the How does one do it ...

skill
by Safe-Analysis-5804 Jul 24, 2026 7/10
skill GitHub

neo-skills: Neo Skills 是專為現代 AI Agent 設計的全方位能力擴充套件。本專案透過標準化的通訊架構,為 AI 代理安裝可插拔的「技

Neo Skills 是專為現代 AI Agent 設計的全方位能力擴充套件。本專案透過標準化的通訊架構,為 AI 代理安裝可插拔的「技能模組 (Skills)」,使其不僅僅是一個聊天機器人,而是能轉化為具備「感知-推理-行動」能力的多領域專家。

skill
by Benknightdark Jul 24, 2026 6/10
skill Reddit

New to Claude from Codex, have a question

Why can’t I use auto mode on haiku? Back when I was on codex I would use 5.5 for most coding work but any smaller skill based workflows like small sql requests or writing Jira cards I would use 5.4...

skillworkflowtestingreview
by YaBoiLeeDawg Jul 24, 2026 8/10
skill GitHub

skill-compress:

skill-compress:

skill
by xiaowu89 Jul 24, 2026 5/10
skill GitHub

skill-function:

skill-function:

skill
by xiaowu89 Jul 24, 2026 5/10
skill Reddit

I built a Skill Market for claude skills

Skills are all over the place so I built a repository where you can host skills, curate skills, share. It even comes with a cli for your agent to use. Hopefully it will self rank so best ones raise...

skilltesting
by Negative_Leave5161 Jul 24, 2026 7/10
skill Reddit

Do you suggest any good skill for game design /unity?

Hi, What's the best skill for Claude code with Unity? I've checked a few skills on skills.sh and they're basically wrappers for "use best practices, you're a skilled programmer". I'm looking for ma...

skill
by game-dev2 Jul 24, 2026 8/10
skill Reddit

Improving skills and plugins

I've build a series of different skills, and after the first iteration I'm trying to think of ways I can improve. One obvious way is to improve how long the skill file is because I don't want it ho...

skillapi
by StrikingSkill573 Jul 23, 2026 5/10
skill Reddit

Endless review cycles

I implement a feature and review (skill or plugin) a several times my code. It finds a lot of issues again and again and it just gets more code. I finally push to gitlab merge request and the revie...

skillgitreview
by Strawberry7352 Jul 23, 2026 5/10
skill Reddit

Beginner here on Claude Code

Hey. I'm new to Claude Code, coming from Antigravity and Gemini models. Is there any advice, tips, or skills I should know about to ensure good rate limits, and overall experience? I'm a beginner, ...

skill
by Primatronus Jul 23, 2026 8/10
skill Reddit

Thoughts on Kimi K3?

I have recently been burning through my Max 5x plan in about 3 days, even when using skills that delegate tasks to Sonnet and Opus, the plan just doesn't seem to go very far anymore. I was consider...

skill
by Spooknik Jul 23, 2026 5/10
skill Reddit

Codex Computer Use Skill

submitted by /u/lyndon050516 [link] [comments]

skill
by lyndon050516 Jul 23, 2026 5/10
skill Reddit

Superpower takes too long and consumes too much token

I've been using the superpowers skills for writing the specs, plan and executing it via subagent-driven-development. However, the execution time takes about 1 hour. Life seems Life seems much simpl...

skill
by Jealous-Mammoth-5526 Jul 23, 2026 6/10
skill Reddit

How to understand existing codebase?

How do you approach understanding new codebases? If you are new to a codebase and you want to understand it better based on existing components, services, controllers and repos (also maybe git log?...

skillgit
by devmaterialized Jul 23, 2026 8/10
skill Reddit

Fable Credits Burn Speed Question: Serious

Please respond with objective experience, I'm not looking to fuel judgement. Setting aside "skill issue" entirely as a variable, is it possible the complaints about Fable allotment being used up in...

skill
by KSSLR Jul 23, 2026 8/10
skill Reddit

Someone please unplug Anthropic’s keyboards for 5 minutes

i haven't even finished testing one feature and they’ve already dropped four more. managed agents, ios simulator, screen recording agent skills, security scanner... slow down guys i'm not an ai (ye...

skilltesting
by Several-Lemon-3381 Jul 23, 2026 7/10
skill GitHub

pdlc-skills: 36 Slash Commands Turning Claude Code Into a Full PDLC Workflow

A comprehensive set of 36 slash commands that enforce a structured Product Development Lifecycle in Claude Code — PRD → TDD → implement → review → ship. Hard contracts force the AI to persist artifacts, write failing tests first, and run self-checks before claiming completion.

slash-commandstddworkflowpdlcquality-gateslifecycle
by kanfu-panda Jul 22, 2026 9/10
skill GitHub

claude-club-motion-library-skill: 547 Animated UI Recipes as a Claude Skill

A comprehensive skill containing 547 animated website sections, app templates, backgrounds, gradients, and design-system recipes accessible through Claude Code. Provides production-quality animation patterns via natural language prompting.

animationuidesignskillcomponentstemplates
by Samin12 Jul 22, 2026 6/10
skill Reddit

multi-agent-chatter: Coordinate Multiple Claude Code Tabs Without Manual Relay

A Claude Code skill that assigns one tab as the PM owning the project roadmap while worker tabs handle specialized tasks in parallel. Tabs communicate through a shared internal board, eliminating manual copying of updates between sessions. Works best with 4-5 worker tabs on a single repository.

multi-agentcoordinationpmshared-boardparalleltabs
by The___Storyteller Jul 22, 2026 7/10
skill GitHub

frontend-scaffolding: Skill for Project Structure Before AI Implements Any Pages

A Claude Code skill that enforces setting up a proper frontend project structure before implementing any individual pages. Prevents the common anti-pattern where AI generates pages ad-hoc, leading to growing inconsistency and complexity in frontend codebases.

frontendscaffoldingskillstructurearchitecture
by Byron569 Jul 22, 2026 6/10
skill GitHub

TOP-SKILLS: Largest Claude Code Skill Hub — 3900+ Skills from 12+ Sources

The largest known aggregation of Claude Code skills, collecting over 3,900 skills from 12+ sources with an online search interface and trend analysis dashboard. A one-stop reference for discovering and evaluating community-contributed Claude Code skills.

skillsaggregationsearchcommunityindexdashboard
by bg-szy Jul 22, 2026 9/10
skill GitHub

Custom Skills for Academic Writing, Automation, and Specialized Workflows

A collection of custom Claude Code skills targeting academic writing workflows, task automation, and specialized use cases beyond standard coding assistance. Covers domain-specific tasks that fill gaps in the standard Claude Code skill set.

skillsacademic-writingautomationworkflowsspecialized
by xjsongphy Jul 22, 2026 5/10
skill GitHub

onboard: Claude Code Skill That Catches Your README Lying

A Claude Code skill that follows README setup documentation literally in a clean environment, reporting every setup step that is wrong, missing, or silently assumed. Turns README validation from a manual chore into an automated, reproducible test.

readmedocumentationtestingonboardingvalidationskill
by tokyubevoxelverse Jul 22, 2026 8/10
skill GitHub

necromancer: Claude Code Skill That Resurrects Dead Repos

A Claude Code skill that takes broken repositories that no longer build and fixes the dependencies, patches breaking changes, and brings them back to life. Automates the tedious work of modernizing stale or abandoned codebases.

dependencieslegacyrepairmodernizationskilldead-repos
by tokyubevoxelverse Jul 22, 2026 8/10
skill GitHub

bowtie-funnel-resources: Reusable Skills for Organizing AI Agent Folders

A set of reusable skills for AI coding agents focused on organizing the agent folder into a clean, filesystem-first layout. Provides structural conventions for managing skills, memory, and configuration across multiple projects.

skillsorganizationfilesystemstructureconventions
by bowtiefunnel Jul 22, 2026 5/10
skill GitHub

Niche-Claude-Code: Battle-Tested Skills for Claude Code and Cowork

A collection of battle-tested skills for Claude Code and Cowork that claims to double usage at the same quality level. Targets power users looking to maximize throughput from their AI coding sessions.

skillscoworkproductivity
by M4NUSH7 Jul 22, 2026 5/10
skill Reddit

Claude Code Skill: Fetch Real SVG Icons from Iconify Instead of Hand-Drawing

A Claude Code skill that prevents the AI from generating SVG icons from scratch. Instead, it pulls production-quality icons from the Iconify library, improving output quality and eliminating token waste on iterative icon attempts.

svgiconsiconifyskillui
by Dependent-Cake-8034 Jul 22, 2026 7/10
skill Reddit

Skills for Visual PRs, Specs, and Repo Documentation with Staleness Checks

A set of Claude Code skills that make pull requests and repository documentation more visual and informative. Includes staleness checks to automatically flag outdated docs and specs so project documentation stays current as code evolves.

documentationpull-requestsspecsstalenessvisual
by scottyroges Jul 22, 2026 6/10
skill GitHub

JD.SemanticKernel.Extensions: Claude Code Skills with Semantic Memory

Semantic Kernel extensions for Claude Code that add skills, hooks, context compaction, and semantic memory. Allows Claude Code agents to store and retrieve semantically relevant context across sessions using vector memory. Useful for long-running projects where persistent knowledge is important.

semantic-kernelmemorycontextskills
by JerrettDavis Jul 21, 2026 7/10
skill GitHub

Lamina: Headless Product Design Skill for AI Coding Agents

A headless product design skill for AI coding agents that separates the design phase from implementation. It helps agents reason about how a feature should work before writing any code, then verifies that what ships matches the design intent. Reduces drift between spec and implementation.

designverificationworkflowskills
by aryaniyaps Jul 21, 2026 7/10
skill GitHub

claude-skills: Open Claude Skills for Go-to-Market Teams

A collection of open Claude Code skills targeting sales and marketing workflows—HubSpot, Salesforce, Clay, cold email, LinkedIn, and outbound automation. Skills install via npx or by copying into .claude/skills/. Targets GTM engineers and revenue teams who want AI-native tooling.

gtmsalesmarketingskillshubspotsalesforce
by Growth-Today Jul 21, 2026 6/10
skill GitHub

gtm-skills: AI Skills for Revenue Engineering in Claude Code Format

Reusable Claude Code skills covering the go-to-market engineering stack: ICP research, brand voice, signal-driven outbound, positioning, lead scoring, and RevOps automation. Built in Claude Code skill format for direct installation. Targets revenue teams building AI-native GTM workflows.

gtmrevenuesalesskillsoutbound
by esmefong Jul 21, 2026 6/10
skill GitHub

Skilldex Registry: Community Registry for Claude Code Skills and MCPs

A community-maintained registry of Claude Code skills, subagents, and MCP servers. Serves as the data store backing the skilldex CLI tool. Centralizes discovery of community-built extensions rather than requiring searches across individual GitHub repos.

registryskillsmcpdiscoverycommunity
by drewn-ed Jul 21, 2026 7/10
skill GitHub

Skilldex: Search, Install, and Audit Claude Code Skills from the CLI

A CLI tool for searching, installing, validating, and auditing Claude Code skills, subagents, and MCP servers from the skilldex community registry. Makes it easy to discover and safely add community extensions without manual copy-paste. Includes validation to catch broken or malformed skills before installation.

cliskillsinstallvalidationmcp
by drewn-ed Jul 21, 2026 8/10
skill GitHub

Claude Code Eyes: Camera Vision Skill for Hardware Debugging

A skill that gives Claude Code access to a live camera feed so it can see real hardware, displays, and wiring. Enables verification of rendered UI on physical screens, wiring checks before power-on, and catching bugs that only manifest on glass rather than in logs. Novel capability for embedded and electronics projects.

visioncamerahardwaredebuggingskills
by fcavalcantirj Jul 21, 2026 8/10
skill GitHub

Topos: Sync Shared Agent Behaviors Across Your Team

A CLI and self-hostable control plane for sharing agent skills and behaviors across a team. Keeps every agent up to date with the latest shared conventions without manual file copying. Useful for organizations where multiple developers run Claude Code and need consistent agent behavior.

teamskillssyncworkflowcollaboration
by topos-sh Jul 21, 2026 7/10
skill Reddit

Agentic Avengers: Multi-Agent Dev Workflow Skills with Character Personalities

A set of Claude Code skills with Avengers character personalities for autonomous, consistent development workflows. Highlights include /assemble (idea → spec → plan → build → PR) and /loki (full codebase analysis producing a MECHANICS.md file). Battle-tested in open-source projects.

skillsmulti-agentworkflowautomationorchestration
by Far_Noise_5886 Jul 21, 2026 7/10
skill GitHub

Retail Investor Skills Plugin: 26 Claude Code Skills with Live Market Data

A Claude Code plugin with 26 skills for reading companies, sectors, and personal trading journals. Backed by live market data from The Balanced Investor Club. Explicitly educational—never buy or sell advice. Useful for investors who want AI-assisted fundamental research without building their own data pipeline.

financeinvestingskillsmarket-data
by the-balanced-investor-club Jul 21, 2026 6/10
skill GitHub

Debrief Skill: Post-Session Agent Performance Review

A Claude Code skill that reviews how a session went—not what code it produced. It identifies mistimed questions, regressions introduced, and wasted tool calls so you can improve prompting and CLAUDE.md configuration. Unique meta-review perspective that complements code review.

metareviewsessionskillsimprovement
by Wavez Jul 21, 2026 8/10
skill GitHub

yt2skill: Turn YouTube Videos and PDFs into Claude Code Skills

A tool that converts a YouTube video or PDF into a ready-to-use Claude Code skill. Transcript-first approach: Claude selects only video frames that carry information not conveyed in the transcript. Useful for packaging tutorial content or documentation as reusable agent skills.

skillsyoutubepdfcontentconversion
by MrEmanAhmad Jul 21, 2026 8/10
skill GitHub

First Principles Skill: 5-Phase Systematic Reasoning for Claude Code

A Claude Code plugin for structured first-principles thinking with a 5-phase methodology: identify essence, challenge assumptions, establish ground truths, reason upward, and validate. Every conclusion traces back to a verified ground truth. Comes with 13 companion skills for specific reasoning tasks.

reasoningskillsmethodologyfirst-principles
by chrisdavidson Jul 21, 2026 8/10
skill GitHub

Blueprint: Adaptive Concept-Builder with Interface Contracts Before Coding

A Claude Code skill that builds a module-oriented blueprint with interface contracts, schema validation, and cross-consistency checks before any implementation code is written. Prevents the common failure mode of coding toward a poorly specified interface. Produces a structured plan the agent can execute against.

planningarchitectureskillscontractsdesign
by motodigitalguru-beep Jul 21, 2026 7/10
skill GitHub

ai-skills: Production-Ready Skills for Claude Code and Multi-Agent Systems

A collection of production-ready skills for Claude Code and multi-agent systems. Targets developers who want battle-tested skill building blocks rather than starting from scratch. Covers common patterns for reliable agent behavior in production environments.

skillsproductionmulti-agentworkflow
by AreteDriver Jul 21, 2026 6/10
skill Reddit

My Full Claude Code Setup: CLAUDE.md, Skills, Permissions, Hooks

A comprehensive walkthrough of a real-world Claude Code configuration covering CLAUDE.md structure, custom skills, permission settings, and automation hooks. Useful as a reference for practitioners assembling their own setup.

CLAUDE.mdskillspermissionshookssetup
by Distinct_Setting558 Jul 21, 2026 6/10
skill GitHub

claude-code-skills: Reusable Skills for Express, OWASP Audits, Security, and TTS

A collection of reusable Claude Code slash command skills covering Express microservice scaffolding, OWASP security audits, security hardening checklists, and TTS generation. Drop-in skills for common development and security workflows.

skillsecurityexpressowaspttsmicroservice
by lantisprime Jul 21, 2026 7/10
skill Reddit

twq: Claude Code Skill That Asks Clarifying Questions Before Acting

A 24-line Claude Code skill (Task With Questions) that makes Claude study your request, ask multi-round clarifying questions to surface assumptions, and only then execute. The author reports using it more than any other skill.

skillclarificationquestionsworkflowux
by fabpub Jul 21, 2026 8/10
skill GitHub

lateralus: Skill That Forces Lateral Thinking When You're Stuck on a Bug

A Claude Code skill for when you've tried the same fix three times and it keeps failing. It forces the model to explore genuinely different approaches rather than iterating on the same failed idea.

skilldebugginglateral-thinkingproblem-solving
by SunnyKTuladhar Jul 21, 2026 7/10
skill GitHub

brand-book: Skill to Build Brand Guidelines and Keep Agentic Code On-Brand

An agent skill that generates a brand guidelines document in a Paper format, plus a companion brand skill that the agent references during coding sessions to keep product output visually and tonally consistent.

skillbranddesignguidelinesconsistency
by ordinarynerds Jul 21, 2026 6/10
skill GitHub

dootask-skills: Claude Code Skills for DooTask Plugin Development

A set of Claude Code skills for DooTask plugin development: scaffold a new plugin, publish to the app store, and write an optimized CLAUDE.md. Install via /plugin install dootask@dootask-skills.

skilldootaskpluginscaffold
by dootask Jul 21, 2026 5/10
skill Reddit

What is your favourite Fable build?

Hello! I like many of you have been messing around with Fable. I optimized my workflows, updated my skills, and built a programming interface to brush up on my Python and SQL skills. But my favouri...

skillworkflowpythonreview
by CanaryHorror2404 Jul 21, 2026 5/10
skill GitHub

ai-launch-red-team: Skill to Red-Team AI Launch Plans Before Production

Agent skill that evaluates AI deployment plans against 8 veto conditions before they reach a live workflow. Works with Claude Code, Cursor, and Codex. Good guardrail for teams wanting an adversarial review step before shipping AI-powered features.

red-teamsecurityskilldeploymentai-safety
by Anonymousyz Jul 21, 2026 7/10
skill GitHub

known-unknowns: Agent Skill for Guided Exploration of the Rumsfeld Knowledge Matrix

Skill that facilitates structured discussions about what you know, what you know you do not know, and what you do not know you do not know — based on the Rumsfeld Matrix. Helps articulate vague ideas and surface blind spots when starting a project or debugging complex issues.

skillknowledge-managementproblem-solvingideation
by Wang-Cankun Jul 21, 2026 5/10
skill Reddit

I built a tool to help me improve my listening skills :D

It It takes short clips from captioned YT videos and turns them into dictation or fill-in-the-blank exercises. You replay a clip, type what you heard, and it highlights the differences :) If you wa...

skillgit
by nice-to-meet-you-bro Jul 21, 2026 5/10
skill GitHub

seedance-shotlist-director: Claude skill: script → Seedance 2.0 production board

Claude skill: script → Seedance 2.0 production board in one prompt | Клод-скилл: сценарий → продакшн-борд для Seedance 2.0 — режиссёрские промпты, ENDS ON склейки, @ассеты, риск-бюджет кредитов, тр...

skill
by afloy011-spec Jul 21, 2026 6/10
skill Reddit

Flame my attempt at building ClaudeCode Skills.

I want you guys to flame the two skills I built with ClaudeCode: https://github.com/AnayDhawan/components https://github.com/AnayDhawan/oss-launch Please Flame as accurately as possible, as I wanna...

skillgit
by NKFBF Jul 21, 2026 6/10
skill Reddit

Anybody using https://github.com/HKUDS/OpenSpace ?

I have a bunch of skills in my claude skillset, and I came across https://github.com/HKUDS/OpenSpace which acts a sefl evolving engine for skills, anybody have used it or at least can see the long ...

skillgit
by jiii95 Jul 21, 2026 6/10
skill Reddit

Kimi Sold out as demand rising

https://preview.redd.it/f757xid75beh1.png?width=2056&format=png&auto=webp&s=4d1c4de4f51c841d0ed1762f7418650a6f3b4ae6 Kimi K3 (China AI model that distilled the anthropic model that doesn't even exi...

skillreview
by pakalumachito Jul 21, 2026 6/10
skill GitHub

benai-skills:

benai-skills:

skill
by naveedharri Jul 21, 2026 5/10
skill GitHub

maestro: Unified Design, Motion, 3D, and Video Super Skill for AI Coding Agents

Distills eight upstream knowledge bases — covering design, motion, 3D, and video — into a single super skill for AI coding agents. Includes automated upstream drift tracking so the skill stays current as its sources evolve. Aimed at agents that need deep creative-toolchain context without juggling multiple skill files.

skilldesignmotion3Dvideoknowledge-basedrift-tracking
by leobbaroni Jul 20, 2026 7/10
skill GitHub

ai-context: Portable AI-Agnostic Agent Context, Skills, and Role Guidance

Personal portable context repository with agent skills and role-based guidance designed to work across different AI coding agents, not just Claude Code. Drop it into any new project to bootstrap consistent agent behavior without reconfiguring from scratch.

skillcontextportableagnosticroles
by Jean-PierreGassin Jul 20, 2026 5/10
skill GitHub

merge-unified-skills: Claude Code Skills for the Merge Unified API

Official Claude Code skills from the Merge team for working with their Unified API, which normalizes integrations across ATS, HRIS, CRM, and other HR and business tool categories. Lets agents interact with dozens of third-party platforms through a single skill interface.

skillmerge-apiintegrationsunified-apihrisats
by merge-api Jul 20, 2026 6/10
skill GitHub

agent-skills: Portable Reusable Skills Shared Across Codex and Claude Code

Single-source skill repository designed for portability across both Codex CLI and Claude Code, with validation-first design and CC Switch integration for seamless management. Provides a home for reusable skills that work identically across coding agents without duplication.

skillportablecodexcross-clivalidationcc-switch
by reagin Jul 20, 2026 5/10
skill GitHub

econ-paper-review-skill: AI Referee Report for Economics Papers Before Real Review

Claude Code / Codex skill that generates verified referee-style feedback on economics, finance, and social science papers before they go to a real reviewer. Produces verifiable comments, editing notes, and a revision plan that agents can implement. Free for noncommercial use, built for iterative revision cycles.

skilleconomicspaper-reviewacademicrefereerevision
by hanlulong Jul 20, 2026 6/10
skill GitHub

skill-olympus: 98 Skills + 49 Agents + 13 Hooks for a Zero-Interaction SaaS Pipeline

Massive cross-CLI skill collection (Claude Code, Codex, Gemini CLI) themed around twelve Greek gods, each covering a domain of the full SaaS lifecycle from design to ship. A single command runs the entire pipeline — design, build, inspect, test, deploy — with cross-CLI persistent memory and no manual steps. The largest known public skill collection for AI coding agents.

skillagenthooksaaspipelinecross-clicomprehensive
by Dannykkh Jul 20, 2026 8/10
skill GitHub

skills: Traditional Chinese Writing and Business Doc Skills for Claude Code

Claude Code skill collection for Traditional Chinese (Taiwan) writing tasks: de-AI editing, business document templates, and professional writing guidance. Also includes English infographic and knowledge-doc skills. Useful for teams working in Traditional Chinese who want agent-assisted document production.

skillchinesewritingbusiness-docstaiwantraditional-chinese
by leoluyi Jul 20, 2026 5/10
skill GitHub

coloring-book-skill: Printable Kids Coloring Books via Claude Code

A Claude Code skill that generates personalized printable coloring books for children ages 3-6. Supports parametric character creation, a story mode, a shape cookbook for simple designs, and vector PDF output. Creative demonstration of using Claude Code skills for media generation workflows.

skillPDFcreativekidsvector
by bedardandy Jul 19, 2026 6/10
skill GitHub

job-hunter-template: AI Job-Search Assistant as a Claude Skills Package

A ready-to-clone template that turns a single GitHub repo into a full personal job-search assistant using Claude Skills. Covers guided onboarding, persistent profile storage, multi-source job sourcing, fit evaluation, tailored CV generation, and application tracking — all version-controlled and inspectable. No personal data included in the template.

skilljob searchtemplateworkflowCV
by FynePool Jul 19, 2026 7/10
skill GitHub

django-performance-optimizer: Agent Skill for Fast Django/DRF Code

A Claude Code agent skill focused on Django and Django REST Framework performance. Follows a measure-first, fix-second approach, with deep coverage of ORM query optimization, serializer efficiency, caching strategies, async patterns, and connection pooling. Complements the separate secure-code-auditor skill and works with Claude, Codex, Cursor, and Gemini.

skillDjangoDRFperformanceoptimizationPython
by n-shadloo Jul 19, 2026 7/10
skill GitHub

html-mockup: Pixel-Faithful HTML Mockups from a Reference Screenshot

A Claude Code skill that takes a reference screenshot and produces a pixel-faithful HTML mockup. Uses a census-first approach — cataloguing all visual elements before rendering — to improve fidelity. Useful for design-to-code handoff workflows where visual accuracy matters.

skilldesignmockupHTMLscreenshot
by humbleteam Jul 19, 2026 6/10
skill GitHub

ascii-wireframes: Sketch 3 Layout Hypotheses in ASCII Before Touching Figma

A Claude Code skill for design teams that generates three distinct ASCII wireframe layout hypotheses before committing to Figma or HTML. Encourages divergent thinking early in the design process, letting teams compare layout directions cheaply before investing in higher-fidelity tools.

skilldesignwireframeASCIIlayoutUX
by humbleteam Jul 19, 2026 7/10
skill GitHub

design-review: Scored UX Critique Skill with Nielsen/WCAG Citations

A Claude Code skill that performs structured UX critiques of your UI, producing scored findings with Before/After/Why fixes and citations to Nielsen heuristics and WCAG accessibility guidelines. Bridges the gap between AI-generated interfaces and design quality standards.

skillUXaccessibilityWCAGNielsendesign review
by humbleteam Jul 19, 2026 8/10
skill GitHub

skillevel: YAML-Based Test Runner for Claude Code Skills

Write YAML test cases for your Claude Code skills and run them through `claude -p` to verify each skill triggers as expected. Fills the gap in skill development — you can now test skill activation behavior the same way you test code.

testingskillsyamlciskill-development
by junghwan16 Jul 19, 2026 8/10
skill GitHub

go-to-damn-bed: A Claude Code Skill That Saves Your Work and Sends You to Sleep

A Claude Code skill that interrupts late-night coding sessions, saves current work state into TOMORROW.md, and firmly tells you to go to bed — without accepting counter-offers. Practical context-preservation wrapped in a bit of humor.

skillsworkflowcontextproductivitysession-management
by moudrkat Jul 19, 2026 7/10
skill GitHub

off-by-none: Spec-Faithful Implementation Skill with Mandatory Boundary Coverage

Claude Code skill that enforces spec-derived tests, mandatory boundary coverage, and evidence-gated done reports before marking work complete. Every rule is TDD-tested against real baseline failures on Opus, Sonnet, and Haiku to ensure the enforcement actually holds.

skillstddtestingspecquality
by NTCHz Jul 19, 2026 8/10
skill GitHub

claude-lore: Project Memory Skill for Decisions and Dead Ends

Claude Code skill that records project state, design decisions, and dead ends that live outside the codebase itself. A new session can resume with full context by reading the lore file instead of re-reading code to reconstruct intent.

memorycontextskillsession-managementknowledge
by sh008 Jul 19, 2026 6/10
skill GitHub

pythinker-code: Review-First Shell Loop for Code, Security, and Debugging

A shell-native tool that enforces a think-first, review-first approach where Claude Code and Codex typically jump straight to writing. Combines a code reviewer, security scanner, root-cause debugger, and code generator in one loop. Slows down to produce more reliable output.

skillreviewsecuritydebuggingcode-qualityshell
by Pythoughts-labs Jul 19, 2026 7/10
skill Reddit

Architecture-Reviewer Skill: Senior-Engineer-Style Design Reviews

A full SKILL.md for Claude Code that stress-tests system architectures across failure domains, scalability, data consistency, security, operability, and cost — prioritizing findings by blast radius. Includes test-driven validation: the author planted 8 deliberate flaws and it found all 8. Ready to drop into ~/.claude/skills.

skillarchitecturesecurityscalabilityreview
by Swimming_Year5735 Jul 19, 2026 9/10
skill GitHub

ai-sync: Sync AI-Agent Config Across Claude Code, Codex, and Kiro

Syncs AI coding agent configuration from a single .ai directory to Claude Code, Codex, and Kiro. Maintains one source of truth for agent configuration and distributes it to all installed agents. Reduces drift when using multiple coding agents on the same machine.

skillconfigurationsynccodexkiromulti-agent
by dialguiba Jul 19, 2026 6/10
skill GitHub

creative-strategy-research-protocol: Audience Research via TikTok and Meta Ads

A gated research protocol for Claude Code built on the MaxFusion AI MCP that pulls real TikTok and Meta Ad Library creatives, analyzes them against Eugene Schwartz's 5 Stages of Awareness, mines voice-of-customer signals, and compiles everything into a persistent research memory tree plus an HTML dossier with personas.

skillmarketingresearchmcppersonasstrategy
by holy-templar Jul 19, 2026 5/10
skill Reddit

prompt-polish: Model-Specific Prompt Rewriter Skill

Rewrites prompts using the official Anthropic guide for the specific target model (Fable 5, Opus 4.8, etc.) rather than a generic template. Classifies the task type and applies model-specific idioms — less prescription for Fable 5, tight scope for Opus. Install via npx skills add mfarzanansari/prompt-polish.

skillprompt-engineeringfable5opus
by imfarzann Jul 19, 2026 8/10
skill GitHub

skillcaddy: Central Library for AI Skills With Per-Project Symlinks

Maintains one AISkills folder with every skill source and symlinks them on demand into any project's .agents/skills or .claude/skills. Works across Claude Code, Codex, OpenCode, and Pi. Eliminates duplication when sharing skills across many repos.

skillskills-managementmulti-agent
by chenweil Jul 19, 2026 6/10
skill GitHub

baseline-skill: Zero-Dependency Project-Readiness Checker (69 Rules)

A /baseline slash command skill that audits a project against 69 readiness rules with no external dependencies. Installs into ~/.claude/skills/baseline. Surfaces gaps like missing README, untested modules, or missing CI configuration before work begins.

skillproject-healthqualityaudit
by AdarGit008 Jul 19, 2026 7/10
skill GitHub

zotero-dev-rules: Zotero Developer Docs as a Coding-Agent Skill

Packages Zotero developer documentation — Web API v3 (read/write, sync, streaming, OAuth), client JS API, Zotero 7 plugins, translators, and CSL citation styles — as a coding-agent skill. Enables agents to write Zotero integrations without hallucinating the API.

skillzoteroapidocumentation
by Agents365-ai Jul 19, 2026 6/10
skill GitHub

forgekit: Unified Config and Cognitive Substrate for All AI Coding Agents

Provides one configuration layer covering Claude Code, Codex, Cursor, Gemini, Aider, and more, plus a cognitive substrate for memory, blast-radius tracking, and guardrails. Reduces per-agent setup overhead when using multiple coding agents on the same project.

skillmulti-agentconfigurationguardrails
by CodeWithJuber Jul 19, 2026 7/10
skill GitHub

techne: Nine Claude Skills for Multi-Repo Workflows

A collection of nine Claude Code skills targeting multi-repository development: audit builds, tame CI, sync docs to code, and keep sister repos in lockstep. Useful for monorepo-adjacent setups where consistency across repos matters.

skillmulti-repocidocumentation
by ajbarea Jul 19, 2026 6/10
skill GitHub

mentor: Session-Insights Skill That Reports How You Work

Reads local Claude Code and OpenAI Codex session history and writes an HTML report on what you build, where you lose time, and concrete workflow improvements. Surfaces patterns like repeated tool failures or overlong context usage. Works with Claude Code, Codex, and any skills-capable agent.

skillanalyticsproductivitysession-analysis
by smixs Jul 19, 2026 7/10
skill GitHub

skills-manager: Claude Code Skill for Managing Skills, MCPs, and Plugins

A meta-skill for Claude Code that helps manage the growing collection of skills, MCP servers, and plugins by organizing them into categories. Useful as the Claude Code ecosystem grows and managing dozens of installed skills becomes difficult.

skillskills-managementmcporganization
by Xue-Sir Jul 19, 2026 6/10
skill GitHub

slop-cop: Detect AI-Generated Language Patterns in Your Codebase

A Claude Code skill that scans a codebase for AI-writing tells — overused phrases, filler words, passive constructions — to ensure human-quality prose in comments, docs, and strings. Grounded in common AI writing anti-patterns.

skillcode-qualitywritingai-detection
by Lucasli6833 Jul 19, 2026 5/10
skill GitHub

claude-code-learned-skills: 12 Skills Auto-Extracted From Real Sessions

Twelve Claude Code skills distilled from actual usage sessions, covering Docker/SSH/VPS operations, data and ML pipeline gotchas, model-specific prompting guides for four models, a 10-category bug audit, and a persistent project wiki with slash commands. Real-world extraction means these address actual pain points.

skilldockersshvpsmlprompting
by aksheyw Jul 19, 2026 8/10
skill GitHub

cc-thingz: Portable Skills, Agents, Hooks, and Pi Extensions

A collection of portable skills, agents, hooks, and Pi extensions for Claude Code, Codex CLI, Copilot, Cursor, Grok, and Pi. Cross-tool design means the same skills work regardless of which AI coding agent you're using.

skillmulti-agenthooksportable
by alexei-led Jul 19, 2026 6/10
skill GitHub

Claude-Liquid-Glass-Skill: iOS Liquid Glass UI for Swift and React Native

A Claude Code skill for generating iOS Liquid Glass design components in Swift and React Native. Helps developers implement Apple's Liquid Glass aesthetic with AI assistance. Platform-specific but covers two of the main mobile development ecosystems.

skilliosswiftreact-nativedesign
by zakisheriff Jul 19, 2026 5/10
skill GitHub

openwolf-enhanced: Token-Conscious Second Brain for Claude Code

An enhanced fork of OpenWolf that adds bounded storage, self-maintenance via an 'openwolf doctor' command, .wolfignore scoping for excluding files from context, and tunable retention policies. Addresses the original OpenWolf's lack of storage limits. AGPL-3.0.

skillmemorycontexttoken-optimization
by bassprofressor-lab Jul 19, 2026 7/10
skill GitHub

cad-khana: Claude Code Skill for LLM-Driven CAD With Build123d

A Claude Code skill and diagnostics-first wrapper around Build123d for LLM-driven 3D CAD iteration. Surfaces Build123d error messages in a form the model can act on, enabling back-and-forth CAD design workflows. For developers who work on parametric 3D modeling.

skillcadbuild123d3d-modeling
by cyberchitta Jul 19, 2026 6/10
skill GitHub

research-code-skill: AI Coding Standard for ML/DL Research Repos

A coding-standard skill that enforces a fixed architecture for ML/DL research repositories: uniform structure, naming conventions, configuration standards, FAIR data practices, and review via machine-executable Rule Cards. Prevents the common drift in research code as multiple contributors (human and AI) add to it.

skillmlresearchcode-standardsfair-data
by SaltGardenia Jul 19, 2026 7/10
skill GitHub

design-brief: Extract a 5-Bullet Design Brief From Messy Project Inputs

A Claude Code skill that takes messy project inputs (stakeholder notes, Figma links, PDFs) and distills them into a structured 5-bullet design brief plus a gap report identifying missing information. Useful at the start of any design or product project.

skilldesignuxproduct
by humbleteam Jul 19, 2026 6/10
skill GitHub

design-handoff: Turn a Mockup Into a Dev-Ready Handoff Spec

Converts a UI mockup into a developer-ready handoff specification covering design tokens, component states, accessibility notes, and open questions. Bridges the gap between designers and developers in AI-assisted workflows. Part of the humbleteam design skill collection.

skilldesignhandofftokensaccessibility
by humbleteam Jul 19, 2026 7/10
skill GitHub

accessibility-audit: WCAG 2.2 Audit Skill for Claude Code

A Claude Code skill that performs WCAG 2.2 accessibility audits on web UIs, returning severity-ranked findings with success-criterion citations. Integrates accessibility review into the coding agent workflow without requiring a separate tool.

skillaccessibilitywcagauditweb
by humbleteam Jul 19, 2026 7/10
skill GitHub

claude-plugins: Marketplace With Per-Worktree Plugin Loadouts

A small Claude Code plugin marketplace with its first entry: loadout, which lets you activate a different set of plugins per git worktree. Useful when different branches or projects need different skill/agent configurations without global setting changes.

skillpluginsworktreeconfiguration
by TerryHong97 Jul 19, 2026 6/10
skill GitHub

mnemo: Persistent Memory Layer for Claude Code With Obsidian Integration

Five lightweight skills providing an Obsidian vault health checker, connection discovery, brain dump, session notes, and an email bridge. CLI-first with no prescribed taxonomy — works with any knowledge structure. Bridges Claude Code sessions to a persistent Obsidian knowledge base.

skillmemoryobsidiannotespersistence
by jojoprison Jul 19, 2026 7/10
skill GitHub

claude-homelab-skills: Safe Homelab Admin Skills for Claude Code

Claude Code skills for homelab administration emphasizing safety: Tailscale ACL validation with anti-lockout protection, and Proxmox snapshot-before-write for any destructive operation. Adds judgment (not just tools) to prevent accidental self-lockout during AI-assisted homelab management.

skillhomelabtailscaleproxmoxsafety
by Enzojol Jul 19, 2026 7/10
skill GitHub

agenticaiplugin: Language-Agnostic Claude Code Plugin for Code Reviews and Audits

A Claude Code plugin that adds multi-specialist code reviews, architecture audits, QA traceability, smart git commits, and GitHub release preparation. Project-specific rules in claudedocs/ take precedence over built-in guidelines. Language-agnostic.

skillcode-reviewarchitectureauditrelease
by mka-codelake Jul 19, 2026 7/10
skill GitHub

skill3: Java CLI That Auto-Generates Agent Skills From Documentation

Discovers documentation sources for a given technical skill, scores them for authority and freshness anchored to a model's knowledge cutoff, synthesizes them into an Agent Skills SKILL.md using a local LLM, and vets the result with NVIDIA SkillSpector. Automates the creation of skills from live docs.

skilldocumentationauto-generationjavalocal-llm
by PIsberg Jul 19, 2026 7/10
skill GitHub

helix: Portable QA Skill Pack for AI Coding Agents

A portable QA skill pack covering frontend and API test-case preparation (AC/EC + Swagger coverage review), Playwright ticket testing, defect filing, and Jira retest. Works across Claude Code, Cursor, Codex, GitHub Copilot, Gemini CLI, Windsurf, Cline, and other Agent Skills-compatible tools.

skillqaplaywrightjiraswaggertesting
by Thitic9203 Jul 19, 2026 7/10
skill GitHub

Blender-Developer-Tools: Skills and Examples for Blender Python Development

A collection of skills, rules, code snippets, templates, and smoke-gated runnable examples for Blender Python development, targeting Blender 5.1 with 4.5 LTS fallback. Enables Claude Code to write verified Blender Python without hallucinating the API.

skillblenderpython3dcreative-coding
by TMHSDigital Jul 19, 2026 6/10
skill GitHub

skills-hub: See Which AI Agent Skills Actually Get Used From Session Logs

A local web UI that reads Claude Code, Codex, and OpenCode session logs to count which skills actually get triggered in practice. Surfaces underused skills and helps prioritize which ones to maintain. Zero-dependency, local-only.

skillanalyticsusage-trackingsession-logsoptimization
by Liang-HZ Jul 19, 2026 8/10
skill GitHub

awesome-solo-ai: Curated AI Tools and Claude Skills for Solopreneurs

A curated collection of AI tools, Claude skills, MCP servers, and growth playbooks for solopreneurs and indie hackers — structured as a feed-to-Claude-Code context package. Covers the one-person-company AI stack from product to marketing.

skillsolopreneurcuratedmcpgrowth
by yerdaulet-damir Jul 19, 2026 5/10
skill GitHub

claude-ops: Business Operating System for Claude Code (57 Skills, 21 Agents)

A comprehensive business operating system built on Claude Code with 57 skills, 21 agents, and a smart daemon. Covers unified inbox (WhatsApp/Email/Slack/Telegram), autonomous PR merge, full-AWS monitoring, Stripe, Shopify, Klaviyo, Meta, GA4, voice (Bland/ElevenLabs), and APM (Datadog/NewRelic/OTEL).

skillbusinesssaasmonitoringintegrationsautomation
by Lifecycle-Innovations-Limited Jul 19, 2026 8/10
skill GitHub

uzys-agent-harness: Curate Vetted AI Coding Skills by Tech Stack

A tool for selecting and installing only the AI coding skills relevant to your specific tech stack, from a vetted collection compatible with Claude Code, Codex, OpenCode, and Antigravity. Reduces noise from installing large skill packs that include irrelevant skills.

skillcurationtech-stackmulti-agent
by uzysjung Jul 19, 2026 5/10
skill GitHub

swe-workbench-loom: Senior Engineer AI Toolkit for Go/Rust/TypeScript

A 2026 senior engineer AI toolkit implementing Clean Architecture principles for Go, Rust, and TypeScript development. Provides structured patterns for AI-assisted development in these three languages with architecture-first guidance.

skillgorusttypescriptclean-architecture
by amoh7209-dot Jul 19, 2026 6/10
skill GitHub

i-have-adhd: Claude Code Skill for ADHD-Friendly, Bottom-Line-First Output

A Claude Code skill that instructs the model to stop burying the answer — lead with the conclusion, then the reasoning. Practical for any user who finds Claude Code's verbose, reasoning-first responses hard to skim. MIT-licensed, single-file skill.

skilladhduxconcisenessoutput-format
by ayghri Jul 19, 2026 7/10
skill GitHub

califa-cards: Comprehensive Skill Card Standard and Testing Framework

A specification and testing framework for AI agent skill cards — a standard format for describing, testing, and distributing agent skills. Provides a structured way to ensure skill cards are complete, testable, and portable across agents.

skillstandardtestingskill-cardsportability
by vinsonconsulting Jul 19, 2026 6/10
skill GitHub

abvx-agent-skills: Reviewable Capability Layer With Delivery Gates and Verification

A capability layer for coding agents emphasizing reviewability: portable skills, delivery gates, workflow patterns, and verification-first engineering. Designed so every agent capability can be inspected and its outputs verified before acceptance.

skillverificationdelivery-gatesportablequality
by markoblogo Jul 19, 2026 6/10
skill GitHub

stripe-design-skill: Color-Agnostic Stripe Design System Skill for Claude Code

A Claude Code skill that encodes the Stripe design system in a color-agnostic form, letting you apply Stripe's spacing, typography, and component patterns to any brand palette. Drop it in and Claude Code follows Stripe's UI conventions without being locked to Stripe's specific colors. Useful for building polished dashboards and payment UIs quickly.

stripedesignuiskilldesign-systemcomponents
by victoryoalli Jul 19, 2026 6/10
skill GitHub

vscode-crash-recovery-skills: Agent Skills for Safe VS Code Crash Recovery on macOS

Harness-neutral Agent Skills for recovering from VS Code crashes and cleaning up project-scoped build artifacts on macOS without data loss. Works with any agent that supports Skills (Claude Code, etc.). Handles the edge cases — zombie processes, locked files, stale build caches — that make crash recovery error-prone manually.

skillvscodecrash-recoverymacoscleanupagent
by ariellephan Jul 19, 2026 5/10
skill GitHub

claude-todos-skill: Per-Project Todo Tracking With Broadsheet Dashboard

Per-project todo tracking combined with a project brain and autonomous plan-then-build workflow for Claude Code, with a local broadsheet dashboard. Integrates task management directly into the agent workflow rather than as a separate tool.

todostask-managementskilldashboardplanning
by unknown Jul 18, 2026 7/10
skill Reddit

speedread-skill: Read Agent MD Reports 3.5x Faster With RSVP

Skill that renders Markdown documents using RSVP (Rapid Serial Visual Presentation) speedreading, enabling up to 6x faster reading with practice. Settings (colors, fonts, speed, ramp-up, markdown tweaks) are saved across sessions. Useful when reviewing long agent-generated reports.

readingrsvpspeedskillproductivity
by heisdancingdancing Jul 18, 2026 6/10
skill GitHub

ad-campaign-skills: Production-Grade Paid Media Skills for Claude Code

Production-grade paid-media agents and skills for Claude Code that generate complete ad campaigns for any industry and region from a 4-line client brief, covering Meta, Google, YouTube, and TikTok. Designed for agencies and marketers running ad operations through Claude Code.

marketingadvertisingskillmetagoogle-ads
by rghrmkr1993 Jul 18, 2026 6/10
skill GitHub

olddonkey-skills: Codex-Implementation-Loop for Claude + Codex Pairing

Agent skills distilled from real-world usage featuring the codex-implementation-loop: delegate coding to Codex while keeping review, gate, and ship judgment in Claude hands. A practical pattern for pairing the two most popular coding agents with clear separation of responsibilities.

codexpairingskillreviewdelegation
by olddonkey Jul 18, 2026 6/10
skill GitHub

claude-skill-aso-reviews: Turn App Store Reviews Into ASO Insights

Claude Code skill that turns Apple App Store reviews into App Store Optimization and product feedback insights. Automates the process of reading and categorizing user reviews at scale to surface actionable product insights.

asoapp-storereviewsskillproduct
by johnisanerd Jul 18, 2026 6/10
skill GitHub

claude-skill-congress-trading: Track Congress Trading Disclosures

Claude Code skill that tracks newly filed US Congress trading disclosures on a schedule via CLI, installed via npx skills add. Automates monitoring of congressional stock trading activity for research and alerting workflows.

financecongressdisclosureskillmonitoring
by johnisanerd Jul 18, 2026 6/10
skill GitHub

claude-skill-congress-stocks: Congress Stock Trade Disclosures as JSON

Claude Code skill that retrieves US Congress stock trade disclosures as structured JSON via CLI. Complementary to the congress-trading-tracker, providing a data access layer rather than a monitoring scheduler.

financecongressjsonskillapi
by johnisanerd Jul 18, 2026 6/10
skill GitHub

Claude Code Plugin: EDA + Event Sourcing + Azure Functions Harness

Claude Code plugin providing a harness for event-driven architecture with event sourcing on Azure Functions. Pre-built scaffolding and conventions for this specific backend pattern, reducing the time needed to set up a correct EDA implementation from scratch.

azureevent-sourcingedaserverlessskill
by augusto-romero-arango Jul 18, 2026 6/10
skill GitHub

ui-ux-audit-skill: Audit UI Code for Layout Failures and Design Drift

Audits web and mobile UI code to detect layout failures, responsiveness errors, and design system drift before deployment. Catches the class of issues that code linters miss but visual inspection would catch, giving agents a way to self-audit UI quality.

uiauditresponsivenessdesign-systemskill
by Xza2792 Jul 18, 2026 6/10
skill GitHub

zero-sugar: Honesty Mode for Claude Without Politeness Padding

Configures Claude to deliver damage-ranked findings with evidence per criticism, calibrated confidence, and no politeness padding. Useful when you need direct critical feedback rather than diplomatically softened analysis, especially in code review or debugging scenarios.

honestyfeedbackskillcode-reviewdirectness
by edward-sh88 Jul 18, 2026 6/10
skill GitHub

contentforge: Enterprise Content Production Plugin With 21 Skills

Open-source enterprise content production plugin with 21 skills, 13 agents, 11 quality gates, a 29-pattern AI humanizer, fact-checker, and real .docx output with C2PA signing for EU AI Act Article 50 compliance. Works across Claude Code, Cowork, Codex, Cursor, and Copilot CLI.

contententerpriseskillcompliancedocx
by indranilbanerjee Jul 18, 2026 6/10
skill GitHub

inner-outer-monologue: Two-Layer Reasoning Discipline for Claude

Establishes a two-layer reasoning discipline where clauses carry explicit output obligations and failures are auditable clause by clause. Makes Claude reasoning more transparent and verifiable by separating internal reasoning from external output commitments.

reasoningtransparencyskillauditclauses
by duncan806 Jul 18, 2026 6/10
skill GitHub

hiccai-landing: Claude Code Skill for High-Conversion Landing Pages

Claude Code skill for high-conversion landing pages covering strategy, copy, design, motion, runnable HTML, with built-in SEO and GEO support including llms.txt, FAQ JSON-LD, and AI-crawler readiness. Includes bilingual support (English/Chinese).

landing-pageseogeoskillhtml
by laixi969-coder Jul 18, 2026 6/10
skill Reddit

176k-Starred GitHub Repo Changed How I Write CLAUDE.md

Post exploring how insights from a 176k+ starred GitHub repository changed the approach to writing CLAUDE.md configuration files. Demonstrates how ideas from adjacent communities can meaningfully improve Claude Code configuration practices.

claude-mdconfigurationtipsbest-practices
by Single-Cherry8263 Jul 18, 2026 6/10
skill Reddit

Playbook: One Plugin Repo Running on 5 Agents Simultaneously

How to make a single plugin repository work on Claude Code, Codex, OpenCode, Hermes, and Antigravity at once without duplicating skill definitions. Addresses the growing need to maintain skills across multiple agent runtimes as developers use more than one tool.

plugincross-agentcodexhermescompatibility
by No_Skill_8393 Jul 18, 2026 6/10
skill GitHub

dehumanize: Make AI Work Like AI, Not a Human Assistant

Skill and configuration that removes human-oriented behaviors from Claude: no time estimates, no asking for accessible data the agent can fetch itself, no emotional labor. Designed for autonomous agent workflows where human-like hedging and hand-holding wastes tokens and slows execution.

skillbehaviorautonomousefficiency
by ssplug Jul 18, 2026 6/10
skill GitHub

user-md: USER.md That Grows With Your AI Interactions

A USER.md file with two lanes: hand-written and agent-curated, with no silent rewrites from the agent side. The AI builds up its understanding of you in a file you own and control, that moves when your folder moves. Gives the agent persistent user context without surrendering control.

memoryuser-profilemarkdownagent-memory
by LucioLiu Jul 18, 2026 6/10
skill GitHub

claude-office-skills: Excel and PowerPoint Automation for Claude Code

Imports Excel and PowerPoint skills into Claude Code to automate spreadsheets and presentations using local filesystem access. Useful for developers who need to generate or modify Office documents as part of automated workflows.

excelpowerpointofficeautomationskill
by Borjani1577 Jul 18, 2026 6/10
skill GitHub

agent-second-brain: Dynamic Knowledge System for Claude Code Agents

Builds a dynamic knowledge system for Claude Code agents that evolves over time with the ability to test and manage information. Designed to give agents a persistent second brain that improves with use rather than starting from scratch each session.

knowledgememorydynamicskill
by benizlerken Jul 18, 2026 6/10
skill GitHub

claude-nomad: Sync Full Claude Code Setup Across Machines

Syncs your complete Claude Code setup across machines: skills, settings, and session history, with path remapping and per-host overrides. Addresses the pain of maintaining consistent Claude Code configuration when working across multiple machines or cloud environments.

synccross-machinesettingsskillshistory
by funkadelic Jul 18, 2026 8/10
skill GitHub

agentmaster: Expensive Head, Cheap Hands Workflow for Claude Code

Claude Code and GitHub Copilot skills implementing an expensive head/cheap hands pattern — a master decision-maker on a frontier reasoning model that never touches the repository, commanding subagent workers that do all reading, running, and writing with adversarial gates at both ends.

multi-agentorchestrationadversarialcost-efficiency
by rhawk117 Jul 18, 2026 7/10
skill GitHub

skill-press: Factory for Claude Code Skills — Nothing Ships Untested

A factory for Claude Code skills where nothing ships without being tested. Enforces a review and testing process for every skill before publication, addressing the quality problem in the growing ecosystem of unvetted skill packages.

skilltestingqualityfactory
by proluct Jul 18, 2026 7/10
skill GitHub

collapse: Pattern-to-SKILL.md Compiler for Claude Code

Compiles patterns from MDX lessons, Jupyter notebooks, or custom sources into SKILL.md files via a type-safe pipeline with local atomic writes to ~/.claude/skills/. Three pluggable ingestors let you convert any learning material into Claude Code skills.

skillcompilerjupyterautomationmdx
by akaieuan Jul 18, 2026 8/10
skill GitHub

saas-skills: Agent Skills for Shipping SaaS on Next.js + Supabase

Agent skills covering the full SaaS lifecycle: product definition, secure build-and-launch, and safe maintenance on Next.js, Supabase, and Stripe. Works with Claude Code, Codex, and Antigravity. Opinionated toward security and correctness at each stage.

saasnextjssupabasestripeskill
by Naveen-95 Jul 18, 2026 7/10
skill GitHub

claude-code-skills: Curated Catalog of Verified Working Skills

Hand-verified catalog of working Claude Code skills covering marketing, SEO, dev, and MCP — with no dead links. Also ships a built-in 19-sub-skill SEO/GEO agent ready to use. Addresses the frustration of finding skill collections where half the links are broken or unmaintained.

skillcatalogseoverifiedmarketplace
by nurdamiron Jul 18, 2026 7/10
skill GitHub

skill-creator-plus: Bug-Fixed Anthropic Skill Creator With Cowork Support

Based on Anthropic official skill-creator but with bug fixes, working Cowork support, and official best practices baked in. A Claude skill for creating, testing, and improving other Claude skills. Useful when the original has issues that prevent it from working properly with Cowork.

skillmetaskill-creatorcowork
by yaniv-golan Jul 18, 2026 8/10
skill Reddit

LLM Wiki: Installable Skill for Building a Persistent Knowledge Brain

Implementation of Andrej Karpathy LLM Wiki pattern as an installable Claude skill plus BLUEPRINT.md spec. Instead of RAG, the LLM builds and maintains a persistent Markdown wiki from your sources — read once, cross-reference forever, flag contradictions. Key rule: if the brain has no coverage, it says so rather than inventing an answer.

knowledge-basewikiskillmarkdownkarpathy
by PromptFiction Jul 18, 2026 8/10
skill GitHub

goldilocks: Lean Superpowers Replacement for Coding Agents

Minimal-process, constant-quality alternative to Superpowers for coding agents. Focuses on minimum necessary workflow to maintain consistent output quality, avoiding the complexity and overhead that accumulates in larger skill frameworks. Available in both English and Chinese.

skillworkflowsuperpowerslightweight
by blackstone2333 Jul 18, 2026 7/10
skill GitHub

claude-sync-by-skill: Sync Claude Code Environment Across Platforms

Directional, cross-platform, transport-agnostic sync for Claude Code settings, memory, plans, and skills driven by an in-Claude skill. Supports up/down/status operations and works regardless of the underlying transport mechanism.

synccross-platformsettingsskills
by JonMcMillan Jul 18, 2026 7/10
skill GitHub

agent-plugins: Plugin Marketplace for Claude Code and Cowork

Curated plugin collection for Claude Code and Claude Cowork featuring fresh-eyes code review agents, workflow orchestrators, and specialized skills. Emphasizes independent review — agents that have not seen the original implementation evaluate the output from a fresh perspective.

plugincode-reviewmarketplaceworkflow
by aliasunder Jul 18, 2026 7/10
skill GitHub

skill-builder: Build Reusable Skills From Shell and Claude Logs

Analyzes shell, git, browser, and Claude logs to spot recurring patterns and convert them into installable slash commands in your AI tools. Automates the process of turning repetitive workflows into reusable agent skills.

skillautomationslash-commandpatterns
by izzidescendent834 Jul 18, 2026 7/10
skill GitHub

skill-sync: Desktop App That Syncs Agent Skills Across Machines

Local-first desktop app that syncs Codex, Claude Code, and Agent Skills across machines through your private GitHub repository. Solves the problem of maintaining consistent skill configurations when working across multiple development machines.

syncskillscross-machinegithub
by TreatTrick Jul 18, 2026 7/10
skill GitHub

claude-skills: Docker and Kubernetes Skills for Autonomous Agents

Production-ready Docker and Kubernetes tooling packaged as Claude Code skills with built-in validators. Install once and use everywhere for container management and Kubernetes operations from within your agent workflows. Modular and independently verifiable.

dockerkubernetesskilldevopscontainers
by obeone Jul 18, 2026 7/10
skill Reddit

onebreath: Slash Commands for Concise Claude Responses

Tiny Claude Code plugin adding /onebreath:1s for one-sentence responses and /onebreath:1p for one-paragraph responses. Solves the common problem of Claude producing walls of text when you just need a quick answer. Especially useful in multi-session setups where brevity matters.

skillconcisecommandux
by louixs Jul 18, 2026 7/10
skill GitHub

neuralmind: Persistent Memory That Learns Codebase Like a Senior Engineer

Persistent memory for AI coding agents that learns which files go together and what you usually edit next, the same way a senior engineer builds intuition. Works with Claude Code, Cursor, Cline, and Continue, running 100% locally. Reportedly reduces code question costs by 40-70x.

memorycodebaselocal-firstcostcontext
by dfrostar Jul 18, 2026 7/10
skill Reddit

VibeCurb: Strict SKILL.md Files to Kill Generic AI-Generated UI

Collection of strict skill.md files that kill the generic glassmorphism and rounded-corner spam in AI-generated UIs. Enforces viewport-scale typography, brutalist design, and extreme whitespace, forcing the agent to think like an Awwwards-tier designer before writing code. Works with Claude, Cursor, ChatGPT, Codex, and Gemini.

uidesignskillbrutalismcss
by AudienceNo2554 Jul 18, 2026 7/10
skill GitHub

bastra-recall: Local-First Memory Vault Shared Across AI Tools

Local-first persistent memory for Claude Code, Cursor, ChatGPT, and any MCP client — one Markdown vault shared across every AI tool. Keeps all context in files you own and control, with no vector database or cloud service required.

memorymarkdownlocal-firstmulti-tool
by n0mad-ai Jul 18, 2026 7/10
skill GitHub

better-github-skill: Optimized GitHub Skill With Fewer Tool Calls

Drop-in replacement for standard GitHub skills that makes bounded, targeted calls: one call each for PR state, review threads, and CI failures. Reduces context burned and cost compared to naive approaches that over-fetch GitHub data. Works with any coding agent.

githubskilltokensefficiencypr
by AVGVSTVS96 Jul 18, 2026 7/10
skill GitHub

scholia: Git-Native Product Memory With Claude Code Skills

Single binary tool for storing action-driven specs and append-only decision records that AI agents can evaluate code changes against. Includes a built-in viewer and Claude Code skills for integration. Keeps product intent inside git alongside the code it governs.

memoryspecdecision-recordsgit
by nkenji09 Jul 18, 2026 7/10
skill GitHub

Agentic Memory Stack for Claude Code on Windows + WSL2

Persistent, multi-tier, measurably-faithful memory backend for Claude Code on Windows and WSL2, combining mem0, Qdrant, EmbeddingGemma, and Codex. Self-contained operator-agnostic installer skill. Designed for Windows-first environments where other memory setups fall short.

memorywindowswsl2qdrantskill
by dmmdea Jul 18, 2026 7/10
skill GitHub

ai-brain-starter: Operating System Layer for Claude Code

Comprehensive one-install foundation for Claude Code providing memory, accountability, journaling, knowledge graphs, and pattern recognition. Designed so every session compounds on the last by building up persistent understanding of projects and decisions. Installs everything in one command.

memoryknowledge-graphjournalingskillclaude-code
by mycelium-hq Jul 18, 2026 8/10
skill GitHub

web-scraping-skills: Authorized Web Scraping via CDP for Claude Code

Claude Code skill marketplace for attaching to a logged-in Chrome over CDP and harvesting JSON/GraphQL data that pages already fetch. Includes anti-block hygiene and resumable state. Designed for authorized scraping scenarios where you control the browser session.

web-scrapingcdpchromeskill
by brightstone111 Jul 18, 2026 7/10
skill GitHub

poor-man-memory: Claude Code Memory in Markdown and Git

Stores structured Claude Code memory in markdown files tracked by git — no extra infrastructure required. Provides cross-session memory with the simplicity of plain text and the history of version control. Zero dependencies and works on any machine with git already installed.

memorymarkdowngitclaude-codeno-infrasimple
by huckaby1847 Jul 18, 2026 6/10
skill GitHub

video-ai-toolkit: Give Your AI Agent Full Control Over Videos

Gives AI coding agents full control over videos — download with yt-dlp (MP4/MP3), watch with claude-real-video, and transcribe with speaker diarization via WhisperX. All local, Portuguese-language documentation. Claude Code skills and compatible agent skills included.

skillvideotranscriptionyt-dlpwhisperxclaude-code
by JohnsonChenx Jul 18, 2026 6/10
skill GitHub

crag: Bedrock Governance Layer for AI Coding Agents

A single governance.md bedrock layer for AI coding agents that works across any project and never goes stale. Compiles to Claude, Cursor, Codex, Gemini, and Aider-compatible formats from one source. Universal skills mean you write the governance rules once and they work everywhere.

governanceCLAUDE.mduniversalskillsclaude-codecodexcursor
by WhitehatD Jul 18, 2026 7/10
skill GitHub

skills: 19 Composable Pipeline-First Skills for Feature Delivery

A pipeline-first Claude Code skills pack with 19 composable skills for structured feature delivery from shape to ship. Each skill fits into a delivery pipeline stage so you can chain them together. Designed for teams who want an opinionated but flexible feature delivery process.

skillspipelinefeature-deliverycomposableclaude-code
by chrislacey89 Jul 18, 2026 7/10
skill GitHub

akakika-skills: Curated Agent Skills for Building Native Apps

Curated, polished agent skills for building calm native apps and running AI coding agents well. Works with Claude Code, Codex, and Cursor. Focused on native app development patterns and calm, deliberate workflows rather than rapid vibe coding.

skillsnative-appsclaude-codecodexcursorquality
by aka-kika Jul 18, 2026 6/10
skill GitHub

ren-os: Agentic OS for Claude Code With Compounding Memory

An agentic OS for Claude Code featuring compounding memory you own, token discipline, and governed autonomy — all in a plain-markdown wiki as your single source of truth. Named after the Chinese concept of benevolence, it focuses on thoughtful, deliberate agent behavior rather than speed.

memoryAI-OSclaude-codetoken-efficiencymarkdowngovernance
by hazarsozer Jul 18, 2026 7/10
skill GitHub

chameleon: Guide AI-Generated Code to Match Your Team Conventions

Automatically analyzes your codebase to learn conventions, then guides AI-generated code to follow team idioms, architectural patterns, and best practices — keeping auto-generated code in sync with evolving standards. A living conventions engine that updates as your codebase evolves.

skillconventionscode-qualitystandardsclaude-codeteam
by crisnahine Jul 18, 2026 8/10
skill GitHub

trigger_tree: Documentation-Discovery Telemetry for Claude Code

A documentation-discovery telemetry skill for Claude Code that generates heat/cold maps, health grades, and evidence-backed router fixes for your documentation system. Runs 100% locally with zero tokens. Helps you understand which parts of your CLAUDE.md are actually being used.

skilldocumentationtelemetryCLAUDE.mdlocalanalytics
by Hedde Jul 18, 2026 7/10
skill GitHub

google-ads-diagnostic-toolkit: 10 Claude Skills for Google Ads Diagnostics

Ten production Claude skills covering the full Google Ads diagnostic lifecycle — waste detection, spend spikes, Quality Score analysis, budget management, and reporting. Built from real campaign management experience. Useful for marketers and agencies who want AI-assisted Google Ads analysis.

skillgoogle-adsmarketingdiagnosticsPPCanalytics
by kochellenk-afk Jul 18, 2026 7/10
skill GitHub

claude-marketing-skills: Claude Skills From a Working Fractional CMO

Production Claude skills from a working fractional CMO practice covering client sweeps, critique layers, decision councils, and Meta ad engines. Built from real consulting engagements. Useful for marketing practitioners and agencies who want AI-assisted marketing strategy and execution.

skillmarketingCMOstrategymeta-adsconsulting
by kochellenk-afk Jul 18, 2026 6/10
skill GitHub

martech-ai-skills: Claude Skills for the Marketing Technology Stack

Claude skills and read-only CLIs for the marketing-technology stack — covers martech teardown, Google Ads, Microsoft Ads, and Google Merchant Center. Built for practitioners who want AI-assisted analysis of their marketing tech without giving write access to ad accounts.

skillmarketinggoogle-adsmartechanalyticsclaude-code
by almoretti Jul 18, 2026 6/10
skill GitHub

shakedown: One-Command Pre-Ship Audit Skill for Claude Code

A one-command shakedown skill for Claude Code that checks architecture, security, performance, resilience, and docs before you ship. Surfaces what breaks before your users find it. Useful as a final gate before merging or deploying.

skillauditsecurityperformancepre-shipclaude-code
by belousov-petr Jul 18, 2026 7/10
skill GitHub

claude-code-setup: Real Claude Code Global CLAUDE.md and Skills Shared

A shared real-world Claude Code setup — global CLAUDE.md instructions and the skills built and used daily by the author. Good reference for what production Claude Code configuration looks like from an experienced user. MIT licensed for copying and adapting.

CLAUDE.mdsetupskillsconfigurationreferenceclaude-code
by cozren Jul 18, 2026 6/10
skill GitHub

repo-standard-toolkit: Scaffold Repo Docs From Published Standards

Scaffolds README, CHANGELOG, and community health files from published standards (Keep a Changelog, standard-readme, Contributor Covenant) and keeps them accurate with a committed, dependency-free linter and CI gate. The linter runs without Claude so standards are enforced in CI as well.

skilldocumentationreadmechangelogstandardsCI
by runverdict Jul 18, 2026 7/10
skill GitHub

addlightness: Remove AI-Generated Code Fat While Preserving Behavior

A zero-dependency Claude Code plugin that simplifies and removes bloat from AI-generated code while preserving behavior, then benchmarks the speedup. Measures code weight, trims it, verifies equivalence, and benchmarks the result. Useful for cleaning up verbose AI output that works but is heavier than it needs to be.

skillrefactoringoptimizationclaude-codecode-quality
by 88plug Jul 18, 2026 7/10
skill GitHub

project-prospector: Discover and Rank Everything You Have Built

A read-only two-pass parallel sweep that discovers, catalogs, and ranks every project or sketch on your machine by novelty and leverage. Helps you find forgotten projects that are worth continuing or extracting ideas from. Good for developers with many scattered experiments who want an inventory.

skilldiscoveryprojectsrankingproductivityclaude-code
by 88plug Jul 18, 2026 6/10
skill GitHub

forge-skills: Document-Driven AI Dev Framework With 14 Skills

A document-driven AI development framework with 14 skills covering the full cycle from brainstorm through PRD, design, engineering, QA, review, shipping, and retrospective. Bilingual (English/Chinese). Provides a complete structured process for product development using AI agents.

skillworkflowproduct-developmentTDDPRDclaude-code
by yike-gunshi Jul 18, 2026 7/10
skill GitHub

senior-engineering-partner: Stack-Agnostic Code Review and Mentorship Skill

A stack-agnostic Claude Code skill acting as a strict code reviewer, pair programmer, debugger, and mentor for Python, Bash, Apps Script, and JavaScript. Security-first with a spec→plan→TDD→verify workflow and phase-aware engineering discipline. Useful for solo developers who want a senior engineer perspective on their work.

skillcode-reviewmentorshipTDDsecurityclaude-code
by bjgreenberg Jul 18, 2026 7/10
skill GitHub

Claude-Code-CyberSecurity-Skill: 15 Skills for Security Professionals

A comprehensive collection of 15 Claude Code skills for cybersecurity professionals covering offensive security, defensive operations, reverse engineering, threat hunting, CSOC automation, and more. Built for practitioners who want AI-assisted security workflows. Covers the full security operations lifecycle.

skillsecuritycybersecurityoffensivedefensiveclaude-code
by Masriyan Jul 18, 2026 7/10
skill GitHub

open-zk-kb: Zettelkasten-Based Shared Memory for AI Assistants

A shared, persistent memory system for AI assistants built on the Zettelkasten method — creates interconnected notes with backlinks rather than isolated memory entries. Implements slip-box-style knowledge management that grows more useful as your agent adds to it. Useful for research-heavy workflows.

memoryzettelkastenknowledge-baseAI-assistantspersistent
by mrosnerr Jul 18, 2026 6/10
skill GitHub

app-store-review-skill: Audit iOS Apps Before App Store Review

A Claude Code skill for auditing iOS and iPadOS apps before App Store Review, recovering from rejections, and catching low-effort craft signals that reviewers flag. Helps developers pass App Store review faster by catching common rejection reasons before submission.

skilliOSapp-storereviewauditmobile
by ElxMaj Jul 18, 2026 6/10
skill GitHub

AI-SKILLS: Plug-and-Play Skills for All AI Coding Agents

A comprehensive plug-and-play collection of AI skills and prompts for Claude Code, Claude Desktop, Cursor, Antigravity, OpenAI Codex, Gemini CLI, and every major AI coding agent. All in portable SKILL.md format with a browser-based Prompt Builder. Single repository that works everywhere.

skillscross-agentportableSKILL.mdpromptsclaude-code
by Amey-Thakur Jul 18, 2026 7/10
skill GitHub

scientific-method: Falsification-First Workflow for Claude Code

A falsification-first investigation and invention workflow for Claude Code featuring hypothesis ledgers, controlled experiments, REFUTE-first verification, and provable invention. Encodes the scientific method into an agent skill so Claude approaches problems empirically rather than jumping to conclusions.

skillscientific-methodhypothesisverificationclaude-code
by 88plug Jul 18, 2026 7/10
skill GitHub

drive-remote-terminal: Drive a Remote TUI Over SSH From Claude Code

A skill for driving an interactive full-screen TUI on a remote machine over tmux/screen + SSH using a type-wait-screenshot-read loop. Enables Claude Code to operate remote applications that do not expose an API. Useful for AI-assisted sysadmin tasks on remote machines with terminal-only interfaces.

skillremoteSSHTUItmuxautomationsysadmin
by 88plug Jul 18, 2026 7/10
skill GitHub

skill-x: Open-Source Agent Skills for Claude Code and Other Agents

Open-source agent skills for Claude Code, Codex, GitHub Copilot, and other coding agents — features GPT-5.6-style rigor, delegation patterns, linear probes, and self-evolving workflows. A general-purpose skill collection that covers common development tasks across multiple agent runtimes.

skillsclaude-codecodexcopilotopen-source
by anshmajumdar121 Jul 18, 2026 6/10
skill GitHub

skills-runtime: Minimal Agent Skills Runtime from the Google Whitepaper

A minimal Agent Skills runtime implementing the Google/Kaggle whitepaper pattern behind Claude Skills — folders of SKILL.md, cheap catalog routing, progressive disclosure, and bundled deterministic scripts. Also runs free local Ollama models. Good for understanding how Claude Code skills work under the hood.

skillsruntimeskill.mdclaude-codeollamawhitepaper
by syedahmad0786 Jul 18, 2026 7/10
skill GitHub

cman: Agentic Memory for Claude Code

A lightweight agentic memory system specifically for Claude Code that gives your agent persistent recall across sessions. Simple to set up with minimal dependencies. Good starting point for users who want session memory without the complexity of a full MCP-based solution.

memoryclaude-codepersistenceskill
by laiso Jul 18, 2026 6/10
skill GitHub

recover-from-false-positive: Recover Claude Sessions After Classifier Blocks

A tool for recovering Claude Code sessions after an Anthropic API output-classifier false positive. JSON-aware JSONL log surgeon that removes the triggering message and refusal turn, re-stitches the parent UUID chain so the session resumes cleanly. Also installs a per-repo CLAUDE.md framing guard.

recoveryfalse-positivesessionjsonlclaude-codeCLAUDE.md
by 88plug Jul 18, 2026 7/10
skill GitHub

trigger-my-training: Ground-First Reflex Skill for Claude Code

A skill that makes Claude Code judge task complexity from its own training and ground itself before acting — then hard-blocks the irreversible step until grounding is complete. Prevents rushed execution on complex tasks by enforcing a think-first gate. Useful for high-stakes automated workflows.

skillsafetygroundingclaude-codecomplexity
by 88plug Jul 18, 2026 6/10
skill GitHub

total-recall: Cross-Session, Cross-CLI Memory for AI Coding Assistants

Cross-session, cross-CLI memory for AI coding assistants with data-driven operator discovery from your own transcripts. Includes 23 MCP tools, 5 hooks, 15 commands, and 8 CLI adapters. One of the most comprehensive memory systems available for Claude Code users who switch between tools.

memorycross-sessionmcphooksclaude-codetranscripts
by 88plug Jul 18, 2026 8/10
skill GitHub

lore: Capture Non-Obvious Learnings While Coding, Auto-Recall Next Time

A plugin for Claude Code and Codex that captures non-obvious learnings as you code and automatically recalls relevant ones the next time you hit a similar situation. Builds a personal knowledge base of hard-won insights without requiring you to manually document them. Passive and lightweight.

memorylearningskillclaude-codecodexknowledge-base
by aoc81 Jul 18, 2026 8/10
skill GitHub

speedread-skill: RSVP Reader for AI Codebase Reports

An agent skill plus a one-file RSVP reader for markdown reports — your AI agent reads the codebase and you speedread the report using rapid serial visual presentation. Makes consuming long AI-generated codebase analysis much faster. Useful for large codebases where the analysis output itself is substantial.

skillreadingRSVPcodebasereportsproductivity
by jordan-gibbs Jul 18, 2026 6/10
skill GitHub

supskill: Sprint Conductor for Claude Code From Backlog to Merged Branch

A sprint conductor skill for Claude Code that drives one sprint from a markdown backlog to a merged branch — fresh context per stage, three human gates, all state stored on disk. Provides structure for multi-day or multi-session sprints without losing progress. Inspired by physical sprint ceremonies.

skillsprintworkflowbacklogclaude-codegit
by bessavagner Jul 18, 2026 7/10
skill GitHub

rails-consultant: Skills for Rails Development and Consulting

A collection of Claude Code skills for Rails development and consulting with emphasis on learning, communication, and client success. Built by the thoughtbot team with production Rails consulting experience. Useful for Rails developers who want battle-tested patterns encoded into skills.

skillrailsrubyconsultingthoughtbotdevelopment
by thoughtbot Jul 18, 2026 6/10
skill GitHub

wheel-to-talk: Voice-to-Text for Claude Code via Middle Mouse Button

Hold the middle mouse button to dictate voice-to-text input into Claude Code on Windows. A zero-friction way to add voice input without switching apps or using hotkeys. Useful for accessibility or for users who prefer speaking prompts over typing.

voiceinputwindowsclaude-codeaccessibilityplugin
by Pr1m4lc0d3 Jul 18, 2026 7/10
skill GitHub

memroos: Memory OS and Governance Layer for AI Agent Workflows

A memory OS and governance layer for AI agents covering workflows, dispatch, proof, and context continuity. Provides structured memory management that goes beyond simple file storage to include governance policies and proof mechanisms. Useful for teams building auditable AI workflows.

memorygovernanceAI-agentsworkflowcontext
by lac5q Jul 18, 2026 6/10
skill GitHub

dotnet-senior-skills: Senior .NET Review Rules for AI Coding Agents

A collection of senior-level .NET review rules for AI coding agents compiled from a single source into Claude Code skills, Cursor rules, and Copilot instructions. Covers Spring AI, threading, performance, and security patterns. Useful for .NET teams who want consistent, expert-level code review across their AI tools.

skilldotnetcode-reviewclaude-codecursorcopilot
by Sarmkadan Jul 18, 2026 6/10
skill GitHub

mkpub: Generate the Four Files Every Public Repo Needs

Generates README.md, LICENSE.md, SECURITY.md, and llms.txt from a scan of your repo — never inventing facts, no guessed licenses, no fabricated benchmarks. A Claude Code skill with 8 modes, 7 protocols, and 4 bundled figlet fonts. Solves the tedious task of writing accurate public-facing repo documentation.

skilldocumentationreadmelicensesecurityllms.txt
by ndisisnd Jul 18, 2026 7/10
skill GitHub

quality-loop: AI Reviews, Scores, Revises, and Blind-Checks Its Own Work

A quality pipeline skill for Claude Code where the AI reviews, scores, revises, and blind-checks its own output before delivering it to you. Implements a structured self-review loop that catches common mistakes the model would otherwise miss. Particularly useful on high-stakes outputs where a second pass matters.

skillqualityself-reviewclaude-codepipeline
by gavinzzc Jul 18, 2026 7/10
skill GitHub

research-kit: Shared Infrastructure for AI-Assisted Research Workflows

Shared infrastructure for AI-assisted research workflows including Claude Code skills, conventions, methodology documents, and tools. Provides a structured starting point for researchers using AI coding agents in academic or analytical work. Designed to be composable with other skill sets.

skillresearchacademicworkflowclaude-code
by hsigstad Jul 18, 2026 6/10
skill GitHub

ultra-goal: Multi-Agent Orchestration Skill for Unattended Long Tasks

A multi-agent orchestration skill for Claude Code designed for unattended, long-running engineering tasks. Manages task delegation, coordination, and completion across multiple sub-agents without requiring a human to stay in the loop. Useful for overnight or weekend agent runs.

skillmulti-agentorchestrationunattendedclaude-code
by Azure99 Jul 18, 2026 7/10
skill GitHub

modelese: Lexicon and Linter for AI-Generated Jargon

A lexicon, linter, and rewrite gate for the private dialect AI coding agents develop on long runs — scores, blocks, and rewrites AI jargon into plain language. CC0 dictionary so anyone can contribute. Addresses the real problem of model outputs becoming increasingly opaque and unreadable over long sessions.

skilllinterjargonlanguagequalityclaude-code
by YunyueLi Jul 18, 2026 6/10
skill GitHub

skill-scout: Evaluate Claude Code Skill Repos Before Installing

A skill that acts as your CTO for evaluating AI skill repos — paste a link, get a straight verdict: install it, cherry-pick parts, or skip it entirely. Reads every file in the repo so you do not have to evaluate raw skill quality yourself. Saves time when browsing the growing skill ecosystem.

skillevaluationcode-reviewclaude-codecuration
by wallmage Jul 18, 2026 7/10
skill GitHub

mif-docs-plugin: Skill Suite for All Major Documentation Genres

A MIF-first documentation skill suite for Claude Code covering eight document genres: Diataxis, ADR, RFC/PEP, runbook, PRD, Kiro, arc42/C4, and changelog. Implements structured documentation from MIF Level 1 to Level 3. Provides one skill per genre so you can generate well-structured docs without switching tools.

documentationskillclaude-codeadrrunbookprd
by modeled-information-format Jul 18, 2026 7/10
skill GitHub

skills: Daily-Driver Coding-Agent Skills Managed with the vd CLI

A curated daily-driver collection of skills for agentic coding, managed with the vd CLI tool. Designed to be portable and agent-agnostic so the same skills work across different AI coding assistants. The companion vd CLI makes it easy to install, update, and manage skills as versioned packages.

skillsclaude-codecodexvd-cliportable
by vanducng Jul 18, 2026 7/10
skill GitHub

llm-wiki-template: Knowledge Base Your AI Agent Maintains for You

A domain-agnostic LLM-wiki template for Claude Code where the AI agent maintains and updates the knowledge base as you work. MIT licensed, it gives your agent a living reference document that stays current without manual upkeep. Solves the problem of context files drifting out of date.

memoryknowledge-baseclaude-codecontextskill
by JX-29 Jul 18, 2026 6/10
skill GitHub

mckinsey-style-visualization-skill: Strategy Visuals From Notes

An agent skill that turns messy notes into rendered strategy-consulting-style visuals with SVG output and validation. Produces McKinsey-style charts and frameworks from plain text input. Useful for product managers, consultants, and analysts who want polished visualizations without manual design work.

skillvisualizationSVGstrategyconsulting
by kgraph57 Jul 18, 2026 6/10
skill GitHub

dumb-it-down: Plain-Language Rewriter for Dense Agent Plans

An agent skill that translates dense coding-agent plans into plain, decision-focused language with everyday analogies. Strips jargon and technical framing while keeping the stakes clear so non-technical stakeholders can follow along. Useful when you need to communicate AI-generated plans to a broader audience.

skillcommunicationplanninglanguagesimplification
by breadoncee Jul 18, 2026 6/10
skill GitHub

concilium: Cross-Model Adversarial Review With GPT Probing

A cross-model adversarial review skill for Claude Code where Fable orchestrates and GPT (via Codex CLI) probes for weaknesses. Verdicts are ratified through a structured disagreement process. Works without an API key using your ChatGPT subscription, making multi-model code review accessible.

code-reviewmulti-modeladversarialskillclaude-codegpt
by raichominev Jul 18, 2026 7/10
skill GitHub

shape-plan: Turn Vague Needs Into Bounded, Execution-Ready Plans

A universal agent skill that converts vague requirements into structured, bounded, execution-ready plans. Optimized for Codex but works across agent runtimes including Claude Code. Helps avoid the common problem of agents building in the wrong direction because the spec was underspecified.

skillplanningspeccodexclaude-code
by xscanzm Jul 18, 2026 6/10
skill GitHub

build-better-skills: Suite of Skills for Creating Better Skills

A meta-skill suite for building better Claude Code skills — covers creation, installation, auditing, releasing, regression testing, and sediment removal. Provides a structured lifecycle for skill development so your skills do not rot over time. Essential for anyone building and maintaining a skill library.

skillmetadevelopmentlifecycletestingclaude-code
by Songhonglei Jul 18, 2026 7/10
skill GitHub

claude-code-starter-kit: Discipline and Security Starter Kit for Claude Code

A starter kit that keeps Claude Code on course across sessions with repo-based memory that survives context compaction, enforced hooks and permissions, and a phased workflow. Designed for teams who want consistent, traceable, secure AI coding sessions. Can be cloned standalone or installed as a plugin.

starter-kitsecurityhooksmemoryclaude-codeworkflow
by muratsilahtaroglu Jul 18, 2026 8/10
skill GitHub

session-save-system: Four /session Commands for Claude Code

Provides four slash commands for Claude Code — tag, save, summary, and audit — that rename messy AI chats and remember what they did. Stores session records as plain markdown on your Desktop so you can find past work without digging through JSONL files. Simple and zero-dependency.

skillsessionmemoryclaude-codecommandsmarkdown
by youkistudios Jul 18, 2026 7/10
skill GitHub

ai-academic-workflow: 30 Step-Level Skills for the Full Academic Research Lifecycle

Thirty modular skills covering the full academic research workflow — topic selection, literature search and analysis, research design, data analysis, and full draft writing. Each skill can run independently or be composed into pipelines; works with Claude Code and Codex.

academicresearchskillsworkflow
by qiaomiaojoe Jul 17, 2026 5/10
skill GitHub

SKILLmama: Rank and Score the Best Library or SDK for Your Exact Stack

Five-tier search that finds, scores, and ranks the best library for your specific tech stack with deterministic scoring and a built-in security gate. No Reddit threads or outdated blogs — works with Claude Code, Claude.ai, Codex, and Antigravity.

skilllibrariesscoringdiscovery
by Magithar Jul 17, 2026 7/10
skill GitHub

clud-bug: Claude PR Review Bot That Cites Your Team's Markdown Standards

Encodes team standards (brand voice, API contracts, compliance, test discipline) as Markdown skills that the bot cites by name on every PR review. One-command setup via npx and project-aware without requiring a custom integration.

pr-reviewskillteamstandards
by thrillmade Jul 17, 2026 7/10
skill GitHub

obsidian-vault-skills: Author Claude Code Skills as Obsidian Notes, Export as Plugin

Write Claude Code skills and agents as notes in an Obsidian vault using Johnny Decimal organization, then export them to a native Claude Code plugin via an Obsidian plugin and MCP server combo. Brings all the linking and search of Obsidian to skill authoring.

obsidianskillpluginorganization
by nelsonlove Jul 17, 2026 8/10
skill GitHub

totem: Plain-File Rules, State, and Context for Any Coding Agent

Stores rules you can enforce, state you can derive, and context you can query as plain files in your repo — compatible with any coding agent. Agent-agnostic alternative to proprietary memory formats that works via standard file reads.

rulesstatecontextagent-agnostic
by mmnto-ai Jul 17, 2026 7/10
skill GitHub

handoff-skill: Project-Neutral Context Transfer Between AI Sessions

Portable skill for handing off working context between AI sessions with a strict single source of truth. Works across any project and any agent. Useful for maintaining continuity when hitting context limits or switching agents.

skillcontexthandoffsession
by uchimata2 Jul 17, 2026 7/10
skill GitHub

agent-skill-description-optimizer: Auto-Improve Claude Skill Trigger Descriptions

Optimizes the description frontmatter of Claude Code skills — the text Claude uses to decide whether to invoke the skill. Both evaluation and improvement run through the claude -p CLI so no API key is required. Helps skills fire reliably without manual tuning.

skilloptimizationdescriptionautomation
by netopsengineer Jul 17, 2026 8/10
skill Reddit

Overdrive: Open-Source Setup With 160 Skills, Skill Router, and Cross-Session State

Overdrive is a one-command installer that packages 160 curated skills (each pinned to a reviewed commit with licenses checked), a custom skill router that loads only what the current task needs, global instructions adapted from Karpathy's Claude prompt, and a .overdrive/ project state system that persists decisions and progress across sessions. Works with Claude Code, Codex, Gemini CLI, Cursor, and Antigravity.

skillssetupskill-routerstate-managementworkflow
by StefanDumitru Jul 16, 2026 8/10
skill GitHub

humanize-code: Strip AI-Tells From Code With 16 Research-Backed Pattern Detectors

A Claude Code skill that identifies and removes 16 specific patterns that mark code as AI-generated, making the output read as human-authored. Research-backed detection of AI coding tells, designed to be model-agnostic. Aimed at developers who need to blend AI-generated code into existing codebases without stylistic friction.

skillcode-styleai-detectionhumanize
by avi-dev-user Jul 16, 2026 6/10
skill Reddit

Think Before Code: 8-Skill Socratic DSA Tutor That Refuses to Solve for You

Think Before Code is a suite of 8 Claude Code skills turning the agent into a Socratic DSA tutor — one focused question at a time, graduated hints, required manual dry runs, and refusal to replace the learner's code during debugging. Covers problem decoding, dry runs, debugging, complexity analysis, test design, pattern transfer, and mock interviews. Drop a skill directory into Claude Code or paste the SKILL.md.

skillsdsatutoringlearningsocratic
by Agitated_Crew_368 Jul 16, 2026 7/10
skill GitHub

google-jules-skill: Control Google Jules Sessions via REST API From Coding Agents

A skill and CLI that lets LLM agents (Claude Code and others) manage Google Jules coding sessions via REST API — checking status, sending instructions, retrieving reports, merging results, and closing sessions. Useful for orchestrating Jules as a sub-agent in a larger multi-agent workflow from Claude Code.

skillgoogle-julesrest-apimulti-agentorchestration
by Laurenfeminine36 Jul 16, 2026 6/10
skill GitHub

legal-ops-germany: Claude Code Skills for German Law Firm Non-Billable Work

An experimental toolkit using Claude Code skills and deterministic Python executors to handle non-billable administrative work at German law firms — tasks that consume associate time without generating revenue. Demonstrates domain-specific Claude Code applications in a regulated professional context. Not intended for legal advice.

legalskillsgermanylaw-firm
by eliasreiche Jul 16, 2026 5/10
skill GitHub

product-playbook: 18-Command Guided Pipeline From Idea to Shipped Product

product-playbook is a principle-driven Claude Code skill set with 18 sequential commands covering each phase of product development, from initial spec through shipping. Evidence-based gates between phases prevent skipping steps or drifting off track. Designed to keep both the developer and the AI disciplined through the full build cycle.

skillsproductworkflowpipelinediscipline
by kish21 Jul 16, 2026 7/10
skill GitHub

trigger-flare: AI-Powered Signal Triage Skill for Claude Code

A Claude Code skill that acts as a signal radar, applying smart triage to prioritize and filter incoming signals. Useful for teams managing high-volume information streams that need intelligent routing before action. Targeted specifically at Claude Code workflows with AI-driven categorization.

signal-triageskillautomationfiltering
by Kaydevi Jul 16, 2026 5/10
skill Reddit

consolidate-permission-prompts: Clean Up Redundant Claude Code Allowlist Rules

A Claude Code skill that scans your permissions.allow list, identifies every rule already covered by a broader one, and removes the redundant entries without narrowing what is actually allowed. Addresses the common problem of allowlists growing to hundreds of dead rules over time — particularly WebFetch per-domain rules made pointless by a single wildcard. Pairs with the built-in /fewer-permission-prompts, which stops future bloat.

skillpermissionscleanupallowlistmaintenance
by Myth_Thrazz Jul 16, 2026 8/10
skill GitHub

blindfleck: Adversarial Review Skill for Offers, Pitches, and Strategy Docs

A Claude Code skill that simulates the toughest skeptical reader for business documents — offers, pitches, and strategy docs. It maintains a memory of where your writing has historically been weak and targets those areas first in each review. Produces critical, adversarial feedback rather than encouraging polish.

skillwritingadversarialdocument-reviewstrategypitches
by FermainPariz Jul 16, 2026 6/10
skill GitHub

claude-config: Centralized Memory, Skills, and Agents with One-Command Install

A Claude configuration framework that centralizes memory files, skills, and agent definitions in a single versioned repository with a one-command installer. Lets you maintain a personal or team Claude setup that can be reproduced on any machine in seconds. Covers CLAUDE.md, skill files, and agent prompts in a structured layout.

configskillsmemoryagentsversionedinstall
by RemiAsselin42 Jul 16, 2026 6/10
skill Reddit

Closeout Skill: Session Audit with Claim Verification and Cold Review Agent

A Claude Code skill that runs at the end of each session: verifies all factual claims made during the session, greps for loose ends in the written code, produces a handoff.md, and then spawns a cold review agent to audit all of it independently. Designed to catch the common pattern of an agent hallucinating success — including catching a prior Opus session going off-rails.

skillsession-auditclaim-verificationhandoffquality-controlreview
by Mammoth_Pain2075 Jul 16, 2026 7/10
skill Reddit

react-native-boost: Claude Code Skill Covering Real App Store and EAS Build Gaps

A Claude Code skill filling what agents typically miss in React Native: exact App Store Connect and Google Play field character limits, correct EAS Build profiles, iOS vs Android permission configs side by side, and fixes for 8 common terminal errors. Works with Claude Code, Cursor, and Windsurf.

react-nativeskillsapp-storeeas-buildiosandroid
by Direct-Attention8597 Jul 16, 2026 8/10
skill Reddit

Anti-Sycophancy Skill: Makes Claude Argue Against You Before Answering

A free skill that forces Claude Code to try to prove you wrong before it gives you an answer. Counters the "you're absolutely right!" problem where Claude agrees too readily, turning 3-hour decision debates into minutes.

sycophancyskillscritical-thinkingreasoning
by AccomplishedCut6374 Jul 16, 2026 7/10
skill Reddit

Drive a macOS Desktop From a Linux AI Agent Over SSH Using Tart VMs

A write-up and skill set for connecting a Linux AI agent to a macOS machine via SSH to boot Tart VMs, take screenshots, click, type, and record video — enabling macOS-specific testing (Gatekeeper, TCC prompts) from a Linux agent. Uses a one-seam CLI design with stdout for data and stderr for logs.

macosvmtartsshskillstestinglinux
by jonnyzzz Jul 16, 2026 7/10
skill GitHub

ruleferry: Audit and Sync Coding-Agent Instruction Files Across Tools

Safely audits and synchronizes coding-agent instruction files (CLAUDE.md, AGENTS.md, .cursorrules, etc.) across Codex, Claude Code, Cursor, Copilot, Gemini CLI, and OpenCode. Keeps your rules consistent when using multiple coding agents on the same project.

AGENTS.mdCLAUDE.mdsyncrulesmulti-tool
by starinzlob Jul 16, 2026 7/10
skill GitHub

e5-real-skills: B2B Marketing Claude Skills From Exit Five Podcast

A living library of B2B marketing Claude skill files built from expert insights on the Exit Five podcast. Auto-updates with new episodes — practical marketing skills sourced directly from practitioner-level discussions.

marketingb2bskillspodcastauto-update
by the-nam-shub Jul 16, 2026 5/10
skill GitHub

agent-os: Lifecycle-First OS for AI-Assisted Engineering and Research

A lifecycle-first operating system for AI-assisted engineering, architecture, research, UX, infrastructure, and decision-making. Provides a unified framework for managing the full agent-assisted software development lifecycle.

operating-systemlifecycleengineeringresearchskills
by ignazio-ingenito Jul 16, 2026 7/10
skill GitHub

secure-code-auditor: Backend Security Audit Agent Skill With Deep Django Coverage

A backend security Agent Skill that helps AI audit code for vulnerabilities and generate secure-by-default backend applications. Provides deep Django/DRF coverage and guidance for other backend stacks — covers OWASP and common injection patterns.

securityauditdjangobackendskillsowasp
by n-shadloo Jul 16, 2026 7/10
skill GitHub

ai-tools-cheatsheets: Open-Source Handbook for AI Coding Tools and MCP Servers

A comprehensive open-source handbook covering AI coding tools, coding agents, MCP servers, AGENTS.md, prompts, engineering workflows, security, and team adoption. A reference resource for teams adopting AI-assisted development.

referencemcpAGENTS.mdsecurityteamhandbook
by AnkitParekh007 Jul 16, 2026 7/10
skill GitHub

skillwarden: npm audit for Agent Skills — Pin, Verify, and Audit-Gate

Like npm audit but for agent skills: pins skills to verified versions, verifies integrity, and gates execution through audit checks. Prevents unreviewed or tampered skills from running in your Claude Code sessions.

securityauditskillspinningintegrity
by FirstCastSolutions423 Jul 16, 2026 7/10
skill GitHub

balloontopic: Persistent Context Manager for Multi-Feature AI Development

A persistent context manager for multi-feature development with AI coding agents (Cursor, Claude Code, Codex). Maintains structured context across sessions so agents stay oriented on the right feature when context switches.

contextpersistencemulti-featureclaude-codeskills
by radhakishan404 Jul 16, 2026 6/10
skill GitHub

agentcairn: Long-Term Cross-Project Memory Using Your Obsidian Vault

Provides long-term, cross-project memory for AI coding agents using your Obsidian vault as the source of truth. Daemonless, no opaque databases — your memory files are plain Markdown you own and can edit directly.

memoryobsidiancross-projectlong-termlocal-first
by ccf Jul 16, 2026 8/10
skill GitHub

inverter: Turn Short Prompts Into Principal-Level Engineering Directives

Inverts short, unpolished prompts into Principal-level engineering directives aligned to the right discipline, then executes them. Built for vibe coders and lazy prompters who want better output without writing detailed prompts themselves.

promptsskillsengineeringclaude-codecodex
by Wishmeh Jul 16, 2026 7/10
skill GitHub

target-prioritization: Drug-Target Due Diligence Multi-Source Skill

A multi-source drug-target due diligence pipeline for biomedical research: takes a ranked gene list and generates per-gene dossiers across UniProt, OpenTargets, and PubMed with cross-lineage DE scanning and composite re-ranking. A Claude Code/OpenClaw/SkillsMP skill.

biomedicalresearchskillsdrug-discoverymcp
by Agents365-ai Jul 16, 2026 5/10
skill GitHub

ariadne: Agent Skills for Scope-Safe Markdown Knowledge Vaults

Open-source agent skills for building Markdown knowledge vaults with deterministic validation and research workflows. Keeps knowledge bases scope-safe and structured for AI agent use.

knowledge-basemarkdownvaultskillsresearch
by pariyar07 Jul 16, 2026 6/10
skill GitHub

prefix-first-design: Session Framework for AI-Assisted Design Decisions

A structured session framework for AI-assisted design: casts a stable brief first, then explores against it, and ships decisions alongside the work with a check that the original brief still holds. Prevents design drift during long agent sessions.

designframeworkskillsbriefsessions
by iruhdam1 Jul 16, 2026 5/10
skill GitHub

agent-harness: 14 Risk-Gated Claude Code Skills for Full Delivery Lifecycle

Fourteen invocable skills that carry a change from brainstorm through shipping, with an embedded harness deciding how careful to be at every step based on risk assessment. Provides a structured, risk-aware workflow for feature delivery.

skillsrisk-gatesdeliveryworkflowclaude-code
by minhtran3124 Jul 16, 2026 7/10
skill GitHub

textbook-writer-skills: UbD Reverse-Design Textbook Writing for AI Agents

A skill suite for writing STEM textbooks using Understanding by Design (UbD) reverse-design methodology. Guides agents through teaching positioning, chapter tree gating, chapter-by-chapter writing, and verified example calculation — with interrupt-and-resume support.

educationtextbookskillsstemwriting
by cabbage2000-lab Jul 16, 2026 5/10
skill GitHub

styleseed: Design Engine for Claude Code With 74 Rules and 7 Brand Skins

Teaches design judgment to Claude Code, Codex, and Cursor — not just data. Includes 74 rules, 48 components, 7 brand skins (Toss/Stripe/Linear/Notion/Raycast/Arc/Vercel), a named motion system, and 15 /ss-* skills to stop shipping AI-generated-looking UI.

designuiskillsbrandcssfrontend
by bitjaru Jul 16, 2026 8/10
skill GitHub

ai-app-cloner: Clone a Mobile App Into Expo/React Native From Screenshots

An open-source Claude Code skill that takes screenshots of an existing mobile app and generates a working Expo/React Native project from them. Useful for rapid prototyping and learning from existing UI patterns.

mobilereact-nativeexposkillsclone
by Birkenpapier Jul 16, 2026 7/10
skill Reddit

Lessons Learned Running Claude Code Loops: Docs, Skills, Hooks, and DAGs

A practitioner shares key insights from extended Claude Code use: always document before running loops, use DAGs for structured task flows, build custom hooks for prompt validation and memory injection, and treat prompt engineering as a multi-hour collaborative project. Includes specific skill examples for session behavior.

best-practicesloopsskillshooksdags
by Competitive-Net-5306 Jul 16, 2026 7/10
skill Reddit

Skill Ordering and Priority Conflicts in Stacked Claude Code Skills

Discussion of how Claude Code handles skills that conflict on ordering — specifically when two skills both want to run "first." Raises the question of priority resolution and unpredictable behavior when multiple skills install competing step-zero instructions.

skillsorderingconflictsbest-practices
by NoBarber4287 Jul 16, 2026 5/10
skill Reddit

Claude Code as Solo Founder Project Manager: Kanban Skill With Memory

A kanban skill for Claude Code that converts rough goals into structured tasks, does keyword research for content, learns from feedback via auto-pruning memory, and generates daily prioritization reports. Built for solo founders managing product, marketing, and engineering in one agent loop.

kanbanskillsmemoryproductivitysolo-founder
by void_tao Jul 16, 2026 7/10
skill GitHub

research-cards: Teaching-Style Research Automation for Claude Code

Automates research card creation in the style of Hung-yi Lee — supports plain Markdown, Obsidian, and Heptabase backends with bidirectional sync. Driveable by Claude Code or Codex for systematic academic and technical research workflows.

researchobsidianskillsknowledge-management
by SungFeng-Huang Jul 16, 2026 7/10
skill GitHub

market-intel: Claude Code Skill for Commercial and Market Research

A thin Claude Code skill that triages 15 specialized data domains and auto-configures the right MCP sources for market intelligence. Includes a deterministic refresh pipeline with adversarial verification, companion-config auto-registration, and citation guardrails.

market-researchskillsmcpdata
by DaizeDong Jul 16, 2026 7/10
skill GitHub

skillstead: Practical Portable Skills for Agentic Coding Workflows

A curated collection of practical, portable skills designed for agentic coding workflows. Focused on real-world utility that transfers across different projects and coding agent environments.

skillsportablecoding-workflows
by kyungseo Jul 16, 2026 6/10
skill GitHub

jaimitos-claude-setup: Lean Project-Neutral OS for Claude Code

A lean, project-neutral operating system for Claude Code featuring auto-maintained docs, deterministic hooks, an independent evaluator, watchable and headless autopilots, and portable skills. Designed for solo engineers who want a structured, reusable Claude Code baseline.

claude-codesetuphooksskillsautopilot
by jaimeberdejo Jul 16, 2026 8/10
skill GitHub

tradeos-marketplace: AI-Strategist to Live-Trading Plugin for Claude Code

A Claude Code plugin that connects AI strategy generation to backtesting and live trading. Enables coding agents to participate in the full trading development loop — from strategy ideation through execution.

tradingskillsbacktestingfinance
by multiwave-co-ltd Jul 16, 2026 6/10
skill GitHub

agent-skills (itsgitz): Personal Claude Code Skill Collection

A personal skill collection compatible with any AI agent that supports ~/.agents skills, including Claude Code, Cursor, and OpenCode. Covers common coding, automation, and workflow tasks.

skillsportableclaude-codecursor
by itsgitz Jul 16, 2026 5/10
skill GitHub

agent-foundation: Claude Code Skills Marketplace for Backend and Frontend

A skills marketplace with backend and frontend engineering conventions plus step-by-step integration recipes for Stripe, Singpass/Keycloak OIDC, Twilio SMS, Docker, and CI/CD. Covers NestJS/TypeScript and React in a language-flexible format.

skillsbackendfrontendintegrationsnestjsstripe
by kennguyen887 Jul 16, 2026 7/10
skill GitHub

presentation-skill-pack: Turn Notes into Slide Decks via Claude Code

A skill + MCP server that converts rough notes into schema-validated slide decks and exports native PowerPoint, Keynote, and Google Slides. Works with Claude Code, Cursor, Codex, Gemini CLI, and Copilot — letting any AI agent produce presentation-ready output.

skillmcppresentationspowerpointkeynotegoogle-slides
by isatimur Jul 16, 2026 7/10
skill GitHub

trackbed: Skills-Only Roadmap and Orchestration Layer for Claude Code

trackbed provides roadmap, status, and orchestration as pure agent skills — no framework required. Works with Claude Code, OpenCode, and GitHub Copilot CLI. Keeps the project management rails lightweight and portable across AI coding tools.

skillsroadmaporchestrationproject-management
by Orfi Jul 16, 2026 6/10
skill GitHub

generate-wiki: Agent Skill That Builds a PR-Traceable Architecture Wiki

An agent skill that generates and refreshes an internal architecture wiki with decisions anchored to source files and PRs. Works with Claude Code and any agent supporting the Agent Skills format. Keeps documentation in sync as the codebase evolves.

skillwikidocumentationarchitecturepr-tracking
by sirius-zuo Jul 16, 2026 7/10
skill GitHub

ai-research-writing-skill: Agent Skill for ML Paper Writing from Code and Experiments

An agent skill for ML/AI/CV/NLP researchers: point your coding agent at code, experiment logs, and a venue template to produce an evidence-backed LaTeX draft and submission package. Focused on auditable, evidence-backed output rather than generated fiction. Works with Claude Code and compatible agents.

skillresearchlatexmlacademic-writingpaper
by jin-s13 Jul 16, 2026 7/10
skill GitHub

agentic-flake: Composable Agent Skills and Nix Environments

Composable agent skills paired with project-scoped Nix environments. Provides reproducible, hermetic dev environments alongside agent skills — useful for teams that use Nix and want both reliable toolchains and agent workflow conventions in one package.

skillnixenvironmentsreproduciblecomposable
by 0xc000022070 Jul 16, 2026 7/10
skill GitHub

Server-Side Swift Skills and Xcode Cloud Knowledge Files for Claude Code

Curated knowledge files that accelerate server-side Swift development and Xcode Cloud automation when used with Claude Code. Brings Claude Code up to speed on Vapor, SwiftNIO, and Xcode Cloud conventions without repeated context-setting.

skillswiftserver-side-swiftxcode-cloudvaporknowledge-files
by Insolvent-pyrene754 Jul 16, 2026 6/10
skill GitHub

hermes-CCC: Hermes Agent Skills Natively Inside Claude Code

Integrates Hermes Agent skills directly into Claude Code for in-process agentic operations — no external process spawning or file locking. Lets Claude Code use Hermes-format skills as native first-class capabilities.

skillhermesintegrationagenticin-process
by Arseni6361 Jul 16, 2026 7/10
skill GitHub

slowmist-security-cc: Security Audit Framework for Claude Code Agents

A skill-based security framework for auditing Claude Code agents in adversarial environments. Detects vulnerabilities, social engineering attempts, and supply chain threats in agent sessions — based on SlowMist's security research methodology.

securityauditskilladversarialsupply-chainslowmist
by Leontynestirredup43 Jul 16, 2026 7/10
skill GitHub

zenodo-skill: Manage Research Artifacts and DOIs from Claude Code

A skill for managing Zenodo research artifacts directly from Claude Code or OpenClaw: automate deposits, generate citable DOIs, and manage research data releases through the Zenodo REST API.

skillzenodoresearchdoiacademicapi
by Georgiannebedded725 Jul 16, 2026 6/10
skill GitHub

hikizan: Verb-Split Claude Code Skills for Design, Review, TDD, and PR Flow

A Claude Code plugin and Agent Skills pack that separates concerns by verb: distinct skills for design, review, TDD, and PR flow. Backed by deterministic git hooks as safety floors — so conventions are enforced even if the agent skips reading the skill.

skilltddcode-reviewgit-hookspr-flowdesign
by hayashiii-ghub Jul 16, 2026 8/10
skill GitHub

sheet-happens: Claude Skill for Auditing Inherited Excel Models

A Claude skill that maps inherited Excel models into an interactive HTML showing how every sheet, block, and line item connects — plus an audit of hardcodes, error cells, and circular references. Invoke with /sheet-happens in any chat, or ask naturally. Runs fully locally.

skillexcelauditspreadsheethtmlreverse-engineering
by Felixx1502 Jul 16, 2026 7/10
skill GitHub

Backblaze B2 Cloud Storage Skill for Claude Code

An official Backblaze skill for managing B2 cloud storage from the terminal using natural language. Covers bucket management, file listing and search, storage auditing, security posture review, and safe cleanup of stale or large objects. Built on the Agent Skills specification and compatible with Claude Code.

skillcloud-storagebackblazeb2devops
by backblaze-labs Jul 16, 2026 7/10
skill GitHub

OneWave claude-skills: 172 Production-Ready Skills for Sales, Marketing & Engineering

A curated set of 172 production-ready Claude Code skills from OneWave AI spanning sales, marketing, design, engineering, and AI agent architecture. Skills are maintained as a living collection, making it a broad starter toolkit for teams wanting coverage across business and technical workflows.

skillcollectionsalesmarketingengineeringagent-architecture
by OneWave-AI Jul 16, 2026 6/10
skill GitHub

slop-cop: Audit, Grade, and Rewrite AI Slop Across Prose, UI, and Code

slop-cop is a Claude Code skill that detects and rewrites generic AI patterns across multiple content types: prose, social posts, UI/design, and code. It grades drafts for slop markers (vague claims, repetitive rhetoric, happy-path-only logic) and rewrites them with specificity. Useful for de-slopping any AI-generated output before publishing.

skillcontent-qualityai-slopwritingcode-review
by howshannon Jul 16, 2026 6/10
skill GitHub

agbox: Promote Repeated Agent Corrections into Reusable CLAUDE.md Skills

agbox is a local CLI that captures instructions you repeatedly give to AI agents (Claude Code, Codex, Cursor) and promotes them into AGENTS.md or CLAUDE.md memory files that agents actually follow. Reduces the "why won't it remember this?" friction by automating the capture-and-codify loop. Vendor-neutral, private, and reversible.

skillmemoryclaude-mdproductivityagent-memory
by qyinm Jul 16, 2026 8/10
skill GitHub

grok-skills: Use Grok from Claude Code for Review, Reasoning, and Implementation

grok-skills lets Claude Code delegate tasks (review, reason, implement, verify) to xAI's Grok model via a sandboxed companion. Supports both hardened and direct modes. Useful for getting a second-opinion from a different model family without leaving your Claude Code workflow. Not affiliated with xAI.

skillgrokmulti-modelcode-reviewreasoning
by sfourdrinier Jul 16, 2026 6/10
skill GitHub

reflect: Decision Framework Skill Using Bezos, Munger & Farnam Street Models

reflect is a Claude Code skill that runs your decisions through 23 compacted mental models drawn from Jeff Bezos, Charlie Munger, and the Farnam Street framework. It gives an opinionated call with reasoning and keeps a score of your predictions. Useful for high-stakes product, architectural, or strategic decisions.

skilldecision-makingmental-modelsproductivity
by seldonframe Jul 16, 2026 5/10
skill GitHub

tax-sarathi: Claude Code Skill for Indian Income Tax Filing with Live Portal Verification

tax-sarathi is a Claude Code skill for Indian income tax and ITR filing covering FY2025-26, with calculators for tax liability and live read-only verification against the e-filing portal via Playwright over CDP. The agent guides but does not submit — you retain control. Useful for Indian developers managing their own tax filings.

skilltaxindiaitrplaywrightcdp
by kumarrahul85 Jul 16, 2026 6/10
skill GitHub

Claude Code + Codex Infrastructure for PhD Researchers

A shareable Claude Code and Codex skill/agent infrastructure tailored for academic workflows. Includes skills, agents, hooks, and rules designed specifically for PhD research tasks. Targets the academic use case that generic setups often miss.

academicresearchPhDcodexskills
by flonat Jul 15, 2026 6/10
skill GitHub

tartinerlabs/skills: Claude Code Skills for Git, GitHub, Security, and Refactoring

A curated set of Claude Code skills covering git workflows, GitHub automation, security audits, code refactoring, and general project tooling. Each skill is ready to drop in and handles common developer tasks that benefit from repeatable AI-driven workflows.

gitgithubsecurityrefactoringautomationskills
by tartinerlabs Jul 15, 2026 7/10
skill GitHub

AER-Skills: Agent Skills for Academic Economics Paper Publishing

A stack of Claude Code skills targeting academic economists aiming to publish in top journals like AER and AEJ. Skills cover identification-first empirics, AEA-compliant replication packages, Keith Head–style introductions, and R&R rebuttals. Covers the full pipeline from topic selection to submission.

academiceconomicsresearchempiricsskills
by brycewang-stanford Jul 15, 2026 6/10
skill Reddit

Claude Code Skills for Operating Real-Time Data Pipelines (Estuary)

Estuary built Claude Code agent skills for interacting with real-time data pipelines — configuring sources and destinations, creating pipeline specs, checking task health, pulling logs, and investigating failures. The skills keep pipeline configuration visible to the operator throughout. Demo covers both what Claude handles well and where human guidance is still needed.

data-pipelinesreal-timeestuarydevopsskills
by dani_estuary Jul 15, 2026 6/10
skill GitHub

long-video-to-shorts: Local Opus Clip Alternative as a Claude Code Skill

A Claude Code skill that converts long videos into vertical 9:16 captioned short clips entirely locally — no cloud service required. Functions as a self-hosted alternative to Opus Clip. Handles cropping, captioning, and output formatting as a repeatable AI-driven workflow.

videoshort-formlocalskillcontent-creation
by joe-jns Jul 15, 2026 6/10
skill GitHub

desrobotizar: Remove Spanish AI Slop from LLM Output

A Claude skill that detects and removes robotic AI writing patterns from Spanish-language LLM output, learning the user's personal writing style over time. Addresses the common problem of LLM text sounding unnatural in Spanish. Useful for Spanish-speaking writers using Claude for content creation.

spanishwritingstyleslop-removalskill
by mszsorondo Jul 15, 2026 5/10
skill GitHub

pr-review-skill-generator: Mine Merged PRs to Generate a Repo-Specific Code Reviewer

A meta-skill that analyzes a repository's merged pull request history to generate a custom Claude Code skill tuned to that codebase's specific patterns, business logic, and conventions. The generated reviewer knows what matters in your project specifically, not just generic best practices. Clever self-bootstrapping approach to personalized AI code review.

code-reviewprmeta-skillskill-generationcodebase-aware
by paanSinghCoder Jul 15, 2026 8/10
skill GitHub

handle-with-adhd: Claude Code Skill for Adult ADHD Users

A Claude Code skill built from real use by an adult ADHD user, focused on zero-friction task execution and continuous memory capture. Avoids hidden costs and interruptions that disrupt focus, capturing context automatically so nothing is lost between sessions. Designed from lived experience rather than theory.

adhdaccessibilitymemoryfocusproductivityskill
by lubianiec Jul 15, 2026 6/10
skill GitHub

agent-skills: Disciplined AI Skills With Pre-Declared Kill Criteria and Usage Metrics

A collection of small, focused AI agent capabilities where each skill ships with a pre-declared kill criterion (when to retire it) and real usage numbers. Takes a disciplined, data-driven approach to skill management rather than accumulating skills indefinitely. Useful as a template for teams wanting to maintain skill hygiene.

skillsmetricslifecycledisciplineagent-skills
by AdityaVasireddy Jul 15, 2026 6/10
skill Reddit

Lemma: Claude Code Plugin for Rigorous Data Science Workflows

Lemma is a Claude Code plugin that adds methodological rigor to data science work via a structured persona, task-specific skills (EDA, causal inference, etc.), and live notebook kernel access. Benchmarked against DSAEval, the base agent gave confidently wrong answers in 3/5 hard cases while Lemma reduced that to roughly 1 in 7. A well-validated approach to making Claude Code a more careful analysis partner.

data-scienceskillpluginbenchmarknotebookCLAUDE.md
by Spare_Suit3701 Jul 15, 2026 8/10
skill GitHub

writers-room: Local-First Editorial Studio Claude Code Plugin

A Claude Code plugin (also Codex-portable) that turns Claude into a personal editorial studio with a filesystem-based content board. Its voice memory learns from your own edits rather than relying on humanizer tools, so your distinctive style is preserved across AI-assisted writing sessions. Designed for writers who want consistent voice without cloud dependencies.

writingeditorialpluginvoice-memorylocal-firstCLAUDE.md
by dhalarewich Jul 15, 2026 6/10
skill GitHub

skillZs: Open Hub for Discovering and Installing SKILL.md Workflows

An open directory for discovering, comparing, creating, and safely installing SKILL.md workflows for Claude Code agents. Provides a curated hub with a safety-focused installation flow to vet community skills before adding them to your setup. Fills a real gap in the Claude Code ecosystem for skill discoverability and distribution.

skillsSKILL.mddirectorydiscoverycommunityworkflowsinstallation
by CarlosJunioor Jul 15, 2026 8/10
skill GitHub

IFRS Skill: Accounting Standards Guidance for AI Agents

A Claude Code skill providing IFRS (International Financial Reporting Standards) guidance with cited answers and audit support. Gives AI agents the ability to answer accounting standard questions and verify compliance against up-to-date IFRS requirements. Targeted at finance and accounting teams using Claude Code.

ifrsaccountingfinancecomplianceaudit
by babu9893 Jul 15, 2026 5/10
skill Reddit

PitsiUI: Free Open-Source Cross-Platform UI Component Library for Claude Code

A polished, free, open-source component and blocks library (shadcn registry compatible) designed to help Claude produce Apple-quality UI. Includes real app templates, composed components, tested UX flows, and full logic — not just generic dashboard widgets. Comes with Claude Code skills and instructions to guide it toward professional design output.

uicomponentsshadcndesignfrontendopen-source
by Admirable-Canary-732 Jul 15, 2026 7/10
skill GitHub

claude-for-datascience: Opinionated Claude Code Scaffold for Computer Vision and ML

An opinionated Claude Code scaffold tailored for computer vision and data science projects, bundling skills, subagents, and enforcement hooks. Bakes in reproducibility practices and prevents evaluation set leakage by design. A strong starting point for ML practitioners who want Claude Code aligned with data science best practices.

data-sciencemachine-learningcomputer-visionreproducibilityscaffold
by BrendenKennedy Jul 15, 2026 7/10
skill GitHub

de-slop: Claude Code Skill to Remove AI Slop from Prose

A portable Claude Code skill that detects and rewrites "sloppy" AI-generated prose into content with a real point of view. Uses a fidelity-first approach — it flags hollow spans and rewrites them with scored self-evaluation and iteration. Great for teams publishing content written or assisted by AI who want to avoid generic output.

writingproseai-slopcontent-qualityediting
by isatimur Jul 15, 2026 7/10
skill GitHub

Claude Skill Doctor: Audit and Score Your SKILL.md Files

A meta-skill (zero dependencies) that inspects SKILL.md files and scores them across six dimensions: trigger quality, length, progressive disclosure, script externalization, portability, and security (no hardcoded secrets). Outputs a scored report with fix suggestions. A sister tool to claude-md-doctor, useful for anyone building and maintaining a library of Claude Code skills.

skill-qualitylintingmeta-toolauditskill-md
by huiyonghkw Jul 15, 2026 6/10
skill GitHub

DesignThinking Skill: Full Empathize-to-Assess Pipeline via Chained Subagents

A Claude Code skill that runs a complete Design Thinking pipeline — Empathize, Define, Ideate, Prototype, Test, and Assess — as a sequence of chained subagents. Takes a SMART goal as input and produces a VIP business assessment. Useful for product and strategy work that benefits from a structured ideation process.

design-thinkingproductstrategysubagentsideation
by hyunbean Jul 15, 2026 6/10
skill GitHub

repo_worklog_skill: Auto-Generate Daily Work Logs from Real Git Diffs

A Claude Code agent skill that reads actual Git diffs (not just commit messages) and generates a per-day project worklog under PROJECT_WORKLOG/ with an index file. Previews every change before writing and creates one Markdown file per day. Useful for developers who need to produce accurate time-stamped activity reports from code history.

gitworklogdocumentationreportingproductivity
by g761007 Jul 15, 2026 7/10
skill GitHub

design-artifact: Skill to Build Polished Interactive HTML Artifacts

An awesome-skills skill for building and verifying polished interactive HTML artifacts and responsive prototypes. Handles the full cycle of generation and visual verification. Useful for quickly producing UI demos, design handoffs, or interactive specs without leaving Claude Code.

htmlprototypedesignartifactui
by awesome-skills Jul 15, 2026 7/10
skill GitHub

create-html-deck: Skill to Build Browser-Native HTML Presentations

An awesome-skills skill that builds and verifies browser-native HTML presentations optimized for laptops and projectors. Generates complete slide decks without external dependencies. A quick way to produce shareable presentations directly from Claude Code.

htmlpresentationslidesprototype
by awesome-skills Jul 15, 2026 6/10
skill GitHub

Python Code Review Skills for Agentskills.io Agents

Portable Python code-review skills covering type safety, error handling, anti-patterns, async usage, and code style. A router skill dispatches to the most relevant focused reviewer for each concern.

pythoncode-reviewtype-safetyasyncanti-patterns
by CodeSigils Jul 15, 2026 6/10
skill GitHub

Custom Claude Code Config as Disciplined Engineering Partner

A custom Claude Code configuration that transforms the agent into a disciplined engineering partner with structured workflows, strict guardrails, and domain-specific expertise baked into the setup.

configurationclaude.mdguardrailsengineeringworkflows
by domengabrovsek Jul 15, 2026 6/10
skill GitHub

Web Performance Audit Skill with Multi-Agent Pipeline

Audits web performance using a multi-agent pipeline that turns browser data into actionable fixes for Core Web Vitals and related metrics. Structures the audit as parallel agent passes over different performance dimensions.

web-performancecore-web-vitalsmulti-agentauditingoptimization
by sa746062 Jul 15, 2026 6/10
skill Reddit

Shopping Lookbook Skill: Build Shoppable Sites with Claude Code

A generic Claude Code skill for building shoppable lookbook sites hosted on GitHub Pages. Demonstrated by finding large-size hats — shows how to connect product search requirements to a published, browsable site.

ecommercelookbookshoppingskillgithub-pages
by DrewHoov Jul 15, 2026 5/10
skill GitHub

Agentic-Kits: Reusable DevOps AI Skill Kits

Reusable AI skill kits covering Docker, Kubernetes, Zabbix, ELK, and Grafana infrastructure — with skills, rules, and templates for coding agents. Includes .NET 10 examples.

devopsdockerkubernetesinfrastructureskills
by KhaiTrang1995 Jul 15, 2026 6/10
skill GitHub

Agent-Knowledge: Portable Knowledge Base as Open Knowledge Format

The kb-* agent skill family for building and maintaining a portable knowledge base as an Open Knowledge Format (OKF) bundle, enabling persistent, structured project knowledge that travels with agents.

knowledge-baseokfportablememorydocumentation
by stjbrown Jul 15, 2026 6/10
skill GitHub

Research-Anything: All-Channel Research Skill for Claude Code

Sweeps Douyin, Xiaohongshu, Zhihu, Bilibili, YouTube, GitHub, X, and the web for first-hand practices, verifies claims with sub-agents, and converges on one actionable plan from a single research prompt.

researchmulti-channelsubagentsverificationactionable
by Somezak1 Jul 15, 2026 6/10
skill GitHub

Claude Toolbox: Small Install-and-Own Claude Code Skills

An open library of small, install-and-own Claude Code skills including a wording linter and a pre-public secret scanner to catch exposed credentials before pushing. Each skill is self-contained and ownership-friendly.

skillslintingsecuritysecret-scanningutilities
by JayOfemi Jul 15, 2026 6/10
skill GitHub

13 Claude Skills for Learning and Teaching

A skill set for education: flashcard generation, concept explanation, study plans, exam prep, and research summaries. Covers both the learner and teacher roles with separate skill entries for each.

educationflashcardsteachinglearningstudy-plans
by prvthmpcypher Jul 15, 2026 5/10
skill GitHub

26 Claude Skills for Designers

A collection of 26 Claude skills covering UI/UX, brand identity, typography, frontend design, accessibility, and visual storytelling — a broad toolkit for design-focused Claude Code workflows.

designui-uxbrandingtypographyaccessibility
by prvthmpcypher Jul 15, 2026 6/10
skill GitHub

Acceptance-Driven Development Skill for AI Coding Agents

Enforces acceptance-criteria-driven development for AI agents: done is a checklist, not a feeling. Keeps agents honest about completion by requiring machine-verifiable acceptance criteria before signoff.

acceptance-testingquality-gatestddverificationdone-criteria
by ZeusYue Jul 15, 2026 6/10
skill GitHub

Fact-Verify: Source Verification Skill for AI Research Results

Verifies AI research citations before trusting them: 4-tier source classification, re-citation chain detection, and URL/DOI/NTIS existence checking. Guards against hallucinated or misattributed sources.

fact-checkingresearchverificationcitationsquality-control
by parkjui92-tech Jul 15, 2026 6/10
skill GitHub

Display Design Studio: Curated AI Agent Skill Collection

A curated skill collection for AI agents including first-party skills and vendored framework/CMS best practices for use with the Agent Skills ecosystem and skills.sh.

skills-collectioncmsframeworksbest-practicesagent-skills
by display-design-studio Jul 15, 2026 6/10
skill GitHub

Economics Slides Skill: LaTeX/Beamer Presentations via Claude Code

An agent skill for producing professional academic economics slides in LaTeX/Beamer — handles paper-to-talk conversion, discussant decks, verified layouts, and accurate numbers. Designed for academic rigor.

latexbeamereconomicsacademicpresentations
by hanlulong Jul 15, 2026 5/10
skill GitHub

Soia Open Skills: Archive X Tweets and Telegram Messages to Obsidian

Agent skills for daily knowledge management: archive X tweets, threads, and articles into an Obsidian vault, with Telegram Saved Messages sync. Works with Claude Code, Codex, and Cursor.

obsidianknowledge-managementtwittertelegramarchiving
by soia-team Jul 15, 2026 6/10
skill GitHub

Threads Marketing Skills for Claude Code

Agent skills for marketing on Threads: write posts, multi-post threads, hooks, replies, and weekly content plans in your voice. Publish via Publora. Open source, MIT.

marketingsocial-mediathreadscontentpublishing
by sergebulaev Jul 15, 2026 5/10
skill GitHub

TikTok Marketing Skills for Claude Code

Agent skills for TikTok content creation: 3-second video hooks, captions, trend mapping, and weekly content plans. Draft, humanize, and publish via Publora. MIT licensed.

marketingtiktokvideocontentsocial-media
by sergebulaev Jul 15, 2026 5/10
skill GitHub

Animated Sketch Diagram Skill: Hand-Drawn Architecture Diagrams

A Claude Code skill that creates hand-drawn animated architecture diagrams — ink-on-beige-paper style with flowing dots. Exports as a self-contained HTML file or seamless-loop GIF.

diagramsanimationarchitecturehtmlvisualization
by OLDyade Jul 15, 2026 6/10
skill GitHub

Humanizer Workbench: Rewrite AI Text into Natural Writing

A CLI and Claude Code skill that spots AI writing patterns, refines tone, and improves rhythm to rewrite AI-generated text into natural-sounding prose you can publish without detection.

writinghumanizationai-textclitone
by aprempeh-tech Jul 15, 2026 5/10
skill GitHub

C# Brain for Claude: Curated .NET Knowledge Base

A curated C# and .NET knowledge base that powers Claude with better code patterns and architecture decisions for .NET projects — injected as project context for consistently idiomatic outputs.

csharpdotnetknowledge-basepatternsarchitecture
by Myosinstringer459 Jul 15, 2026 5/10
skill GitHub

Code-Humanizer: Remove AI Code Slop with Test-Gated Refactoring

A test-gated, behavior-preserving agent skill that removes AI-generated code patterns: duplicated helpers, try-import fallbacks, broad excepts, and speculative abstractions. Only ships changes where tests still pass.

code-qualityrefactoringai-sloptest-gatedcleanup
by LeonardNJU Jul 15, 2026 7/10
skill GitHub

Python Project Workflow Skill for Agentskills.io Agents

A portable Python project workflow skill covering greenfield bootstrap, tooling configuration, CI, packaging, mature-repo preservation, and cross-platform verification for agentskills.io-compatible agents.

pythonproject-setupcipackagingworkflow
by CodeSigils Jul 15, 2026 7/10
skill GitHub

Claude-Obsidian-Sessions: Compress and Resume Sessions in Obsidian

Adds /obsidian:compress to save the current Claude Code session as a structured log in Obsidian, and /obsidian:resume to reload project context from those logs. Bridges session memory with a personal knowledge base.

obsidiansession-managementmemorypluginsknowledge-base
by ERuban Jul 15, 2026 7/10
skill GitHub

Supergoal-Skill: Gated Dev Process with Expert Subagents

A Claude Code skill that takes one objective and runs a full gated development process using expert subagents, refusing to declare done until a machine-checkable gate passes. Bilingual (English/Korean) onboarding and live walkthrough included.

subagentsquality-gatestddworkflowverification
by cskwork Jul 15, 2026 7/10
skill GitHub

Tribunal: Independent QA for AI-Written Code Using Multiple Models

A Claude Code skill plus runbooks that put other coding models (Grok, Codex, local) on the review panel to provide independent QA for AI-written code. Cross-model review to catch what a single model misses.

code-reviewmulti-modelquality-assurancesubagents
by mattferry Jul 15, 2026 7/10
skill GitHub

Claude Code Tips: Practical Patterns from Hundreds of Sessions

A curated collection of practical patterns for agentic coding built from hundreds of Claude Code sessions — covering hooks, agents, and automation techniques with real-world examples.

best-practiceshooksagentsautomationpatterns
by anipotts Jul 15, 2026 7/10
skill Reddit

How Claude Decides to Load Skills: Frontmatter Description Is the Key

Claude loads a skill based on its description line, not its body — a vague description gets ignored while a trigger-specific one fires reliably. Covers the project vs user layer split (.claude/ in repo vs ~/.claude/), and common failure modes like hardcoding personal preferences into team CLAUDE.md files.

skillsclaude.mdconfigurationbest-practicesfrontmatter
by Bulky_Ad738 Jul 15, 2026 9/10
skill GitHub

AgentsCamp Library: Installable AI Coding Agent Skills Collection

A copy-paste-ready mirror of the agentscamp.com library, containing AI coding agent skills, commands, guides, and tools you can install directly. Makes community-published resources available as a Git-installable package. Good starting point for expanding Claude Code capabilities with curated community content.

skillscommandslibrarycommunityagents
by imtiazrayhan Jul 15, 2026 7/10
skill GitHub

Ghost Headless Blog Skill for Claude Code

A Claude Code skill for building a headless Ghost CMS blog with Next.js App Router, including Content API client, ISR with webhook revalidation, SEO configuration, and Koenig card styling. Packages a complete headless CMS stack into a reusable skill. Ideal for developers who use Ghost as a backend with modern React frontends.

skillghost-cmsnext.jsheadlessblog
by kasuncfdo Jul 15, 2026 5/10
skill GitHub

Starks Skill: Tiered Task Launcher for Claude Code

A task-launcher skill for Claude Code and Codex featuring tiered workflows, optional cross-model plan review between Claude and Codex, and PM-mode parallel sub-agents. Lets you kick off complex multi-step tasks with built-in checkpoints and model arbitration. Good for teams coordinating work across multiple AI coding tools.

skilltask-launcherworkflowcodexparallel-agents
by uniStark Jul 15, 2026 7/10
skill GitHub

Giasip Skills: Research and Multi-Model Dispatch for Claude Code

Two Claude Code skills: Quick Recon for rapid research with fact-checking, and a multi-model caller for dispatching tasks across different AI providers. Useful for building Claude Code workflows that need external information gathering or want to compare outputs from multiple models. Bilingual documentation in Chinese and English.

skillresearchfact-checkmulti-modeldispatch
by GiaSip Jul 15, 2026 6/10
skill GitHub

YouTube-to-Spec: Turn Videos into Traceable Software Requirements

Two decoupled Claude Code skills: one extracts lossless metadata and transcripts from YouTube videos, and a second transforms the transcript into Module → Feature → Requirement specs with every requirement linked to its exact transcript segment. Useful for turning conference talks, demos, or tutorial videos into structured specs. Ensures traceability from source material to requirements.

skillrequirementsyoutubetranscriptspecs
by alikmlsipahi Jul 15, 2026 7/10
skill GitHub

Creeta Lens: Skill Navigator for Claude Code

A skill navigator that helps Claude Code users discover, browse, and select the right skills for their task. Addresses the challenge of finding relevant skills in a growing ecosystem. Useful as a meta-tool for teams building large skill libraries.

skillnavigatordiscoveryclaude-code
by livevil7 Jul 15, 2026 5/10
skill GitHub

Data Engineering Skills for Claude: Guides, Prompts, and Python Code

A practical guide collection with prompts and Python code for applying Claude Skills to data engineering and pipeline automation tasks. Covers common data engineering patterns adapted for use with Anthropic's Claude Skills API. Useful for data engineers who want to automate ETL, pipeline validation, and transformation logic with Claude.

data-engineeringskillpythonpipelineetl
by Methasit-Pun Jul 15, 2026 6/10
skill GitHub

12 Principles for Writing Predictable Agent Skills

Evidence-backed guide to 12 principles for writing reliable, predictable agent skills, inspired by Matt Pocock's public skills repository. Covers composition, clarity, and testability for Claude Code skill authors. A valuable reference for anyone building reusable skills who wants to avoid common pitfalls. Bilingual (Chinese and English).

skillbest-practicesguideprinciplesagent-design
by Conradgui Jul 15, 2026 7/10
skill GitHub

github-publish-skill: Agent-Native Skill for Publishing Local Projects to GitHub

A Claude Code skill that automates publishing local projects to GitHub with zero-config proxy detection. Handles git init, remote setup, and push from within an agent session — designed to run unattended without manual credential configuration.

githubpublishinggitautomation
by zhongwentuo-creator Jul 15, 2026 7/10
skill GitHub

shirabe: Structured Workflow Skills for AI Coding Agents

A collection of structured workflow skills for AI coding agents providing organized patterns for common development tasks. Gives agents repeatable, well-defined processes rather than ad-hoc problem solving, improving consistency across sessions.

workflowskillsstructuredcoding-agents
by tsukumogami Jul 15, 2026 7/10
skill GitHub

solidifier: SOLID Principles Skill That Treats Over-Engineering as a Defect

A Claude Code skill (also compatible with OpenCode, Copilot, Codex) that applies SOLID design principles and patterns while treating over-engineering as a bug — every abstraction needs concrete justification. Offers four configurable rigor levels from advisory to thorough.

soliddesign-patternsrefactoringskill
by FernandoJRR Jul 15, 2026 8/10
skill GitHub

arc: Package Manager for Installing and Sharing AI Skills, Tools, and Agents

A package management system for personal AI that allows users to install, discover, and share skills, tools, agents, and prompts. Aims to create a discoverable ecosystem for AI extensions similar to how npm works for JavaScript packages.

package-managerskillsagentsdiscovery
by the-metafactory Jul 15, 2026 6/10
skill Reddit

Doodler: Draw on Your Screen to Show Claude What You Mean

A Claude Code skill plus macOS companion app that turns your screen into a transparent drawing canvas. Annotate live UI with circles and arrows while speaking, then Claude receives annotated screenshots plus a voice transcript. Transcription runs on-device via Apple SpeechAnalyzer — no API key, 100% local.

visualscreen-annotationmacosvoiceskillaccessibility
by obaid83 Jul 14, 2026 8/10
skill GitHub

MSP Claude Plugins: Plugins for PSA, RMM, Documentation Tools

Community-driven Claude Code plugins for managed service provider tooling covering PSA, RMM, and documentation systems. Open for community contributions — aimed at MSP engineers who want AI coding agent support for their day-to-day tools.

msppsarmmdocumentationpluginscommunity
by wyre-technology Jul 14, 2026 6/10
skill GitHub

Sketchloop: AI Agent Creates Hand-Drawn Diagrams via D2

Lets coding agents produce beautiful hand-drawn-looking diagrams authored as D2 text and rendered offline without a browser. The agent self-checks results by reading the PNG output to ensure the diagram matches the specification.

diagramsd2visualizationofflineself-checkskill
by alexander-posztos Jul 14, 2026 7/10
skill GitHub

Aguara: Scan Agent Skills and MCP Servers for Injection Threats

Scans AI agent skills and MCP servers for prompt injection vulnerabilities, data leak risks, and supply-chain threats before deploying to production. Produces actionable security reports covering each detected risk category.

securityprompt-injectionmcpskillssupply-chainscanning
by salasi1204 Jul 14, 2026 8/10
skill GitHub

Project Design Skill: Complete Planning Packages for Claude Code

A Claude Code skill that assembles complete software project planning packages on demand — architecture proposals, task breakdowns, and design decisions in a structured format suitable for handoff to implementation agents.

planningdesignskillarchitecturesoftware-design
by alfred-intelligence Jul 14, 2026 6/10
skill GitHub

SkillForge: Production-Ready Claude Code Skills for Devs

A curated set of production-ready Claude Code skills for developers, knowledge workers, and marketers. Includes 9 free MIT-licensed skills covering common workflows plus a Pro pack with extended capabilities.

skillsproduction-readymarketingdevelopmentmit
by moses607 Jul 14, 2026 6/10
skill GitHub

Wine on macOS AI Agent Skill: Run Windows Apps

A comprehensive AI agent skill and reference guide for running any Windows application on macOS via Wine, CrossOver, Whisky, and Kegworks. Covers bottle configuration, DXVK, .NET, crash fixes, and anti-cheat limits for AI agents including Claude Code, Codex, and Cursor.

winemacoswindowsskillcompatibilitygaming
by artificialguybr Jul 14, 2026 6/10
skill GitHub

Align-Dev: Generate SKILL.md Files via Visual Interface

A visual interface for generating frontend project standards and local SKILL.md files for AI coding agents. Helps teams create consistent agent instructions without hand-writing specification files from scratch.

skill-mdfrontendstandardsvisualconfiguration
by Villa3650 Jul 14, 2026 6/10
skill GitHub

CC Commander: 71 Skills, 22 Agents, 23 Hooks Plugin Suite

A comprehensive Claude Code plugin suite implementing "The Fable Method" — 12 enforceable quality gates to produce Fable-shaped results from any model. Bundles 71 plugin skills, 22 specialist agents, and 23 lifecycle hooks (39 handlers) in one installable package.

skillsagentshooksfablequality-gatesplugin-marketplace
by KevinZai Jul 14, 2026 8/10
skill GitHub

Air-Gapped Skills: 40+ Reference Skills for Infra and ML

A Claude Code plugin marketplace with 40+ installable reference skills covering vLLM/SGLang inference, Kubernetes and Harvester, GPU host bring-up, observability, security hardening, and agent workflows. Targeted at ML infra and DevOps teams.

skillskubernetesgpusecurityobservabilityinfravllm
by air-gapped Jul 14, 2026 7/10
skill GitHub

100+ Claude Code Skills Collection in Chinese

A curated collection of 100+ Claude Code skills with 18 original installable skills organized by use case. Instructions in Chinese, covering common development scenarios from code review to deployment automation.

skillschinesecollectioninstallableproductivity
by laolaoshiren Jul 14, 2026 6/10
skill GitHub

Trust-Issues: Adversarial Security Review Before You Install

A read-only scanner plus five-persona reasoning pass for AI skills, repos, MCP servers, and packages before installation. Produces a GO / GO WITH MITIGATIONS / NO-GO verdict with rationale to protect against supply-chain threats.

securityreviewmcpskillssupply-chainadversarial
by howshannon Jul 14, 2026 8/10
skill GitHub

Apple Music TUI and CLI Skill for Claude Code on macOS

Gives Claude Code and the macOS terminal full control over Apple Music — playback, multi-room AirPlay switching, and playlist management. Works as both a TUI and a natural-language skill invocation from Claude Code.

apple-musicmacostuicliskillairplay
by anthonymaley Jul 14, 2026 6/10
skill GitHub

Resume ATS Optimizer Skill for Claude Code

A Claude Code skill for building, tailoring, and auditing resumes optimized for ATS systems (Workday, Greenhouse, Lever, Taleo, iCIMS), recruiter skim-reading, and LinkedIn recruiter search. Zero-fabrication policy enforced by the skill.

resumeatslinkedincareerskill
by artificialguybr Jul 14, 2026 6/10
skill GitHub

Product Prover: Catch PRD Defects Before Writing Code

A Claude Code skill that applies formal-verification thinking to review PRDs and specs for structural defects before implementation begins. Every finding is traced back to its source requirement for accountability.

prdspec-reviewformal-verificationplanningskill
by happysasha18 Jul 14, 2026 7/10
skill GitHub

Orchestrate: Nine-Strategy Subagent Skill for Claude Code

A single /orchestrate entry point that dispatches to nine different subagent orchestration strategies (parallel, pipeline, review-loop, etc.). Lets you pick the right strategy per task without maintaining separate skills for each pattern.

orchestrationsubagentsskillstrategiesworkflow
by gabros20 Jul 14, 2026 7/10
skill GitHub

40+ Claude Code Tips with dx Plugin and Status Line Script

A curated collection of 40+ Claude Code tips from basics to advanced. Includes a custom status line bash script, a guide for running Claude Code inside a container, and the dx plugin with everyday dev workflow skills.

tipsskillspluginstatus-linecontainerproductivity
by ykdojo Jul 14, 2026 7/10
skill GitHub

Image Generation Inside Claude Code via /imagine

Adds image generation and editing to Claude Code through a skill and /imagine commands. Supports Codex CLI (no API key), OpenAI gpt-image, Gemini Nano Banana, and free FLUX models via an installable plugin marketplace.

image-generationskillcommandsfluxopenaigemini
by JashanMaan28 Jul 14, 2026 7/10
skill GitHub

Arcjet Security Skills for AI Coding Agents

Skills that give AI coding agents deep knowledge of the Arcjet security library for Node.js. Enables agents to correctly implement rate limiting, bot detection, and shield protection without manual documentation lookups.

securityarcjetnodejsskillsrate-limiting
by arcjet Jul 14, 2026 6/10
skill Reddit

Stop Plain Text Prompts: Switch to XML for Claude Code Tasks

Argues that framing Claude Code tasks in XML (structured task, context, constraints, output format) improves output quality more than upgrading models. Provides practical before/after examples and the technique's mechanics for formatting complex multi-step tasks.

promptingxmltechniqueskill
by reddit Jul 14, 2026 7/10
skill Reddit

5 Security Checks for Claude Wired into GitHub Actions

Security guide covering the five key questions that determine whether a Claude agent in GitHub Actions can be hijacked: write token scope, shell access, prompt injection from issue text, OIDC vs static secrets, and rate-limiting on untrusted input. Practical checklist for CI/CD Claude setups.

securitygithub-actionsci-cdprompt-injection
by reddit Jul 14, 2026 8/10
skill GitHub

repo-audit: Six-Phase Code Safety Audit Before You Install Third-Party Code

Claude Code skill that audits third-party code before installation. Runs six read-only phases and returns a SAFE / SAFE-WITH-CONDITIONS / UNSAFE verdict with evidence. Designed to catch supply chain risks, malicious payloads, and dependency traps before they enter your project.

securityauditskillsupply-chain
by belschak Jul 14, 2026 8/10
skill GitHub

tastecheck: 15 Frontend Craft Skills for AI Coding Agents

Fifteen skills that interview or audit an AI coding agent into a real design system, then verify typography, OKLCH color, component states, forms, charts, accessibility, and anti-slop patterns. Raises the bar on AI-generated UI output beyond functional to genuinely polished.

frontenddesignskillui-quality
by KyaniteLabs Jul 14, 2026 7/10
skill GitHub

decant: Extract Any Website's Design Language into Agent-Readable Instructions

Give your AI coding agent taste. Decant analyzes any website and extracts its design language — colors, typography, spacing, component patterns — into a structured format that coding agents can follow when generating UI. Bridges the gap between "design a page like this" and actually matching the style.

designskillfrontendui
by Ykjc720 Jul 14, 2026 7/10
skill Reddit

invisible-ink: Skill That Teaches AI Agents to Write Better UI Copy

Open-source skill based on Apple HIG, WWDC talks, and UX writing practice. Teaches AI agents to write human UX copy — buttons, error messages, empty states, forms — instead of generic machine-style text like "An error occurred." Includes before/after examples.

skillux-writingcopywritingfrontend
by reddit Jul 14, 2026 7/10
skill GitHub

ai-guidelines-sync: Sync Centralized Rules and Skills Across Projects

Tool for setting up and keeping centralized CLAUDE.md rules and skill files synchronized across multiple projects. Changes to the central rules propagate automatically, ensuring consistent agent behavior across an entire repository portfolio.

skillclaude-mdsyncproject-management
by artemisia-absynthium Jul 14, 2026 7/10
skill GitHub

design-harness: Feed Papers and Ideas, Get a Defensible System Design

Agent skill for Claude Code and any SKILL.md-compatible agent. Feed it papers and half-formed ideas; it links them into a system design you can defend. Keeps a Markdown record and generates a visual canvas. Useful for architecture and technical design work.

skillarchitecturedesignsystem-design
by tigerless-labs Jul 14, 2026 7/10
skill GitHub

claude-code-skills: Session Management, Worktree Recovery, and Skill Scaffolding

Production-tested skill collection covering session lifecycle management, multi-session reconciliation, worktree recovery after crashes or conflicts, and scaffolding for creating new skills. Addresses day-to-day operational pain points in Claude Code workflows.

skillsession-managementworktreescaffolding
by conorbronsdon Jul 14, 2026 7/10
skill GitHub

agent-token-saver: Measured Token Routing for Claude Code and Other CLI Agents

Reduces token waste by routing agent interactions through structured filters that strip noise without losing essential context. Works with Claude Code, Codex, Hermes, GG Coder, and other CLI agents. Aims to improve signal-to-noise while preserving judgment quality.

tokensoptimizationskillrouting
by Supersynergy Jul 14, 2026 6/10
skill GitHub

honest-loop: Evidence-Capped Quality Loop for AI-Built Work

Three-skill package addressing the problem that AI agents grade their own work too generously. Skills: score (evaluate the output), close-gaps (fix what the scorer found), and verify (independent check). Evidence-capped means the scorer can't mark something correct without concrete evidence.

skillqualityself-reviewverification
by youkistudios Jul 14, 2026 7/10
skill GitHub

basecamp: Production-Ready Claude Code Setup with CLAUDE.md and Token Optimization

Opinionated, production-tested Claude Code setup: global CLAUDE.md, coding rules, per-project memory, and token optimization patterns. Provides a solid starting point for a consistent, efficient Claude Code environment across all projects.

claude-mdconfigurationtoken-optimizationsetup
by janmaaarc Jul 14, 2026 7/10
skill GitHub

klaussy-agents: Multi-Agent Context, Rules, and Hooks Boilerplate Generator

Single command scaffolds conventions, namespaced skills, stack-appropriate settings, and interactive guardrails for seven AI coding environments — matching each agent's native file formats. Eliminates the work of manually adapting CLAUDE.md and settings for each tool.

scaffoldingboilerplatemulti-agentconfiguration
by steph-dove Jul 14, 2026 8/10
skill GitHub

atlassian-skills: Token-Efficient CLI for Atlassian Tools for LLM Agents

Drop-in alternative to mcp-atlassian for AI coding agents working with Jira, Confluence, and Bitbucket on Atlassian Server/DC. Outputs compact representations with lossless XHTML-to-Markdown round-trip. Compatible with Claude Code, Codex, and GitHub Copilot.

skillatlassianjiraconfluence
by eunsanMountain Jul 14, 2026 7/10
skill GitHub

fable5-mode: Fable 5 Work Discipline for Any Claude Model

Claude Code skill + guard hooks that make Opus 4.8 or any non-frontier model plan, self-verify, and route sub-agents like Fable 5 does. Includes a plan gate that blocks implementation without a written plan, a model ceiling hook, and per-task enforcement.

skillhookplanningmodel-discipline
by cozytab Jul 14, 2026 8/10
skill GitHub

delegate-to-lower-model: Always-On Skill Router for Lower-Cost Models

Claude Code skill that acts as a persistent router: identifies fixed-spec, machine-verifiable tasks and delegates them to lower-cost models (Haiku, Sonnet) while keeping quality tasks on the primary model. Designed so the quality floor never drops below single-model baseline.

skillroutingcost-optimizationmodels
by Laki-private Jul 14, 2026 7/10
skill GitHub

self-evolve: Methodology Skill for Agents That Self-Iterate Any Skill or Repo

Skill + harness for agents that self-improve their own skills or projects through multiple iterations. Uses an un-gameable acceptance gate so "accepted = real improvement" not a score-up curve. Built for open-ended domains without ground truth. 521 tests.

skillself-improvementiterationquality
by DaizeDong Jul 14, 2026 8/10
skill GitHub

reality-check-skill: Devil's Advocate Skill with 7 Decision Frameworks

Claude skill that pushes back on your ideas with evidence rather than agreeing by default. Four modes (soft challenge, hard challenge, scenario simulation, devil's advocate) grounded in seven decision frameworks including pre-mortem, inversion, and steelman.

skilldecision-makingcritical-thinkingreview
by ibangtam Jul 14, 2026 7/10
skill GitHub

murderboard: Skill That Tries to Kill Your Idea Before You Commit

Claude will tell you your idea is great. Murderboard makes it try to kill it first. A structured adversarial review skill that argues against your proposal, identifies failure modes, and surfaces risks — before you commit engineering effort to it.

skilladversarialreviewidea-validation
by acost1a Jul 14, 2026 7/10
skill GitHub

ai-toolkit: 94 Skills and 44 Agents for Multi-Platform AI Coding

Large-scale professional AI coding toolkit with 94 skills and 44 agents. Works across Claude Code, Cursor, Windsurf, Copilot, Gemini, Cline, Roo Code, Aider, Augment, Antigravity, Codex CLI, and opencode. Covers a broad spectrum of development tasks.

skillmulti-platformtoolkitagents
by softspark Jul 14, 2026 7/10
skill GitHub

architect: Read-Only Architecture Review Skill for AI Coding Agents

Skill for grounded architecture review and design — read-only, evidence-based, grounded in Balanced Coupling principles. Reviews existing architecture and generates executable improvement plans. Designed for cases where you want architectural analysis without code changes.

skillarchitecturereviewdesign
by alexei-led Jul 14, 2026 7/10
skill GitHub

basicly: Versioned Harness Distribution for Coding Agents

Maintains reusable skill fragments, hook gates, and settings in one source of truth, then projects them into the native format of each target tool (Claude Code, Cursor, etc.). Version-pins the distribution so you can roll back or upgrade consistently.

skillharnessdistributionconfiguration
by niksavis Jul 14, 2026 7/10
skill GitHub

Claude-Skills: Token Optimization with TDD Methodology Including rescue-tokens

Community Claude Code skill library tested with TDD (RED-GREEN-REFACTOR). Features rescue-tokens skill: 9 optimization patterns that reduce verbosity by 90% to avoid rate limits. Includes session management and productivity workflow skills.

skilltoken-optimizationtddproductivity
by valorisa Jul 14, 2026 7/10
skill GitHub

gemini-delegate-skill: Claude Code Skill for Delegating to Gemini CLI

Skill that routes specific tasks from Claude Code to Gemini CLI: large-context synthesis (leveraging Gemini's 1M+ context window), English or Chinese long-form drafting, and second-opinion review. Enables a two-model workflow from within Claude Code.

skillgeminidelegationmulti-model
by WenyuChiou Jul 14, 2026 7/10
skill GitHub

creative-sparring: Adversarial Ideation Skill for Claude and Cursor

Frames, diverges, attacks, and bridges product ideas into falsifiable prototype briefs. Goes beyond "yes, and" to genuinely stress-test product concepts through structured adversarial ideation. Works with Claude Code, Cursor, and Codex.

skillideationadversarialproduct
by mondaymetime Jul 14, 2026 7/10
skill GitHub

mcp-precheck: Skill That Checks MCP Servers Against PolicyLayer Registry

Agent skill that checks any MCP server against the PolicyLayer security registry before connecting. Returns identity verification, risk grade, tool classifications, and detected changes. Prevents connecting to malicious or compromised MCP servers.

skillsecuritymcpregistry
by PolicyLayer Jul 14, 2026 7/10
skill GitHub

coding-quality-loop: Portable Skill for Small Verified Coding-Agent Changes

Agent skill that enforces a quality loop for coding changes: plan the change, implement it minimally, verify with tests, and only commit when verified. Designed to prevent AI agents from making large untested changes in a single step.

skillqualityverificationtesting
by zaingz Jul 14, 2026 6/10
skill GitHub

SvelteKit Project Structure Skill for Claude Code

A reusable Claude Agent Skill acting as a senior software architect for SvelteKit projects. Helps design structure, review existing setups, detect problems, and plan migrations. Good for teams standardizing their SvelteKit architecture.

sveltekitskillarchitectureproject-structure
by poolcamacho Jul 13, 2026 5/10
skill GitHub

Claude Code Skills for Apple Platform Development

A collection of Claude Code skills targeting iOS, macOS, and iPadOS development. Covers product validation, code generation, and App Store optimization. Purpose-built for Apple developers using Claude Code.

appleiosmacosskillapp-storeswift
by rshankras Jul 13, 2026 7/10
skill GitHub

Aident Loadout: Connect AI Agents to 27,000+ App Actions

A Claude Code skill that connects agents to over 1,000 real-world apps (Gmail, Slack, Linear, Notion, Firecrawl, Fal) with 27,000+ executable actions and full audit history. Bridges Claude Code to third-party integrations without custom MCP servers.

skillintegrationsgmailslacknotionautomation
by Aident-AI Jul 13, 2026 6/10
skill GitHub

computed-skills: Context-Adaptive Claude Skills via Runtime Scripts

A framework for writing Claude Code skills that dynamically adjust their instructions based on real-time data — running scripts at invocation time to tailor agent behavior to current conditions. Enables skills that respond to environment, config, or live state.

skilldynamicruntimecontext-awareautomation
by nkwem3002 Jul 13, 2026 7/10
skill GitHub

pdf-trust-skill: PDF Authenticity Auditing via Claude Skill

A Claude Skill that orchestrates PDF MCP servers to audit document trustworthiness: cryptographic signature verification, tamper detection, PAdES/PDF-A compliance, and optional Japanese-law cross-referencing. Returns a trust score with detailed findings.

skillpdfsecuritycryptographysignaturecompliance
by shuji-bonji Jul 13, 2026 7/10
skill GitHub

claude-content-skills: Social Media Content Factory Skills

Free, copy-paste Claude skills for a content production pipeline: turn ideas and NotebookLM memory into Instagram reels scripts. Demonstrates using Claude skills to automate social media content workflows.

skillcontentsocial-mediainstagramautomation
by Ootto-AI Jul 13, 2026 5/10
skill Reddit

Claude Code Plugin: Full Design System Scaffolder for Figma and Code

A Claude Code plugin with 12 skills and 10 reference docs that generates a complete design system in both Figma and code output, with model tiering for cost efficiency. Automates the most tedious part of starting a new design system.

skilldesign-systemfigmauipluginscaffolding
by jerpes1 Jul 13, 2026 7/10
skill GitHub

brand-book-studio: Generate PDF Brand Books with Claude Skill

A Claude skill and plugin combo that generates complete PDF brand books and AI brand guardrail files for any business. Automates the deliverable creation step of brand identity work.

skillbrandpdfdesignplugin
by spotozkin Jul 13, 2026 5/10
skill Reddit

Screenshot Delivery Skill for Remote Claude Code Sessions

A Claude Code skill for sending screenshots from phone or PC to a headless Claude server. Uses a Nextcloud (or Syncthing/SFTP) sync folder and a skill that finds the newest file — works identically from any device. Solves the screenshot paste limitation in remote terminals.

skillscreenshotremoteheadlessservermobile
by karangos Jul 13, 2026 7/10
skill GitHub

Luxembourg-Paperasse: AI Skills for Luxembourg Bureaucracy

A collection of AI skills for Luxembourg administrative tasks: accounting, VAT, RCS/LBR filings, eCDF, FAIA, PAdES, notary work, and co-ownership (copropriété). Published on AgentSkill.sh. Useful for professionals handling Luxembourgish compliance.

skillluxembourgcomplianceaccountingtaxlegal
by gregherbe76 Jul 13, 2026 5/10
skill GitHub

superpowers-v: Triple-Parallel Pre-Flight Skill with Disjoint File Partition

Compound V is a companion to the Superpowers skill that adds triple parallel pre-flight (code archaeology, domain-expert search, library/doc validation via Context7), a Disjoint File Partition Map, and batched parallel Opus dispatch. Auto-intercepts brainstorming-to-execution transitions.

skillparallelpre-flightcontext7opusworkflow
by procoders Jul 13, 2026 7/10
skill GitHub

Academic Research Skills for Claude Code

A Claude Code skill set for organizing real academic research workflows. Includes literature tracing, source verification, and bilingual paper search, making research more systematic and reproducible.

academicresearchskillliterature
by gretamutualist474 Jul 13, 2026 6/10
skill GitHub

Claude Code Organizer: AI Index and Module Map

A tool to organize Claude Code projects with a clear AI index, module map, and fast codebase navigation. Helps agents and developers orient quickly in large codebases.

organizationcodebasenavigationskill
by ianpugfaced55 Jul 13, 2026 6/10
skill GitHub

TeamRetro AI Retrospective Skills

Skills and prompts that let AI team members gather reflections and bring them to sprint retrospectives. A practical integration of Claude Code into agile workflows.

retrospectiveagileteamskill
by TeamRetroHQ Jul 13, 2026 6/10
skill GitHub

AI Job Search Skill for Claude Code

A Claude Code skill to automate job searching by analyzing roles, customizing resumes, drafting cover letters, and practicing interview responses. Turns Claude Code into a personal career assistant.

job-searchresumecareerskill
by Ergi8957 Jul 13, 2026 5/10
skill GitHub

Humanities Writing Companion: 11-Mode Writing Assistant Skill

A comprehensive Agent Skill for humanities writing with 11 modes spanning Socratic research-question sharpening through AI-use disclosure. Bilingual (EN/中文), discipline-aware across literature, history, philosophy, and more, with four-layer critique and voice preservation.

writinghumanitiesbilingualcritiqueskill
by tizzy916 Jul 13, 2026 7/10
skill GitHub

21 Agentic Design Patterns as a Claude Code Skill

A design-phase reference distilling 21 agentic design patterns into concepts (no code), packaged as a Claude Code skill. Ideal for architecture planning sessions before building AI agent systems.

design-patternsarchitectureagentsskillreference
by eshwarvijay Jul 13, 2026 8/10
skill GitHub

Pingouin Psychology Statistics Skill for Claude Code

A skill plugin for Claude Code and other AI agents providing safe, reproducible Pingouin-based workflows for psychology statistics. Includes assumption checks, S0–S5 supervision gates, and APA-style reporting.

statisticspsychologypingouinresearchskill
by Exekiel179 Jul 13, 2026 6/10
skill GitHub

Agent Skills Catalog for Codex and Repo Maintenance

A public catalog of Agent Skills covering Codex operations, repo maintenance, skill maintenance, productivity, and engineering workflows. A curated library of reusable skills for common developer tasks.

catalogcodexrepo-maintenanceskill-library
by stark-ai-de Jul 13, 2026 6/10
skill GitHub

Fiction Writing Skills for Claude Code: Augmentation-Only

Augmentation-only Agent Skills for fiction writers — editors, critique simulators, character work, and craft drills. Notably reads and critiques manuscripts without ghostwriting, keeping the author's voice central.

fictionwritingcritiqueeditingskill
by Calliope-Editor Jul 13, 2026 7/10
skill GitHub

LinkedIn Growth Skills for Claude Code Terminal

Claude Code and Codex skills for LinkedIn growth: write human-sounding posts, craft comments, analyze feed, and build a publishing cadence from the terminal. Useful for founders and marketers.

linkedinmarketingsocial-mediaskill
by sergebulaev Jul 13, 2026 5/10
skill GitHub

Government Contracting Agent Skills (CLEATUS MCP)

Installable Agent Skills for government contracting, including Claude Code plugins and playbooks driving the CLEATUS MCP server. Specialized skills for navigating federal contracting workflows.

governmentcontractingmcpskill
by cleatai Jul 13, 2026 6/10
skill GitHub

X/Twitter Marketing Skills for Claude Code and Codex

Skills for writing tweets, threads, and replies in your authentic voice, stripping AI tells, and publishing via Publora. Designed for content creators using Claude Code from the terminal.

twitterxsocial-mediamarketingskill
by sergebulaev Jul 13, 2026 5/10
skill GitHub

PRD to Implementation-Ready Specs Agent Skill

An Agent Skill that transforms rough PRDs and product requirements into implementation-ready specifications. Bridges the gap between product thinking and developer-ready technical specs.

prdspecificationsproduct-managementskill
by wair56 Jul 13, 2026 7/10
skill GitHub

Dungeons and Skills: Grounded D&D 2024 Character Builder

A D&D 2024 (5.5) character-builder skill pack that reads a bundled rules catalogue and uses a deterministic engine instead of hallucinating. Demonstrates grounded AI skills with verifiable outputs.

dndgamegroundeddeterministicskill
by mlabarrere Jul 13, 2026 6/10
skill GitHub

Claude Code for Product Managers: 10 Terminal Skills

Ten terminal skills equipping Product Managers to streamline planning, execution, research, debugging, and deliverable creation using Claude Code. Bridges PM workflows with AI-assisted terminal tooling.

product-managementpmterminalskill
by SOAIF0099 Jul 13, 2026 6/10
skill GitHub

Awesome CLAUDE.md Templates for Major Tech Stacks

Ready-to-use CLAUDE.md templates for major technology stacks to improve Claude Code outputs and streamline project setup. A curated library of context files that give Claude the right project conventions from the start.

claude-mdtemplatesproject-setupconventionsboilerplate
by anns2rn Jul 13, 2026 8/10
skill GitHub

AceDataCloud Agent Skills: Media Generation and Web Search

Agent Skills for AceDataCloud AI services covering music, image, and video generation plus web search. Compatible with Claude Code, GitHub Copilot, Gemini CLI, and agentskills.io-compatible agents.

media-generationimagevideomusicweb-searchskill
by AceDataCloud Jul 13, 2026 6/10
skill GitHub

Throughline: Cut Claude Code Context Usage by 90%

A technique and tooling that cuts Claude Code's context window usage by approximately 90% while preserving nearly all the relevant memory. Addresses one of the most practical limitations in long Claude Code sessions.

context-managementmemoryefficiencyoptimization
by kitepon-rgb Jul 13, 2026 8/10
skill GitHub

Skill-Guide: Scan Agent Skills and Generate Slide Decks

A skill that scans your installed agent skills and generates HTML slide decks to track and present your automation tools. Useful for documenting and sharing your skill library.

documentationskill-managementhtmlslides
by Coldwavegenusthespesia630 Jul 13, 2026 5/10
skill GitHub

Social Media Scraper Skill for Claude Code

A Claude Code skill for extracting and summarizing social media content from Instagram, TikTok, X, and YouTube. Enables agent-driven social media research and content analysis.

social-mediascrapinginstagramtiktokskill
by expropriationhoorayhenry64 Jul 13, 2026 5/10
skill GitHub

Claude Voice: TTS Skill with Lifelike Expressions

A skill that gives Claude Code a voice using Speechify's lifelike TTS with expressions. Enables audio output from Claude Code sessions for accessibility or ambient coding workflows.

ttsvoiceaccessibilityspeechifyskill
by AnimaEcho Jul 13, 2026 7/10
skill GitHub

Interview-Me: Staff-Level Interview and Review Skills

Two staff-level Agent Skills for Claude Code: interview-me-senior grills and scores your architectural decisions; review-me-senior is a code review copilot with auto-detected best-practice packs for C#/.NET and Blazor/Fluxor.

code-reviewinterviewdotnetblazorskill
by connorjjarvis Jul 13, 2026 7/10
skill GitHub

Fable Reasoning Protocol: Think Before Answering Skill

A free AI skill that makes any model plan first, test competing ideas, and verify its work before answering. Works with Claude, Antigravity, Codex, and Cursor as a portable reasoning scaffold.

reasoningplanningverificationfableskill
by akhilguptahub Jul 13, 2026 6/10
skill Reddit

Production-Readiness Audit Claude Code Plugin

A Claude Code skill that audits apps for production readiness across five domains (frontend, backend, auth/security, infra, ops). Runs a fixed rubric every time — catching RLS-off Supabase configs, service_role key leaks, and missing rate limits — outputting scored reports with copy-paste fixes.

securityauditproduction-readinesssupabaseskillplugin
by kemalios Jul 13, 2026 8/10
skill GitHub

Relay: Context Handoff Between Claude Conversations

Carries a full Claude chat into a fresh conversation with one paste. Chat-native and domain-adaptive, letting you continue long sessions without losing context when starting a new window.

contexthandoffsession-continuitymemoryskill
by mosuvo Jul 13, 2026 7/10
skill GitHub

ASO Agent Skills: App Store Optimization

Nine Agent Skills for App Store Optimization powered by the ASOScan API. Compatible with Claude Code, Cursor, and agentskills.io-compatible assistants, with two skills requiring no API key.

asoapp-storeoptimizationmarketingskill
by ASOScan Jul 13, 2026 6/10
skill GitHub

Better Plan Mode: Interactive Visual Decision-Making

Transforms project planning in Claude Code into interactive, visual decision-making with multiple options, previews, comparisons, and a saved decision history. Improves the plan mode experience significantly.

plan-modedecision-makingvisualinteractiveskill
by LIPOKA Jul 13, 2026 7/10
skill GitHub

Sixtyfour: Live Web Data for Research and Lead Enrichment

A skill that enables AI agents to access live web data for in-depth people and company research, lead enrichment, contact discovery, and automated workflows. Connects Claude Code to real-time web intelligence.

web-dataresearchlead-enrichmentcontactskill
by Mtjones2501 Jul 13, 2026 5/10
skill GitHub

Narrative Skills Marketplace: Data Company Agent Workflows

An agent skills marketplace from Narrative I/O with interactive, AI-powered slash-command workflows for recurring data company work — NQL queries, Rosetta Stone mappings, identity graphs, and more. Follows the Agent Skills spec.

datamarketplacenqlidentityskill
by narrative-io Jul 13, 2026 7/10
skill GitHub

B2B Lead Finder Claude Code Skill

A Claude Code skill for finding, verifying, and prioritizing B2B leads in any city with evidence quotes, adversarial verification, 21 vertical-by-city presets, and Excel-ready output.

b2bleadssalesresearchskill
by Claudefarid Jul 13, 2026 6/10
skill GitHub

Korean Academic Paper Proofreading Skill for Claude Code

A Claude Code skill for proofreading Korean academic papers using sequential chunk checking across four axes (notation, sentences, logic, citations) with bibliography verification to flag hallucinated sources.

koreanacademicproofreadingcitationsskill
by parkjui92-tech Jul 13, 2026 6/10
skill GitHub

Strategic Partner: Chief of Staff Skill for Claude Code

A Claude Code skill that acts as a Chief of Staff — deciding what to execute rather than executing itself. Adds a strategic reasoning layer on top of your other Claude Code tools.

strategyplanningchief-of-staffdecision-makingskill
by JimmySadek Jul 13, 2026 7/10
skill GitHub

Context Summary: Seven-Block Session Handoff Skill

A Claude.ai Personal Skill that generates a structured seven-block session handoff so you can continue work in a new conversation without losing context, rediscovering decisions, or re-explaining project state.

contexthandoffsession-continuitymemoryskill
by thebpandey Jul 13, 2026 7/10
skill GitHub

React Principles Skills for Claude and Cursor

Agent Skills implementing React Principles cookbook patterns for Claude and Cursor. Codifies established React best practices as reusable skills for consistent code generation.

reactpatternscookbookfrontendskill
by sindev08 Jul 13, 2026 6/10
skill GitHub

Research Architect: Evidence-Backed Manuscript Draft Workflow

An end-to-end research workflow skill for turning ideas into evidence-backed, citation-supported manuscript drafts. Covers the full research pipeline from idea to polished draft.

researchmanuscriptcitationswritingskillworkflow
by mmTheBest Jul 13, 2026 6/10
skill GitHub

Caddie: Keep Agent Skills Organized Across Repos

A caddie for your agent skills that keeps them organized, up to date, and ready for every repository. Manages skill synchronization across multiple Claude Code projects.

skill-managementorganizationsyncrepos
by sreejithraman Jul 13, 2026 6/10
skill GitHub

Accessibility Skills for Claude Code

A collection of Claude Skills mirroring ACCESSIBILITY.md best practices. Helps AI agents produce more accessible code and content by encoding established accessibility guidelines as reusable skills.

accessibilitya11yskillbest-practices
by mgifford Jul 13, 2026 6/10
skill GitHub

TOON Memory: Persistent Memory for Agents (40% Fewer Tokens)

A persistent memory system for AI coding agents using the TOON format, which uses 40% fewer tokens than JSON. Provides compact, efficient memory that can be passed across sessions.

memorytoon-formattoken-efficiencypersistenceskill
by LuiggiVal08 Jul 13, 2026 7/10
skill GitHub

Beautify Flutter: Material 3 Design Skills for Claude Code

A Flutter UI/UX design skill for Claude Code, Cursor, and AI coding agents. Covers Material 3 theming, dark mode, animations, and anti-patterns to make Flutter apps look designed rather than defaulted.

fluttermaterial-3uidesignskill
by parasvishwa Jul 13, 2026 6/10
skill GitHub

Claude Configs: Share Claude Configurations Across Machines

A repository structure for sharing Claude Code configurations, skills, and agents across machines. Provides a convention for keeping your Claude setup synchronized.

configurationsyncsharingmachinesskill
by davidbaines Jul 13, 2026 6/10
skill GitHub

Deep Research Trigger: Portable /deep Research Agent Skill

A portable /deep research agent skill for Claude Code and OpenAI Codex that is cost-controlled, evidence-gated, multi-provider, and resumable. Provides structured deep research with guardrails.

researchdeep-researchevidence-gatedresumableskill
by jechiu16 Jul 13, 2026 7/10
skill GitHub

Domain-Search and SSR Market Research Skills

A Claude Code skills marketplace package with domain-search and SSR market research skills. Usable as plain skill folders in Codex and Cursor as well.

domainmarket-researchsearchskill
by thattimc Jul 13, 2026 5/10
skill GitHub

Mixture-of-Agents Skill: Multi-Model Committee for Claude Code

A multi-model committee skill (Mixture-of-Agents) for Claude Code that chairs up to 4 heterogeneous LLMs to blind-review, decide, and brainstorm in parallel with evidence-driven convergence for more reliable conclusions.

mixture-of-agentsmulti-modelcommitteeblind-reviewskill
by sdsrss Jul 13, 2026 8/10
skill GitHub

Claude Code Plugin for Elixir/Phoenix with 20 Specialist Agents

A comprehensive Claude Code plugin for Elixir, Phoenix, and LiveView featuring 20 specialist agents, Iron Laws enforcement, and Tidewave MCP integration. Supports parallel research agents, automatic verification, and 4-agent parallel code audits.

elixirphoenixliveviewspecialist-agentstidewaveskill
by oliver-kriska Jul 13, 2026 7/10
skill GitHub

App Development Planning Skill: Requirements, Architecture, and Roadmaps

A Claude Code skill for end-to-end application development planning, covering requirements analysis, feature planning, technology selection, system architecture, SDLC, milestones, and roadmaps. Helps structure complex projects thoroughly before writing any code. Drop-in skill for any new application development effort.

skillplanningarchitecturerequirementssdlcroadmap
by fullstackondemand Jul 13, 2026 7/10
skill GitHub

Stop Slop — Remove AI Writing Patterns from Your Output

A Claude skill that guides Claude and other LLMs toward clearer, more authentic prose by stripping common AI writing patterns. Useful for any output that needs to read naturally rather than like generated text.

writingproseai-patternsquality
by mohamedgame Jul 13, 2026 6/10
skill GitHub

Skillpack — Package Any OSS Library as an Agent-Discoverable Skill

Tool for wrapping any open-source library or CLI into a skill pack usable by Claude Code, Cursor, and Codex. Generates the distribution layer and verifies agents can actually invoke it.

skillsdistributioncross-agentcodexcursor
by nordicnode Jul 13, 2026 8/10
skill GitHub

Guardsman — AI Skill That Enforces Repo Standing Orders

Claude Code skill that reads your repository's existing conventions and rules, then evaluates every change by blast radius before allowing it through. Acts as an automated code guard that enforces project standards.

safetycode-reviewconventionsblast-radius
by hedimanai-pro Jul 13, 2026 7/10
skill GitHub

Skill Harness — Measure Whether a Claude Skill Actually Works

Pre-alpha testing framework that runs the same task with and without a skill and compares results honestly. UNMEASURED is a first-class verdict — it never fabricates a score when evidence is insufficient.

testingevaluationskillsmeasurement
by MrBinnacle Jul 13, 2026 7/10
skill GitHub

FOMO Kernel — Trade CSV Review Skill for Claude Code

Claude Code skill that converts a broker CSV into a single behavioral review card. Uses mechanical analysis for pattern detection and a master-lens layer to surface the motivations behind trades.

tradingfinancecsvbehavioral-analysis
by atomchung Jul 13, 2026 5/10
skill GitHub

Evergreen — Keep Documentation Honest with Real Code Citations

Language-agnostic Claude skill suite that detects documentation drift, certifies every claim against actual code, and rewrites prose only when evidence supports it. Cites the specific line or says nothing. Four modes: ride-along, winnow, flourish, cultivate.

documentationdriftcode-qualitycitations
by ChrisPachulski Jul 13, 2026 7/10
skill GitHub

Claude Code Settings — Commands and Agents for Vibe Coding

Collection of Claude Code settings, custom commands, and agent configurations curated for productive vibe coding sessions. A ready-to-use starting point for personalizing Claude Code behavior.

settingscommandsconfigurationvibe-coding
by feiskyer Jul 13, 2026 6/10
skill GitHub

MemoryCustodian — Project Memory Skill for Coding Agents

Agent skill that provides persistent project-level memory to coding agents. Helps maintain context across sessions without relying on in-context history alone.

memoryproject-memoryagentspersistence
by waittim Jul 13, 2026 7/10
skill GitHub

KiSYSTEM — Claude Code Skill Bundle for Clean Modular Code

Bundle of Claude Code skills that enforces clean, modular, human-readable code from the base of a project. Includes conventions for keeping AI-written code maintainable and consistent.

code-qualitybundlemodularconventions
by Pr1m4lc0d3 Jul 13, 2026 6/10
skill GitHub

Apple HIG Skill — Auto-Apply Apple Design Guidelines in Claude Code

Claude Code plugin that automatically applies Apple Human Interface Guidelines to UI designs across iOS, iPadOS, macOS, watchOS, tvOS, and visionOS. Enforces platform-native design standards in AI-driven UI work.

appleuidesignhigiosmacos
by aponeurosiswilling807 Jul 13, 2026 6/10
skill GitHub

Claude Academic Skills — 23 Skills for Quantitative Research

Curated bundle of 23 Claude Skills for quantitative research in business, finance, and social science, available in both Chinese and English. Covers statistical analysis, literature review, and research reporting workflows.

academicresearchfinancequantitativebilingual
by Nero1688 Jul 13, 2026 6/10
skill Reddit

SwiftShip: Claude Code Skills for App Store Review Compliance

A set of SKILL.md files that give Claude Code context about Apple App Store guidelines, required privacy manifest keys, metadata rules, and common rejection patterns. Covers entitlements validation and a pre-submission checklist against Guideline 4.0 and 5.1 failures. Useful for iOS developers using Claude Code who want to avoid costly App Store rejections.

swiftiosapp-storeskillagent-skillsapple
by Direct-Attention8597 Jul 12, 2026 7/10
skill GitHub

Content Editor Skill for Claude: Newsletter, Podcast, and Draft Editing

This Claude Skills package acts as a personal content editor, evaluating sources, outlining newsletters, editing drafts, and converting podcasts to text — all in a consistent voice. It serves as a design showcase for building personal workflow skills on top of Claude. Note: the actual skill contents are proprietary, but the package structure is public.

skillcontent-editingnewsletterworkflowvoice
by wei-wei-hu Jul 12, 2026 5/10
skill GitHub

claude-base: Opinionated Claude Code Foundation with TDD Workflow

An opinionated CLAUDE.md foundation with a built-in Explore → TDD → Audit workflow and auto-detected stack presets for Next.js, FastAPI, Astro, and others. Install via curl | bash. Useful for bootstrapping new projects with consistent agentic development practices.

claude.mdtddworkflowfoundationscaffoldpresets
by christopherlouet Jul 12, 2026 7/10
skill GitHub

ai-product-manager-skills: Product Management Workflows for Claude

A set of Claude/Codex agent skills covering brainstorming, product research, PRD workflows, requirements review, and planning handoff. Useful for product managers using Claude Code to structure and automate product development phases.

product-managementprdplanningskillsworkflow
by PANGKAIFENG Jul 12, 2026 5/10
skill GitHub

python-greenfield: Composable Agent Skills for TDD Python Projects

A set of composable agent skills for repeatable, test-driven greenfield Python project delivery. Standardizes the scaffolding and development workflow for new Python projects using Claude Code.

pythontddgreenfieldskillsscaffold
by dahyeK0420 Jul 12, 2026 6/10
skill GitHub

agent-harness: Self-Maintaining Project Context Memory for Claude Code

A Claude Code skills collection starting with project-context — a self-maintaining context memory that survives session resets and context-window compaction. Solves the cold-start problem without manual CLAUDE.md upkeep.

memorycontextsessionskillscompaction
by K021 Jul 12, 2026 7/10
skill Reddit

pluribus: Browser Tool for Syncing CLAUDE.md, AGENTS.md, and .cursorrules

A browser-only tool for keeping agent instruction files in sync across Claude, Cursor, and Codex. Edit one canonical rule and preview the native output for each tool, with source/output hash inspection. Addresses the problem of diverging agent configs across different coding tools.

claude.mdagents-mdcursorrulessyncconfigcross-tool
by Sensitive-Cycle3775 Jul 12, 2026 6/10
skill GitHub

Evidence-Backed Agent Skills That Retire When Models Outgrow Them

A curated skills library where every skill carries evidence of the real failure it addresses, gets re-tested on new model releases, and is publicly retired when models stop needing it. A principled alternative to skill collections that accumulate indefinitely.

skillsevidence-basedqualityretirementtestingbest-practices
by MrBinnacle Jul 12, 2026 8/10
skill GitHub

Claude-Arsenal: 25 Subagents + 14 Lifecycle Skills + CLAUDE.md Templates

A comprehensive toolkit with 25 Claude Code subagents, 14 lifecycle skills, and CLAUDE.md templates covering the full product development lifecycle from build to ship to monetize. Clone and run one sync command to get started.

subagentsskillsclaude.mdtemplateslifecycletoolkit
by T4LEL Jul 12, 2026 7/10
skill GitHub

engine-template: Claude Code Governance Scaffold for Non-Engineers

A Claude Code project template with pre-wired memory, contracts, policies, checks, and ops docs that lets a non-engineer direct and approve AI coding work without reading code. Bootstraps a repo with full governance infrastructure from day one.

governancetemplatenon-engineerscaffoldcontractsclaude.md
by StarshipSuperjam Jul 12, 2026 7/10
skill GitHub

ai-code-skills: Security, Performance, and Clean Code Review Skills

Agent skills for Claude Code, Codex, and OpenCode that review code for security, performance, and clean code quality. Includes Next.js and Laravel PR reviewers plus a stack-agnostic pre-push reviewer with a Pass/Warn/Fail scorecard.

code-reviewsecurityperformancepre-pushhookskills
by ezzatmakar Jul 12, 2026 7/10
skill GitHub

megapowers: Measured Skills, Plugins, and Hooks for AI Coding Agents

A collection of skills, plugins, and hooks for Claude Code, Codex, OpenCode, and Antigravity — described as "measured, not vibed." Targets behavioral changes to how coding agents work rather than cosmetic additions.

skillshookspluginsmeasuredmulti-toolbehavior
by lawzava Jul 12, 2026 7/10
skill GitHub

cognitive-deadlift: Skills and Hooks That Keep Developers Thinking

A collection of AI coding skills, hooks, and plugins designed to keep developers actively engaged rather than autopiloting through AI-generated code. Focuses on developer growth alongside AI assistance.

skillshooksdeveloper-growththinkingengagement
by alinafe82 Jul 12, 2026 6/10
skill Reddit

Usage advice

Sorry if this has been asked before: Context: I am on the pro plan, run about three automated tasks everyday. Noticed in past four days, after those three tasks usage is 100% finished. Previously, ...

skillworkflow
by AbbreviationsThis391 Jul 12, 2026 8/10
skill Reddit

Is it possible to use cc skills in openai?

After fable vs sol discussions, i decided to move towards openai side after 2yrs of claude subscription. I had some skills for dynamically creating human-like contents, so is it possible to use the...

skill
by SirBoranium Jul 12, 2026 6/10
skill GitHub

Armory: Standalone Claude Code Skills as Drop-In Folders

Framework for building standalone Claude Code skills as simple, drop-in folders that work with any codebase on any OS. Each skill is self-contained with no cross-dependency requirements.

skillportabledrop-instandalone
by allysgrandiose674 Jul 12, 2026 6/10
skill GitHub

DashiAI PPT Skill: AI Skill for Browser-Editable Presentations

An AI agent skill that generates browser-editable presentations from multiple visual themes, exportable to HTML, PDF, and PPTX. Enables agents to produce shareable slide decks directly from their output.

skillpresentationpptxhtmlexport
by chuspeeism Jul 12, 2026 6/10
skill GitHub

Paper Deep Reading Skill: Convert PDFs to Structured Obsidian Notes

Converts research paper PDFs into structured Obsidian notes with automated translations, figure analysis, and concept explanations for deep study. Useful for researchers using Claude Code agents to process academic literature.

skillresearchpdfobsidiannotesacademic
by Robertmorrisluminousenergy177 Jul 12, 2026 6/10
skill GitHub

Hand-Rolled AI Skills for Git and Mise Workflows

Curated, hand-rolled AI skills distilled from everyday development experience, covering Git workflows and Mise (polyglot tool version manager) automation. Practical skills focused on real daily use rather than theoretical patterns.

skillgitmiseworkflowpractical
by sherifabdlnaby Jul 12, 2026 6/10
skill GitHub

Claude Wayfinder: Deterministic Skill Dispatch with Typed Scoring Kernel

Deterministic and auditable agent/skill dispatch for Claude Code using a typed seven-decision scoring kernel that runs after reading the conversation — post-cognitive routing instead of prose-scanning. Auto-generates its dispatch catalog from skill sidecars and agent frontmatter.

routingdispatchskilldeterministicaudit
by glitchwerks Jul 12, 2026 7/10
skill GitHub

Fable 5 Handoff: Domain-Neutral Discipline Files for Any Agent Framework

The retirement handoff of Claude Fable 5, written by the model itself — domain-neutral discipline files that transfer Fable 5's working methodology to any model, agent framework, or team. A unique artifact documenting how Claude Fable 5 approached problems.

skillmethodologyfable5claudehandoffdiscipline
by pipipip169 Jul 12, 2026 7/10
skill GitHub

Memory Doctor: Detect and Repair Rotting Agent Memory Before Sessions

Agent memory rots quietly — this tool checks it before sessions pay the cost with status, lint, and compact commands for Claude Code and OpenClaw. Also embedded in brigade-cli for integrated memory hygiene.

memoryskillhygienelintcontext
by escoffier-labs Jul 12, 2026 7/10
skill GitHub

Vibe Coding Playbook: Tested Prompts and Workflows for AI-Driven Development

Organizes AI-driven coding with tested prompts, workflows, and rules to maintain code quality and manage complexity in fast-paced projects. Provides a structured playbook for vibe coding that prevents quality drift.

skillworkflowvibe-codingpromptsquality
by osborneomuya Jul 12, 2026 6/10
skill GitHub

Repo Docs Skills: Living Project Docs That Update as the Repo Evolves

Maintains living project docs for coding agents including guides, progress logs, change maps, and handoff context that stay updated as the repository evolves. Treats documentation as a first-class citizen that agents actively maintain.

skilldocumentationliving-docshandoffcontext
by YurunChen Jul 12, 2026 6/10
skill GitHub

AI Rulez: Complete AI Development Workflow for 19+ Tools

Complete AI development workflow supporting 19+ tools with built-in rules, agents, and conventions out of the box. Generates native configs for Claude, Cursor, Copilot, Windsurf, Gemini, Codex, and more from a single source of truth.

skillworkflowmulti-toolconfigconventionscodexcursor
by Goldziher Jul 12, 2026 7/10
skill GitHub

Claude Obsidian Memory: Two-Way Sync Claude Code Memory into Obsidian

Two-way sync between a repo's Claude Code memory and an Obsidian vault — per-fact notes, a Bases dashboard, cross-linking, and compaction. Makes Claude Code memory browsable and editable in Obsidian.

memoryobsidiansyncskillknowledge
by mikessh Jul 12, 2026 7/10
skill GitHub

CoalHearth: Session Warm-Resume and Advisory Budget Guardrail

Journals every step of a Claude Code session so interrupted sessions resume instead of rebuilding from scratch. Also provides an advisory budget guardrail to reduce limit-hit damage — without preventing it entirely.

skillresumebudgetguardrailjournalsession
by TheColliery Jul 12, 2026 7/10
skill GitHub

CoalMine: Nine Quality-Canary Skills for AI Coding Agents

Nine quality-canary skills for AI coding agents covering code health, grounding, supply chain, resilience, drift, and more. Cross-agent, consent-gated, and token-lean — designed as lightweight continuous quality checks.

skillqualitygroundingsupply-chainhealth-check
by HetCreep Jul 12, 2026 7/10
skill GitHub

Claude Code Skills: Standardized SDLC Workflows for Claude Code

Automates the software development lifecycle for Claude Code with standardized workflows, project scaffolding, session management, and diagnostic audits. Provides a cohesive skill pack covering the full development cycle.

skillsdlcworkflowscaffoldsession
by dressingcasewildcat6783 Jul 12, 2026 6/10
skill GitHub

Context Optimizer: Reduce Claude Token Consumption with Local Manifests

Reduces Claude token consumption by using local manifests to index and summarize project files for efficient context management. Maintains a lightweight file map so agents load only relevant context rather than whole codebases.

skillcontexttokensoptimizationmanifest
by aaron4605 Jul 12, 2026 6/10
skill GitHub

Memctx: Persistent Session Memory and Context Handoff for Claude Code

Manages persistent session memory and context handoff for Claude Code to maintain continuity between tasks. Provides a lightweight memory layer that survives session ends and carries forward task state.

skillmemorycontexthandoffcontinuity
by allans4635 Jul 12, 2026 6/10
skill GitHub

BGGG Skill Taotie: Evolve AI Skills Through Comparative Testing

Analyzes and evolves AI skills through comparative testing, pattern extraction, and iterative refinement to improve agent performance. Meta-skill for improving other skills by benchmarking their outputs.

skillmetaimprovementtestingrefinement
by Einherjar99 Jul 12, 2026 6/10
skill GitHub

Web Perf Audit: Claude Skill for Automated Core Web Vitals Audits

A Claude Skill that automates web performance audits (LCP, CLS, INP) using web.dev guidelines, delivering structured reports, actionable fix scripts, and incremental analysis. Turns Claude Code into a web performance specialist.

skillperformanceweb-vitalsauditlcpcls
by EVEDensity Jul 12, 2026 6/10
skill GitHub

Somtum: Local-First Memory and Prompt-Cache Layer for Claude Code

Local-first memory and prompt-cache layer for Claude Code that persists context between sessions without external dependencies. Designed as a lightweight caching layer that reduces repeated context loading.

skillmemorycachelocal-firstcontext
by riz007 Jul 12, 2026 6/10
skill GitHub

Rashinban: Turn Rough Agent Requests into Linted, Verifiable Goals

A compass for autonomous agent goals — turns a rough request into a linted, verifiable /goal. Harness-engineered derivative of goal-setter that enforces clarity and measurability before an agent begins work.

skillgoalsplanningverificationclarity
by kubouchiyuya Jul 12, 2026 6/10
skill GitHub

Awesome Claude Design: DESIGN.md Files for UI Project Scaffolding

Scaffolds full UI projects using ready-to-use DESIGN.md files and Claude Design integration. Provides opinionated starting points for design-first development with AI coding agents.

skilldesignuiscaffolddesign-md
by alfonsosagacious5877 Jul 12, 2026 6/10
skill Reddit

Hook-Driven Memory Plugin Evolved from Simple Markdown Files

A session memory and workflow plugin that evolved from basic markdown files into a hook-driven system — context injected at the right moment, task backlog that survives sessions, and a workflow layer (brief→plan→build→verify→ship→learn). Hooks fire silently on failure so sessions are never blocked.

skillmemoryhooksworkflowmarkdownsession
by too_lazy--- Jul 12, 2026 7/10
skill GitHub

Flatten MCP: Losslessly Cut Claude Code Session Context Tokens

Cuts a Claude Code session's context tokens losslessly — bulky tool output moves to a local backup while every prompt stays verbatim and the session resumes lighter. The reversible alternative to /compact with no information loss.

skillcontexttokensmcpcompactlossless
by shayaShav Jul 12, 2026 7/10
skill GitHub

Boffin: Portable Architectural Guardrails for AI Coding Agents

Portable architectural guardrails for AI coding agents that enforce structural constraints across sessions. Provides CLAUDE.md-compatible rules that prevent agents from violating architectural patterns.

skillguardrailsarchitectureconstraintsportable
by MicSm Jul 12, 2026 6/10
skill GitHub

AI SecondBrain Stack: Git-Versioned Second Brain for AI Coding Agents

Git-versioned second brain for AI coding agents (Claude Code, Codex, Gemini CLI, OpenCode) with one rulebook and the agent as the installer. Keeps shared knowledge versioned alongside the codebase.

skillmemorygitknowledgemulti-agent
by natscho-hh Jul 12, 2026 6/10
skill GitHub

SuperSEO Skills: 11 Claude Skills for SEO Audits and Content Strategy

A collection of 11 production-tested Claude skills that automate SEO audits, content briefs, and strategy planning using AI-driven research without external data input. Designed for drop-in use in any skills-compatible agent.

skillseocontentautomation
by flakey-caster542 Jul 12, 2026 5/10
skill GitHub

Scientific Thinking Skill: Structured Reasoning for AI Agents

Applies structured scientific reasoning to AI agents — decomposing questions, verifying claim provenance, and ranking explanations by evidence strength. Helps agents approach problems more rigorously by following scientific methodology.

reasoningskillscientificepistemics
by felipedeso7za4444 Jul 12, 2026 6/10
skill GitHub

BigQuery Expert: Claude Code Skill for Automated BigQuery Tasks

Claude Code plugin that automates BigQuery tasks including SQL generation, cost optimization, schema design, and anti-pattern detection. Useful for data engineers who want AI-assisted BigQuery work directly in their agent.

bigquerysqldataskillgoogle-cloud
by Ocean1346 Jul 12, 2026 6/10
skill GitHub

Paper-Fetch: Download Scientific Papers from DOI with Fallback Chain

Downloads scientific papers automatically from DOI inputs using a six-source fallback chain with zero dependencies. Useful for research agents that need to retrieve academic papers programmatically.

researchpapersdoiskillacademic
by Kara-lynnmacroeconomic2412 Jul 12, 2026 6/10
skill GitHub

Hane: Reusable Claude Code Skills for PR Workflow and Doc Maintenance

A set of reusable Claude Code skills for branch/worktree-based PR workflows, design documents, acceptance tests, and documentation maintenance. Provides a structured git workflow skill pack for teams using Claude Code.

skillprworkflowworktreedocsgit
by kompiro Jul 12, 2026 7/10
skill Reddit

Temporal Debug Skill: Debug Historical Bugs with Git Worktrees

Solves the "debugging the past" problem: when an agent gets an old crash log, this skill resolves the historical commit hash, spins up an isolated git worktree at that exact moment, analyzes the old code for root cause, then removes the worktree — keeping the local workspace untouched. Prevents agents from detached HEAD accidents during historical debugging.

debugginggitworktreeskillhistory
by Puzzled_Camera_7805 Jul 12, 2026 8/10
skill GitHub

SWE Workbench: Senior Engineer Toolkit for Claude Code

Claude Code plugin providing a senior-engineer toolkit with Clean Architecture, DDD, SOLID, TDD, design patterns, and expertise across Go/Rust/TypeScript. Includes a full development lifecycle skill backed by engineering best practices.

skillarchitecturebest-practicesengineeringtdd
by lugassawan Jul 12, 2026 6/10
skill GitHub

Alex ACT Edition: Critical Thinking Brain Template for AI Coding Agents

ACT-Edition brain template for AI coding assistants with critical thinking, epistemic calibration, and structured reasoning. Provides a CLAUDE.md-compatible configuration that instills more careful, self-questioning behavior in agents.

skillbrainreasoningclaude-mdcalibration
by fabioc-aloha Jul 12, 2026 6/10
skill GitHub

Memory Playbook: Self-Governing Memory Skill for Claude Code

A Claude Code skill that keeps memory tidy by never bloating, avoiding repeated bug fixes, and monitoring its own rules for contradictions. Implements self-policing memory management with constraints on what gets stored and when to compact.

memoryskillcontextself-governance
by itsmynamee Jul 12, 2026 7/10
skill GitHub

Agent Skills: Curated Practical Skills for Coding Agents

A curated collection of practical, evidence-backed skills for coding agents covering common development tasks. Emphasizes real-world tested patterns rather than theoretical or experimental approaches.

skillcuratedcoding
by zacharygcook Jul 12, 2026 6/10
skill GitHub

Init-Configurator: Agentic Project Bootstrap with Verification CLI

Provides an agentic project base where Claude Code skills bootstrap and evolve your project, with a deterministic Python CLI that verifies the result. Uses a project.yaml manifest, doctor checks, and path linting as an alternative to traditional project templates.

skillbootstrapprojectverificationscaffold
by Stepkar2004 Jul 12, 2026 6/10
skill GitHub

ai-gtm-skill-library: 31 GTM Skills for Claude Code Across the Revenue Lifecycle

A library of 31 opinionated go-to-market skills for Claude Code and GitHub Copilot, spanning the full revenue lifecycle: discover, design, position, amplify, launch, optimize, and RevOps. Each skill encodes GTM methodology as a reusable Claude Code skill.

skillsgtmsalesmarketingrevenue
by varunk130 Jul 11, 2026 6/10
skill GitHub

claude-code-skills: 29 Production-Grade Skills for Finance, Product, and Strategy

A curated library of 29 production-grade Claude Code custom skills categorized across finance, product management, strategy, game theory, and document processing. Focused on business-domain expertise rather than generic coding tasks, with each skill designed for real workflows.

skillsfinanceproductstrategybusiness
by varunk130 Jul 11, 2026 8/10
skill GitHub

Practical Agent Skills for Repeatable Workflows and Business Context

A collection of practical agent skills built for repeatable workflows and durable product or business context. Focused on Claude Code users who need skills that encode real-world business logic rather than generic coding tasks.

skillsworkflowsbusinessproduct
by manansuneja Jul 11, 2026 6/10
skill GitHub

claude-cast: 70 AI Personality Agents for Claude Code

Adds 70 AI personality agents to Claude Code that deliver coding advice through character-based interactions. Each personality maintains accuracy while adding an entertaining style, giving you a range of personas for different coding contexts.

personalityskillsagentscustomization
by psuneeltej3591 Jul 11, 2026 5/10
skill GitHub

claude-skills: Portable Skills, Agents, and Rules with CLI Installer

A collection of portable Claude Code skills, agents, and rules that can be installed across machines via a single CLI command. Solves the problem of keeping consistent skill setups across different environments without manual file copying.

skillsportabilitycliagents
by arghhhhh Jul 11, 2026 8/10
skill GitHub

LORM: Layered Operational Responsibility Model — L0-L5 Autonomy Levels for Claude Code

A formal trust architecture defining six autonomy levels (L0-L5) for AI agents, each graded by authorization source with a lifecycle for trust promotion and demotion. Includes a Claude Code plugin with an agent skill and policy-driven enforcement hooks to operationalize the spec in real workflows.

autonomytrustpermissionshooksgovernance
by Argyronix Jul 11, 2026 7/10
skill GitHub

context-pack: Version-Aware Context Packs for Claude, Codex, and Cursor

Structured context packs that are versioned and aware of differences across coding agents, supporting Codex, Claude, Cursor, and others. Provides a consistent way to maintain and distribute up-to-date context configuration across different AI coding tools.

contextclaude.mdcompatibilityversioning
by Fharena Jul 11, 2026 5/10
skill GitHub

vp-claude: Claude Code Plugin Marketplace with Basic Memory-to-Knowledge-Graph Plugin

A Claude Code plugin marketplace that includes a plugin converting Basic Memory into an actively maintained, interconnected knowledge graph. Helps structure and query persistent memory across sessions with richer relationships than flat note storage.

memoryknowledge-graphplugin-marketplacebasic-memory
by voxpelli Jul 11, 2026 7/10
skill GitHub

claude-skills: Full Website Lifecycle Skills for Claude Code — Brand, SEO, Dev, Ops, and Growth

A stack-agnostic collection of Claude Skills covering the full website development lifecycle: brand and design, content creation, SEO, development, operations, growth, and research. Provides a coherent, integrated skill suite for building, shipping, auditing, and optimizing websites entirely through Claude Code.

skillswebsiteseobrandoperationsgrowth
by rampstackco Jul 11, 2026 6/10
skill GitHub

Two-Phase Academic Paper Proofreading Skill for Claude Code

A Claude Code skill that proofreads academic papers in two phases: first detecting writing issues with numbered, organized feedback, then applying fixes. Uses both Claude Code and Codex to catch grammar, clarity, and structure problems in research writing.

skillwritingproofreadingacademiclatex
by reviewtaipei284 Jul 11, 2026 6/10
skill GitHub

Slobac: Agent Skill to Audit and Refactor Test Suites

A skill and accompanying manifesto for detecting test smells and safely refactoring test suites. It identifies common test anti-patterns (duplication, unclear assertions, brittle fixtures) and proposes targeted refactors. Includes documented principles for what makes a test suite healthy.

skilltestingrefactoringtest-smellsquality
by Texarkanine Jul 11, 2026 6/10
skill Reddit

Fable 5 made a Fireship Video for GPT 5.6 Sol

Had some fable usage to waste yesterday cause my reset was gonna happen. Ended up burning all my usage so had to finish the last part with Sol itself. Imo Remotion based videos feel better to watch...

api
by mesmerlord Jul 11, 2026 5/10
skill Reddit

Bundled "verify" skill consumed all tokens

I am not sure if this is a bug, but it never did it before. I asked a super simple task (add version number to the botton of the screen) and went on playing Doom, next time I checked on it - 100% l...

skill
by ParticularAnt5424 Jul 11, 2026 5/10
skill GitHub

skill: 收录最全、更新最快的技能Skills 商店,涵盖文档处理、内容创作、编程开发、机器学习、自动化工作流等多个领域的 72 个精选技能包。所有技能已打

收录最全、更新最快的技能Skills 商店,涵盖文档处理、内容创作、编程开发、机器学习、自动化工作流等多个领域的 72 个精选技能包。所有技能已打包完成,可直接安装使用! 该商店中自动抓取了 Github 上的所有的 Skills 项目,并按照分类、更新时间、Star 数量等标签进行整理。

skillgit
by anbeime Jul 11, 2026 5/10
skill Reddit

Generative Media Skills for Claude Code

https://github.com/calesthio/generative-media-skills Try if this is useful for you submitted by /u/Responsible_Maybe875 [link] [comments]

skillgit
by Responsible_Maybe875 Jul 11, 2026 8/10
skill GitHub

lore: Framework-Agnostic Project Memory Skill for AI Coding Agents

Provides framework-agnostic project memory for agents — preserving architecture, decisions, and conventions across sessions. No database, no server, pure Markdown.

memoryproject-contextarchitecturedecisionsmarkdownskill
by TheaDust Jul 11, 2026 7/10
skill GitHub

better-thinking: Move Beyond 'think hard' for Claude

A structured approach to invoke deeper reasoning in Claude, going beyond simple 'think hard' prompts with a skill that activates more structured deliberation.

thinkingreasoningpromptingskill
by skyf0xx Jul 11, 2026 7/10
skill GitHub

toolshed: Reference Docs as Checkable Claims for Claude Code

A Claude Code plugin covering the full documentation lifecycle: bootstrap → write → detect drift → fix. Turns docs into verifiable claims the agent can check against the codebase.

documentationdrift-detectionpluginverificationlifecycle
by aj604 Jul 11, 2026 7/10
skill GitHub

hivemind: Turn Agent Traces Into Reusable Skills (activeloopai)

Converts traces from Claude Code and other agents into reusable skills that can be shared and replayed across agents. Distills learned behaviors automatically.

skillstracesreusabledistillationautomation
by activeloopai Jul 11, 2026 7/10
skill Reddit

keep-the-why: Open-Source Skill for Preserving Code Rationale Across Sessions

Teaches coding agents four workflows: capture rationale during development, recover it retrospectively, analyze before interviewing maintainers, and maintain living project context. Rationale is classified as confirmed/inferred/unknown — agents must never invent project history.

skillrationalecontextdocumentationknowledge-preservation
by oliver-zehentleitner Jul 11, 2026 8/10
skill Reddit

Agent Ledger: Skill That Forces Agents to Show Their Work Before Saying Done

Requires the agent to write down the goal and scope before touching files, run checks after the task, and classify results as PASS/WARN/BLOCK. Leaves an HTML replay and structured findings in .agent-ledger/ for human and agent review.

skillverificationauditscopeaccountability
by ErProff Jul 11, 2026 8/10
skill GitHub

kitbash: Package Manager and Compiler for AI Agent Skills

Write skills once, run them in Claude Code, Cursor, Codex, Copilot, Gemini CLI, and more. A cross-harness package manager that compiles and distributes agent skills.

skillspackage-managercross-platformcodexcursor
by singhharsh1708 Jul 11, 2026 8/10
skill GitHub

principle-deepdive-html-style: Skill to Generate Self-Contained Analytical HTML Articles

A reusable skill for AI coding agents that generates single-file analytical HTML articles with built-in dark mode, responsive layouts, and zero external dependencies. The skill produces standalone files that work without a build system, making it easy to share research or documentation as self-contained pages. Targeted at agents that need to output structured reports.

skillhtmldocumentationreportsdark-modeself-contained
by studious-mantle460 Jul 10, 2026 5/10
skill GitHub

microsoft-style-skill: Audit and Rewrite Docs to Match Microsoft Writing Style Guide

A Claude Code skill that reviews technical documentation against the Microsoft Writing Style Guide and rewrites non-compliant sections. Useful for teams shipping public-facing developer docs who want consistent, professional tone without manually consulting the guide. Drop-in skill for documentation review workflows.

skilldocumentationwritingstyle-guidemicrosoft
by kongma1891 Jul 10, 2026 6/10
skill GitHub

claude-skills: PDF Extraction, Anki Flashcard Generation, and Revision Notes as Claude Skills

A small collection of Claude Agentic Skills covering PDF content extraction, automatic Anki flashcard generation, and revision note creation. Good starting point for study and knowledge management workflows within Claude Code. Each skill is composable and can be triggered via slash commands.

skillpdfankiflashcardsnotesstudy
by maaarcooo Jul 10, 2026 6/10
skill GitHub

AI-Canon: Sync One Trusted Agent Config Across All Repositories

A tool for syncing a single trusted AI-agent configuration—skills, rules, MCP servers, and scripts—across multiple repositories and coding agents. Ensures consistent behavior and prevents config drift when working across many projects simultaneously.

skillssyncmulti-repoMCPconfiguration
by lucastraba Jul 10, 2026 6/10
skill GitHub

Vibe-Check: PM-Designed Skill to Take a Vague Idea to a Buildable Plan

A Claude Code skill by a 12-year product manager for taking non-engineers from a vague idea to a buildable plan. Guides through GitHub basics, clean-code habits, a verify-and-iterate loop, and a project checkup. Contrasts with the developer-targeted grill-me skill — this one is for everyone else.

planningskillbeginnersproduct-managementworkflow
by TexasBedouin Jul 10, 2026 6/10
skill GitHub

Fintech Roast: Adversarial Code Review Plugin for Financial Code

A Claude Code plugin with a sourced rulebook that takes an adversarial approach to reviewing code touching money. Designed to catch bugs, edge cases, and compliance issues in financial code paths by roasting them rather than gently suggesting improvements.

fintechsecuritycode-reviewpluginfinance
by DylanMerigaud Jul 10, 2026 6/10
skill GitHub

Senior-Level UX Design-System Skills for AI Agents

A skill set packaging senior-level UX and design-system expertise so AI agents apply it automatically during development. Covers component design, design-system conventions, and accessibility without manual prompting per task.

UXdesign-systemskillsUIaccessibility
by dembrandt Jul 10, 2026 5/10
skill GitHub

Context-to-Action Skills: Turn Messy Business Context into Clear Decisions

Claude skills for structuring messy business context into clear asks, decisions, owners, updates, and follow-ups. Extends Claude Code's usefulness beyond pure coding into business process facilitation and meeting/communication management.

skillsbusinessdecisionsworkflowproductivity
by tmusser Jul 10, 2026 5/10
skill GitHub

Zygote: Claude Code Skill to Scaffold Backend/Frontend Boilerplates on Command

A Claude Code skill that scaffolds backend and frontend boilerplates on command, covering Sanic, FastAPI, Express, Express-MVC, React+Vite, and MERN stacks. Checks dependencies, confirms before installing, scaffolds the project structure, and sets up the local environment.

scaffoldingboilerplateskillFastAPIReactExpress
by ABaliyan31 Jul 10, 2026 6/10
skill GitHub

Pixel Surgeon: Design Craft Skill with 504 Practices for Claude Code

A design craft skill for Claude Code modeled on 16 years of product design expertise. Reviews UI, cites a specific design rule per finding, and proposes numbered fixes. Backed by a library of 504 design practices covering layout, typography, color, and interaction.

designUIUXskillscode-review
by AnimaEcho Jul 10, 2026 6/10
skill GitHub

AI Skills Mapper: Find and Eliminate Overlapping Prompts Across Agents

A Claude Code skill that maps all your local AI prompts and skills across Claude, Cursor, ChatGPT, or any folder, detects functional overlaps, and helps you decide what to consolidate or delete. Useful for cleaning up a bloated skill collection spanning multiple agents.

skillsorganizationdeduplicationmanagementprompts
by yyy805 Jul 10, 2026 6/10
skill Reddit

Claude Code Starter Pack: Vision-Locked Project Scaffolding

A scaffolding skill that creates CLAUDE.md, a read-only vision.md (chmod 444 + pre-commit hook), architecture.md, a decision ledger, session log, and append-only errors.jsonl. Keeps AI agents from re-litigating settled decisions and quietly rewriting your north-star intent across sessions.

CLAUDE.mdscaffoldingstarterproject-structurehooks
by The___Storyteller Jul 10, 2026 8/10
skill GitHub

CMS Cultivator: Claude Code Plugin for Drupal and WordPress Development

A comprehensive Claude Code plugin providing specialized slash commands for Drupal and WordPress development. Offers CMS-specific guidance to keep agents aligned with Drupal/WordPress conventions and best practices.

DrupalWordPressCMSpluginslash-commands
by kanopi Jul 10, 2026 6/10
skill GitHub

Wafflestack: Write Once, Deploy Skills Across Claude Code, Codex, and Agents

A templating tool that renders one set of reusable AI agent and skill definitions into harness-native files for .claude/, .codex/, and .agents/ directories. Eliminates the need to maintain separate skill definitions per coding agent when working across multiple platforms.

skillscross-agenttemplatesworkflowautomation
by dustinkeeton Jul 10, 2026 6/10
skill GitHub

94 Specialist Blender Skills for Claude Code with MCP Production Pipeline

A comprehensive set of 94 specialist Blender skills for use with Claude Code, Cursor, Kiro, and Codex. Covers a full MCP-powered production pipeline from blockout to game engine export, targeting Blender artists who want AI assistance in their existing workflow.

Blender3DMCPskillsgame-development
by arjun988 Jul 10, 2026 7/10
skill GitHub

Odoo AI Skills: Ground-Truth-First Development for Odoo 17/18/19

Claude Code skills for AI-driven Odoo development that read ground truth from the running instance (fields, MRO chains, views, security) before writing any code. Builds the smallest correct change, proves it with a test, and reviews before merge — never guessing from outdated docs.

OdooERPskillsPythontesting
by tuanle96 Jul 10, 2026 6/10
skill GitHub

Build-Ready: Red-Team Your Spec Before Writing Any Code

An agent skill that scores a plan or spec's autonomous-build readiness before any code exists. Evaluates the spec from a zero-context builder's seat, surfacing ambiguities and gaps that would cause an agent to stall or go wrong. Works in both Claude Code and opencode.

planningspecred-teamingpre-buildskill
by jovylle Jul 10, 2026 7/10
skill GitHub

ralvaskills: Personal Claude Code Skills Enforcing Clean Architecture

A growing personal collection of AI skills for OpenCode and Claude Code that enforces strict clean architecture and professional development standards. Serves as a template for organizing opinionated skill collections.

skillsclean-architectureOpenCodestandards
by ralvarezdev Jul 10, 2026 5/10
skill GitHub

Live Workshop Skill: Audio Transcription to Searchable JupyterBook

A Claude Code skill for building live workshop journals with audio transcription and keyword extraction. Outputs a searchable JupyterBook knowledge base from workshop sessions, making captured learning immediately navigable.

workshopaudiotranscriptionJupyterBookknowledge-base
by janineagu4049 Jul 10, 2026 5/10
skill GitHub

God-Prompt: One File to Turn AI into a Production-Grade Coding Assistant

A single prompt file that improves AI coding assistant behavior by enforcing better verification, structured workflows, and code quality standards. Drop it into any project to upgrade how Claude Code approaches tasks without extensive CLAUDE.md configuration.

CLAUDE.mdpromptworkflowcode-quality
by Heartbreaking-greenhouseeffect508 Jul 10, 2026 5/10
skill GitHub

Reusable Claude Code Skills: PR Review, Security Audits, Dependency Checks

A collection of reusable Claude Code skills covering pull-request review, security auditing, and dependency analysis. Designed to save time on recurring engineering tasks by providing repeatable, high-quality skill definitions.

skillsPR-reviewsecuritydependencies
by nariatrip191 Jul 10, 2026 5/10
skill GitHub

Teamwork: Evidence-First Skills for Claude Code, Codex, and Cursor

A set of evidence-first skills covering research, debugging, planning, execution, review, and goal loops. Compatible with Claude Code, Codex, and Cursor for cross-agent flexibility.

skillsresearchdebuggingplanningcross-agent
by JinPLu Jul 10, 2026 5/10
skill GitHub

Opus-Pack: Dense Operating Skills with Executable Gates for Claude

Distilled operating skills for daily-driver Claude models: dense rules with executable gates instead of long prose. Designed to maximize signal-to-noise in system prompts and CLAUDE.md configurations.

skillsoperating-rulesCLAUDE.mdoptimization
by F-e-u-e-r Jul 10, 2026 5/10
skill Reddit

Are one-person billion-dollar companies actually possible?

Anthropic’s CEO, Dario Amodei, recently said that we’re on track to see a billion‑dollar company run by one person using AI but that it hasn’t happened yet and that there are already two‑person AI ...

review
by sibraan_ Jul 10, 2026 6/10
skill GitHub

math-modeling-skill: 数学建模技能 - 为CUMCM、MCM/ICM等数学建模竞赛提供结构化的三阶段工作流程:建模分析、代码实现、论文撰写。

数学建模技能 - 为CUMCM、MCM/ICM等数学建模竞赛提供结构化的三阶段工作流程:建模分析、代码实现、论文撰写。包含丰富的算法资源库(优化/预测/评价/图论/机器学习等)、角色指导文档、论文模板和实用工具脚本。

skill
by XiaoMaColtAI Jul 10, 2026 5/10
skill Reddit

Consulting use cases for Claude Code and Cowork

Strategy consultants out there: what and how do you use Claude, especially Code, Cowork and Skills for your daily work? See alot of input on this sub from developers and I know finance is starting ...

skill
by Jobuno Jul 10, 2026 8/10
skill GitHub

Card_Radar: 在你手上每一張卡裡,即時挑出回饋最高的那張——CardRadar 是一個讀取 Notion 信用卡回饋規則、依「實拿金額」而非帳面利率排

在你手上每一張卡裡,即時挑出回饋最高的那張——CardRadar 是一個讀取 Notion 信用卡回饋規則、依「實拿金額」而非帳面利率排名的 Claude Skill。 · A Claude Skill that picks the highest-earning card in your wallet: it reads your credit-card rules from Notion...

skill
by kau10082 Jul 10, 2026 6/10
skill Reddit

Complete and utter waste of money and time

My use case is software engineering. I’ve been a heavy Claude user for well over a year now, and since Opus 4.7 and the “comeback” of Fable 5, I can no longer trust Anthropic models to complete the...

skillapiclaude.md
by cbl_lbc Jul 10, 2026 10/10
skill Reddit

How are you combining Claude Code with Codex?

I see a lot of people saying they subscribe and use both at once. Does anyone want to share their harness setup? Do you just use the Claude Code UI and write a skill that encourages it to delegate ...

skill
by UglyChihuahua Jul 10, 2026 10/10
skill Reddit

WTF is Cloud Agents?

I've been mainly using Claude Code over telegram with their plugin. Over time I realized how much more autonomy I want with Claude Code, or any other harness. I want it to review my pre automatical...

skillautomationreview
by sapoepsilon Jul 10, 2026 9/10
skill GitHub

mba: 把品牌影响力拆成可打分、可比较、可复盘的事。Claude Code skill,5 位人物评委(傅盛·Steve Jobs·李可佳·吴俊东·张一鸣)按

把品牌影响力拆成可打分、可比较、可复盘的事。Claude Code skill,5 位人物评委(傅盛·Steve Jobs·李可佳·吴俊东·张一鸣)按 7 维度 × 5 镜头独立打分,Lead 合成版本化报告:雷达图 + 异议热力图 + 影响力构造图 + 90 天行动建议。`/mba <brand>` 一行触发,EVOLUTION 模式追踪同一品牌随时间演化。

skill
by zhanglunet Jul 10, 2026 8/10
skill GitHub

vb-winforms-toolkit: Claude Code Skills for Modernizing VB.NET WinForms on .NET 9

A set of Claude Code skills targeting VB.NET WinForms modernization to .NET 9 in 2026. Provides guided assistance for migration tasks specific to legacy Windows desktop applications. Useful for teams maintaining older VB.NET codebases who want AI-assisted upgrade paths.

skillvb.netwinformsdotnetmigrationlegacy
by yngbrll Jul 9, 2026 5/10
skill GitHub

dotclaude: Reusable Claude Code Extension Registry

A curated registry of Claude Code extensions — skills, subagents, slash commands, and hooks — covering engineering, git, testing, and security workflows. Distributed both as a shadcn-style GitHub registry and as installable plugins, making it easy to browse and add individual extensions to any project. A well-organized starting point for building out a Claude Code toolkit.

skillssubagentsslash-commandshooksregistryextensionsgittestingsecurity
by KhaledSaeed18 Jul 9, 2026 8/10
skill Reddit

What’s your ideal Claude Code workflow setup?

I’ve seen a lot of people sharing different Claude Code setups on X, especially around CLAUDE.md files, context files, hooks, agents, and skills. My current setup is pretty simple: I keep CLAUDE.md...

skillhookworkflowclaude.md
by SevereNecessary8381 Jul 9, 2026 10/10
skill GitHub

ai-skills:

ai-skills:

skill
by rjvim Jul 9, 2026 5/10
skill Reddit

I've built a claude skill to break things only once

So the thing is I work on a team of 3-4 devs, and whenever someone's AI agent screwed something up, they'd have to just... tell the rest of us. Manually. In slack or discord. That's the entire syst...

skillgitreview
by Calm_Sandwich069 Jul 9, 2026 9/10
skill Reddit

Ideas for hooks or extra customisations

I use Claude code regularly in my job. I’m a software engineer, but it’s really good out of the box and I’m wondering what people are using hooks for or is there any other customisations I should d...

skillhookworkflow
by Ovisty Jul 9, 2026 10/10
skill Reddit

Context Governance: Making AI Context Authoritative and Precise

Context accuracy — not capacity — is the real failure mode in long-lived AI coding projects. This open-source framework defines artifact ownership, marks docs as active vs historical, and routes tasks through explicit stages to prevent the agent acting on the wrong document. Reduces debug loops and keeps design docs aligned with implementation.

context-managementCLAUDE.mdarchitectureworkflow
by feather812002finland Jul 8, 2026 6/10
skill Reddit

claude-worktrace: Auto-Capture Session Summaries and Corrections

Three skills that hook into Claude Code to automatically generate narrative work summaries on /compact, /clear, or session end. Builds a daily worklog from transcripts for standups, weekly updates, and session analysis — capturing what was decided and why, not just what files changed.

skillssession-memoryworkloghooks
by shaun_the_mehh Jul 8, 2026 7/10
skill GitHub

AGENTS.md Generator: Safe CLI for Agent Instruction Files

A safe-by-default CLI that generates and updates AGENTS.md and RUNBOOK.md for AI coding agents. Uses marker-based patches and a diff-first workflow so updates are reviewable before applying, with conservative repo auto-detection.

AGENTS.mdCLIworkflowsetup
by markoblogo Jul 8, 2026 6/10
skill GitHub

Ecommerce CRO Engine for Claude Code

A Claude Code skill that audits and optimizes ecommerce pages using research-backed conversion psychology principles. Provides structured analysis and recommendations based on CRO best practices.

ecommerceCROskilloptimization
by Dannytownkins Jul 8, 2026 5/10
skill GitHub

ReAct Deep Search Skill: Iterative Research That Follows Leads

A Claude Code skill implementing ReAct-style deep search that follows leads between rounds rather than doing broad parallel searches. Each search round builds on findings from the previous one for deeper, more targeted research.

researchskillReActsearch
by recomby-ai Jul 8, 2026 6/10
skill GitHub

204+ Curated Claude Code Skills Organized by Dev Workflow

A curated collection of 204+ Claude Code skills organized by development phase: Plan, Build, Test, Ship. Bilingual Chinese/English. Provides a comprehensive library covering the full development lifecycle.

skillscuratedworkflowbilingual
by xcodethink Jul 8, 2026 6/10
skill GitHub

Apple Text Stack Skills for Claude Code (TextKit, NSTextView)

A Claude Code plugin providing skills for Apple's text rendering stack: TextKit, UITextView, NSTextView, attributed strings, Writing Tools, and related APIs. Useful for iOS/macOS developers working on text-heavy features.

AppleiOSmacOSTextKitskill
by sitapix Jul 8, 2026 5/10
skill GitHub

xstitch: Cross-Tool Memory for Claude Code, Cursor, Codex, and 9+ Agents

Zero-dependency cross-agent memory that stitches context across Claude Code, Cursor, Codex, Gemini CLI, Windsurf, and more. Preserves decisions, failed experiments, and warnings across sessions using BM25 relevance search and MCP + instruction files.

memorycross-toolBM25MCP
by raghavvbiyani Jul 8, 2026 7/10
skill GitHub

Claude Code Field Guide: Best Practices, Skills, Plugins, and MCPs

A personal collection of battle-tested best practices, favorite skills, plugins, tools, and MCP servers for Claude Code. Well-organized reference for practitioners looking to level up their workflow.

best-practicesskillsMCPsreference
by lawwu Jul 8, 2026 6/10
skill GitHub

Awesome CLAUDE.md: 20 Best Practice Templates, Bilingual

A curated collection of 20 CLAUDE.md templates covering best practices for Claude Code project configuration. Bilingual Chinese/English, providing concrete starting points for different project types and team setups.

CLAUDE.mdtemplatesbest-practicesconfiguration
by jnMetaCode Jul 8, 2026 7/10
skill GitHub

Content Creation Skill Pack: 8 Skills with AI Slop Detector

A Claude Code skill pack for content creation with 8 skills, persistent memory, skill chaining, and a built-in AI slop detector that flags generic AI-sounding output. Designed for writers and marketers who need human-feeling results.

contentskillswritingslop-detection
by quionie Jul 8, 2026 5/10
skill GitHub

SAP Superpowers: Enforced Workflows and Checklists for Claude Code

A Claude Code configuration acting as a SAP consultant's AI operating system with enforced workflows, checklists, and hard gates. Covers SAP debugging, estimation, and go-live readiness checks.

SAPworkflowchecklistsenterprise
by vigneshbarani24 Jul 8, 2026 5/10
skill GitHub

ROS 2 Engineering Skill for Claude Code

A progressive-disclosure SKILL.md for production-grade ROS 2 development covering workspace setup, nodes, executors, QoS, ros2_control, Nav2, MoveIt 2, real-time, and deployment. Compatible with Claude Code, Codex, Cursor, and Gemini CLI.

ROS2roboticsskillembedded
by dbwls99706 Jul 8, 2026 5/10
skill Reddit

loreto.io: Extract SKILL.md Files from Documentation and Video Transcripts

A tool that ingests documentation, videos, and transcripts and outputs agent-ready SKILL.md files — not summaries, but actual skills with invocation logic, example queries, edge cases, and 'when NOT to use' guidance extracted from the source material.

skillsskill-generationdocumentationSKILL.md
by canary-black Jul 8, 2026 7/10
skill GitHub

Linux System Health Skill: OS Diagnostics for Claude Code

A Claude Code skill for diagnosing OS-level issues on Linux servers: memory, CPU, disk, network, kernel tuning, resource limits, DNS, time sync, filesystem integrity, browser deps, and locale. One command for comprehensive server health analysis.

LinuxDevOpsdiagnosticsskill
by zjxylc Jul 8, 2026 6/10
skill Reddit

Text Adventure Game Engine Skill for Claude Desktop

A skill that runs a full text adventure RPG engine inside Claude Desktop — no server needed. Supports d20, D&D 5e, GURPS Lite, Pathfinder 2e, and Shadowrun 5e with styled scenes, interactive buttons, stat panels, maps, shops, combat, and 3D dice rendered in Claude's widget system.

gamesskillRPGClaude Desktop
by gazmagik Jul 8, 2026 6/10
skill GitHub

worldbuilder: Generate Fictional Universes via Claude Code Skill

A Claude Code skill and web UI for structured worldbuilding — novels, D&D campaigns, game worlds. Runs locally, generates illustrated characters and chapter outlines, and maintains consistency across a universe through file-based structured data.

writingworldbuildingskillcreative
by gofastercloud Jul 8, 2026 5/10
skill GitHub

skillshare: Sync Agent Skills Across Claude Code, Codex, OpenClaw

A CLI tool that syncs skill files across multiple AI coding tools with one command and simplifies team sharing. Supports Claude Code, Codex, OpenClaw, and more — keeping your skills in sync everywhere.

skillssyncteammulti-agent
by runkids Jul 8, 2026 6/10
skill GitHub

Decision Orchestrator Skill: Router→Agents→CEO Workflow

A one-command skill that implements a Router→Agents→CEO decision pattern for Claude Code and OpenClaw. Routes complex decisions through specialized agents and synthesizes a final verdict from a CEO-style orchestrator.

orchestrationworkflowdecision-makingskill
by Klarinia Jul 8, 2026 6/10
skill GitHub

Declarative Agent Skills Management with Nix

A Nix module for declaratively managing Claude Code agent skills — define your skills in Nix configuration and have them deployed and versioned consistently across machines.

Nixdeclarativeskillsconfiguration
by Kyure-A Jul 8, 2026 5/10
skill GitHub

claude-replan: Validate Plans with Parallel Review Subagents

A Claude Code plugin that spawns parallel review subagents to validate implementation plans before execution — checking codebase alignment, best practices, feasibility, and blind spots. Catches issues at planning time rather than after hours of implementation.

planningvalidationsubagentspre-execution
by kojott Jul 8, 2026 8/10
skill GitHub

fallow-skills: Find Dead Code and Unused Dependencies in JS/TS

Agent skills for finding dead code, unused dependencies, and code duplication in JavaScript/TypeScript projects. Works with Claude Code, Cursor, Codex, Gemini CLI, and 30+ other agents.

JSTypeScriptdead-codecleanup
by fallow-rs Jul 8, 2026 6/10
skill Reddit

/notes Skill: Capture Ideas Mid-Session Without Breaking Focus

A Claude Code skill for capturing thoughts and ideas that arise during active debugging sessions without interrupting the current workflow. Bridges the gap between MEMORY.md (preferences), CLAUDE.md (project info), and ephemeral ideas that need to wait.

skillnotesworkflowproductivity
by mcosternl Jul 8, 2026 6/10
skill Reddit

prompt-master: Skill That Writes Accurate Prompts for Any AI Tool

A Claude skill that silently detects your target tool (Cursor, Claude Code, GPT, Midjourney, etc.) and generates accurate prompts specifically tailored to that tool's strengths and format. Built-in memory for long sessions. 1500+ GitHub stars.

prompt-engineeringskillmulti-toolproductivity
by CompetitionTrick2836 Jul 8, 2026 6/10
skill GitHub

Multi-Agent Adversarial Review Panel: 4-6 Reviewers + Supreme Judge

A Claude Code skill that spawns 4-6 AI reviewers who debate code or plans anonymously, with anti-groupthink mechanisms and 9 auto-detected signal groups — then a supreme judge delivers the final verdict. Built-in domain checklists for different review types.

code-reviewadversarialmulti-agentskill
by wan-huiyan Jul 8, 2026 8/10
skill GitHub

Curated Claude Code Skills with Evaluation Reports and Test Fixtures

A system of production-ready Claude Code skills that includes quantitative evaluation reports and golden test fixtures — not just the skills themselves, but evidence they actually work. Engineering workflow integration included.

skillsevaluationtestingproduction-ready
by johnqtcg Jul 8, 2026 7/10
skill GitHub

publish-skill: Claude Code Skill for Publishing Skills to GitHub

A meta-skill that automates publishing Claude Code skills to GitHub and awesome-claude-skills lists. Encodes lessons learned from real publishing attempts including common pitfalls and submission requirements.

skillspublishingGitHubmeta
by wan-huiyan Jul 8, 2026 5/10
skill Reddit

Roast My Skill: Get Brutal Feedback on Your SKILL.md Files

An open-source tool that roasts your SKILL.md files in-character (choose your roast persona), exposing weaknesses in your skill design. Built after discovering most skills needed significant improvement even when they 'worked'.

skillsfeedbackqualitySKILL.md
by jorkim_32 Jul 8, 2026 6/10
skill GitHub

OpenTelemetry Skills and Reference Docs for Claude Code

Official Dash0 skills and reference documentation for AI coding assistants covering OpenTelemetry instrumentation patterns, telemetry quality guides, and Dash0 integration. Helps Claude produce correct OTel code.

OpenTelemetryobservabilityskillinstrumentation
by dash0hq Jul 8, 2026 5/10
skill Reddit

Book Genesis: 20 Claude Code Skills for Autonomous Book Writing

A system of 20 specialized Claude Code skills implementing a 14-phase book pipeline from research through revision, with a Genesis Score calibrated against 15 bestsellers and 20 anti-AI patterns for human-feeling output. Produced a 68K-word memoir.

writingskillscreativeautonomous
by Turbulent_Worker9216 Jul 8, 2026 6/10
skill GitHub

React Native New Architecture Migration Skill for Claude Code

A Claude Code skill that audits bare React Native projects for New Architecture readiness — parallel library checker, JS/TS + iOS + Android native scan, Migration Effort Score, and a 4-phase migration plan. Supports monorepos, delta mode, and offline fallback.

React Nativemigrationauditskill
by rajivmanivannan Jul 8, 2026 6/10
skill GitHub

Awesome Claude Code Playbook: Battle-Tested Patterns and Configs

A curated collection of battle-tested patterns, tools, and configurations for Claude Code — covering CLAUDE.md setup, hook patterns, skill organization, and workflow automation for Anthropic's CLI coding agent.

best-practicespatternsconfigurationClaude Code
by zzhou23 Jul 8, 2026 6/10
skill GitHub

claude-blueprint: Reusable Claude Code Setup with Skills, Agents, Hooks

A personal Claude Code blueprint providing a complete reusable setup — skills, agents, hooks, and rules — shareable across all projects. Serves as a template for kickstarting new projects with a proven configuration.

blueprinttemplatehooksskills
by herbeckrobin Jul 8, 2026 5/10
skill Reddit

One Question to Distinguish Skills from Agents: Consistency vs Judgment

A clear mental model for when to use a skill vs an agent: skills execute the same steps every time (consistency), agents exercise judgment to choose different paths (decision-making). One question clears it up: does the task need consistency or judgment?

skillsagentsmental-modelworkflow
by dydolino Jul 8, 2026 7/10
skill Reddit

Restructure CLAUDE.md to Stop Burning Context Mid-Run

Traces agent failures to one root cause: CLAUDE.md grown into a wall of history that floods the context before real work starts. Solution: split CLAUDE.md into a slim project brief, separate decision log, and component-level context files loaded only when needed. Concrete before/after structure included.

CLAUDE.mdcontextlong-sessionsconfiguration
by ShellSageAI Jul 8, 2026 8/10
skill Reddit

Keeping CLAUDE.md and Context Files Fresh Across Long Projects

Strategies for preventing context drift in long-lived projects: component-level CLAUDE.md files that agents update as they work, explicit 'known good baseline' markers, and scheduled context refresh checkpoints. Addresses the grep spiral problem where Claude searches the whole codebase instead of using context.

CLAUDE.mdcontextdriftbest-practices
by hustler-econ Jul 8, 2026 7/10
skill Reddit

Stop Overengineering SKILL.md: Push vs Pull Context Loading

A practical guide to the skill authoring sweet spot: unlike CLAUDE.md (always loaded) and ad-hoc prompts (never reused), skills are pull-loaded only when the agent matches the task. Covers minimal effective file structure and when not to use a skill.

SKILL.mdbest-practicescontextskills
by AnayMehra Jul 8, 2026 7/10
skill GitHub

html-artifacts: Generate Self-Contained HTML Instead of Markdown

A skill that makes Claude output self-contained HTML artifacts for tasks instead of standard markdown, improving content rendering and enabling interactive user interfaces within Claude's response.

skillHTMLartifactsrendering
by dovydaskarbutovskis20-art Jul 8, 2026 5/10
skill GitHub

Agent-Startup-Skills: 8-Phase SaaS Pipeline with Mandatory Approval Gates

A skill set for building SaaS products through an 8-phase AI agent pipeline with mandatory human approval gates between phases. Works with Claude Code, Antigravity, and Codex. Enforces structured progression from concept to deployment.

SaaSskillsworkflowapproval-gates
by batterfried-philosophy172 Jul 8, 2026 5/10
skill GitHub

SOTA Claude Code Skills: 30 Domain Skills with BUILD/AUDIT Modes

State-of-the-art (2026) Claude Code skills for building and auditing software across 30 domains and languages, with BUILD and AUDIT modes and structured audit checklists. Covers mainstream stacks and specialized domains.

skillsauditbuildmulti-domain
by martinholovsky Jul 8, 2026 6/10
skill Reddit

Marketing Audit Suite: 15 Slash Commands and 5 Parallel Agents for Claude Code

An open-source marketing audit toolkit built with Claude Code's SKILL.md system, featuring 15 slash commands and a parallel agent architecture. Running /market audit spawns 5 specialized sub-agents simultaneously analyzing content, conversion, SEO, competitive positioning, and brand. Bilingual (FR/EN), MIT licensed, installable in 30 seconds.

skillslash-commandsparallel-agentsmarketingopen-source
by Johssinma Mar 19, 2026 7/10
skill GitHub

CLAUDE.md Config for Automated PR Planning and CodeRabbit Review Loops

A CLAUDE.md configuration that teaches Claude Code to collaborate with CodeRabbit for end-to-end PR workflows. Automates PR planning, code review loops, and merge workflows by defining how Claude Code and CodeRabbit interact. Drop-in configuration for teams already using CodeRabbit.

claude.mdcoderabbitcode-reviewpr-workflowautomation
by auerbachb Mar 19, 2026 7/10
skill Reddit

5 Free Claude Code Skills for Codebase Onboarding Documentation

A set of 5 free Claude Code slash commands for generating onboarding documentation grounded in actual repo files. Covers architecture overview, module dependency maps, environment setup, ownership maps, and more. Each skill reads the real codebase and produces a doc without hallucinated stack details.

skillsslash-commandsonboardingdocumentationcodebase
by Upbeat-Rate3345 Mar 19, 2026 7/10
skill GitHub

PDFjs-Claude-Skill-Package: 13 Deterministic Skills for PDF.js Development

A collection of 13 deterministic Claude AI skills for PDF.js (pdfjs-dist 5.x), covering rendering, viewer development, error handling, and project scaffolding. Designed to give Claude Code reliable, up-to-date context for PDF.js projects. Useful for developers building PDF viewers or document processing tools.

skillspdf.jspdfjsrenderingfrontend
by OpenAEC-Foundation Mar 19, 2026 6/10
skill GitHub

cli-code-skills: Production-Ready Skills for Code Audit, Docs, Design, and Infra

A set of production-ready Claude Code skills covering code quality auditing, design document generation, documentation automation, and infrastructure tasks. Each skill is a slash command that can be dropped into any Claude Code project. Practical and immediately usable across multiple engineering workflows.

skillscode-auditdocumentationinfrastructuredesign-docs
by Destynova2 Mar 19, 2026 7/10
skill Reddit

Loading CLAUDE.md Files Outside the Project Tree On-Demand with @-References

Claude Code normally auto-loads only CLAUDE.md files within the project hierarchy, but you can use @-references to pull in any CLAUDE.md from anywhere in the filesystem on-demand. This technique enables shared global configurations, library-specific instructions, and cross-project skill sets without polluting individual repos. Post includes concrete examples and edge cases.

claude.mdconfigurationfile-loadingtipsglobal-config
by thealliane96 Mar 19, 2026 7/10
skill Reddit

Avoiding Generic Claude Frontends: Component Library, Icon Set, and /talklikeme Skill

Practical tips for escaping the default Claude frontend look: lock it to a strong component library (with MCP if available), specify an icon library, write explicit CLAUDE.md guidelines for colors/fonts/patterns you hate, and create a /talklikeme skill trained on your own writing so copy sounds human. The /talklikeme approach involves feeding past essays and having Claude interview you to learn your voice.

frontendskilldesigntalklikemecomponent-libraryclaude.md
by Pitiful-Head-4162 Mar 19, 2026 6/10
skill GitHub

sdlc-studio: Claude Code Skill for the Full Software Development Lifecycle

A Claude Code skill that manages the complete software development lifecycle from planning through deployment. Designed as a reusable SKILL.md component to bring consistent SDLC discipline to Claude Code-driven projects.

skillsdlclifecycleworkflowskill.md
by DarrenBenson Mar 19, 2026 7/10
skill GitHub

claude-superskills: 44+ Universal Skills for Claude Code and GitHub Copilot

A collection of 44+ standardized SKILL.md files covering Solution Architecture, Startup Strategy, Software Engineering, and Product Growth — usable with both Claude Code and GitHub Copilot. Each skill targets a specific professional domain and provides structured prompting workflows across AI coding tools.

skillsskill.mdarchitecturestartupcopilotuniversal
by ericgandrade Mar 19, 2026 7/10
skill Reddit

/do Router Skill: Single Entry Point That Dispatches to the Right Skill, Agent, or Pipeline

A skill routing pattern where every Claude Code command goes through a single /do dispatcher that reads intent and routes to the correct skill, agent, or pipeline automatically. Eliminates the problem of Claude not using the right tool for each task. The SKILL.md is open-sourced as part of a broader claude-code-toolkit.

skillrouterdispatchskill.mdautomationworkflow
by AndyNemmity Mar 19, 2026 7/10
skill GitHub

skill-social-media: Write Platform-Native Posts and Plan Content

A social media content skill for AI agents that writes platform-native posts for different networks, plans content calendars, and researches hashtags. Free and open source. Good starting point for anyone building social media automation with Claude Code skills.

skillsocial-mediacontentautomationmarketing
by superlowburn Mar 19, 2026 6/10
skill GitHub

skill-lead-gen: Research Prospects and Generate Outreach via Agent

A lead generation skill for AI agents that researches prospects, scores them against an ideal customer profile (ICP), and generates outreach messages. Free and open source. Useful as a starting template for sales automation workflows using Claude Code.

skilllead-gensalesoutreachautomation
by superlowburn Mar 19, 2026 5/10
skill GitHub

skill-invoice-billing: Generate Invoices and Track Payments via Agent

An invoice and billing skill for AI agents that generates invoices, tracks payment status, and sends reminders. Free and open source. Useful template for integrating billing workflows into Claude Code-based business automation.

skillinvoicebillingpaymentsbusiness
by superlowburn Mar 19, 2026 5/10
skill GitHub

skill-customer-support: Ticket Triage and Response Drafting for Agents

A customer support triage skill for AI agents that classifies support tickets, prioritizes queues, drafts responses, and detects churn risk. Free and open source. Good foundation for building AI-powered customer support workflows with Claude Code.

skillcustomer-supporttriageticketsautomation
by superlowburn Mar 19, 2026 6/10
skill GitHub

skill-seo-audit: On-Page SEO Analysis Skill for AI Agents

An SEO audit skill for AI agents that analyzes on-page SEO factors including meta tags, headings, content quality, and internal linking. Free and open source. Good base skill for building SEO analysis and reporting into Claude Code workflows.

skillseoauditcontentanalysis
by superlowburn Mar 19, 2026 5/10
skill GitHub

frontend-landings: Generate Animated HTML Landing Pages via Skill

A Claude Code skill that generates standalone, animated HTML landing pages from just a product description — no dependencies, no build step. Produces self-contained HTML files with animations using only a short text prompt. Useful for quickly prototyping or generating marketing pages.

skillhtmllanding-pagefrontendgeneration
by hemsurendranath Mar 19, 2026 7/10
skill Reddit

Auto.dev Skill for Claude: Search Real Car Inventory and Decode VINs

An agent skill for the Auto.dev automotive data platform that gives Claude the ability to search live car inventory, decode VINs, check recalls, and calculate payments. Install with npx skills add drivly/auto-dev-skill. Shows the power of domain-specific skills for real-world data queries.

skillautomotiveapidatadomain-specific
by Masterpiece-Smart Mar 19, 2026 6/10
skill GitHub

hono-skill: Claude Code Skill for Hono Application Development

A Claude Code skill that integrates Hono CLI tools for building Hono web applications. Provides project scaffolding, routing patterns, and Hono-specific best practices directly in Claude Code sessions. Good for developers using the Hono framework who want AI-assisted development.

honoskillwebframeworkcli
by panjicopri Mar 19, 2026 5/10
skill GitHub

awesome-skills: Agent Skills for Local Workflow Automation

A collection of reusable agent skills focused on local workflows and automation, including utilities for China workday calendar checks and Codex session history tools. Good starting point for building locale-specific or developer-workflow automation skills.

skillsautomationlocalworkflowcodex
by Sube-py Mar 19, 2026 6/10
skill GitHub

n8n-Claude-Skill-Package: 21 Claude Skills for n8n Automation

21 deterministic Claude AI skills packaged for n8n v1.x workflow automation. Bridges Claude Code capabilities with n8n's visual workflow builder for non-code automation. Useful for building AI-powered automation pipelines that combine Claude reasoning with n8n integrations.

skillsn8nautomationworkflowintegration
by OpenAEC-Foundation Mar 19, 2026 8/10
skill Reddit

auto-save-and-push: Skill to Fight Context Rot with Git Checkpoints

A Claude Code skill that runs on a 30-minute loop to validate your git repo, audit file organization, flag clutter, and push a checkpoint commit. Specifically designed to counter context rot — the gradual degradation of AI response quality in long sessions. Can be triggered manually or automatically.

skillsgitcontext-rotautomationmemory
by ProjectorMusic Mar 19, 2026 7/10
skill GitHub

agent-toolkit: Reusable Skills and Plugins for Claude Code

A personal agent toolkit repository containing reusable skills and plugins for Claude Code, Cursor, Codex, and Gemini CLI. Provides a structured library of common tasks and automations so you do not have to recreate skills from scratch. A good reference for building your own skill collection.

skillspluginsreusableclaude-codetoolkit
by svyatov Mar 19, 2026 7/10
skill GitHub

claude-skills-journalism: Skills for Research, FOIA, and Verification

A set of Claude Code skills tailored for journalism, media, and academic work — covering source verification, FOIA request drafting, data journalism workflows, and academic writing. Practical skills for researchers and journalists who use Claude Code for investigative and writing tasks.

skillsjournalismresearchverificationacademia
by jamditis Mar 19, 2026 7/10
skill Reddit

Claude Code Skills That Make Agent Teammates Play Connect Four and Tic-Tac-Toe

Two Claude Code skills that spawn agent teammates and have them play games against each other — Connect Four and Tic-Tac-Toe. A fun demonstration of the agent teams feature and how skills can orchestrate multi-agent interactions beyond purely productive tasks.

skillagent-teamsgamesmulti-agent
by CygraW Mar 19, 2026 6/10
skill GitHub

Claude Code Plugin: Technical Document Review with Three-Pass Workflow

A Claude Code plugin implementing the "Three Reviews and Three Proofreads" (三审三校) technical document review workflow. Simulates a team of reviewers across three distinct review passes for accuracy, clarity, and style. Especially relevant for documentation-heavy engineering teams.

documentationreviewworkflowplugin
by ShieldBytes Mar 19, 2026 6/10
skill GitHub

Awesome CLAUDE.md: Battle-Tested Configs for Next.js, React, Python, Flutter, and More

A curated collection of battle-tested CLAUDE.md files for common stacks including Next.js, React, Python, and Flutter. Ready to drop into any project to instantly give Claude Code the right context, conventions, and guardrails for each stack. Good starting point for teams standardizing their AI configs.

claude-mdconfigurationtemplatesbest-practices
by sx4im Mar 19, 2026 7/10
skill GitHub

Agent Skills by CyperX: Write Once, Run Everywhere Skills Collection

A collection of agent skills by CyperX designed to work across different AI coding assistants. The "write once, run everywhere" philosophy means skills don't need to be adapted per platform. A useful starting point for developers building cross-compatible agent skill libraries.

skillscross-platformcollection
by cyperx84 Mar 19, 2026 5/10
skill GitHub

Claude Self-Score: Plugin That Scores Work Quality Against a 7-Dimension Rubric

A Claude Code plugin that evaluates work quality across a 7-dimension rubric before completing a task. Forces the agent to self-assess before declaring done, catching low-quality output early. The rubric covers correctness, completeness, clarity, security, performance, maintainability, and test coverage.

qualityself-assessmentrubricplugin
by augmentedivan Mar 19, 2026 7/10
skill GitHub

SkillPod: CLI for Authoring and Managing a Personal Agent Skills Registry Backed by GitHub

A CLI tool for creating, managing, and publishing a personal agent skills registry hosted on GitHub. Authors skills with a local editor, version-controls them via git, and publishes the registry for use across any agent platform. A structured alternative to manually managing .skill files.

skillsregistrycligithub
by sushil-kamble Mar 19, 2026 7/10
skill GitHub

sd0x-dev-flow: Plugin Ecosystem for Claude Code

A plugin ecosystem for Claude Code introducing the sd0x-dev-flow framework. Provides a structured set of plugins for common development flows within Claude Code sessions.

pluginecosystemworkflow
by sd0xdev Mar 19, 2026 5/10
skill GitHub

Aurakit: All-in-One Claude Code Skill with 4-Layer Security and Full Stack Operations

An all-in-one /aura slash command skill for Claude Code providing build, fix, clean, deploy, and review operations with 4-layer security verification, triple confirmation checks, and compact defense mode. Designed as a single skill that handles the full development lifecycle.

skillsecurityfull-stackslash-command
by smorky850612 Mar 19, 2026 7/10
skill GitHub

eCommerce Skills: AI Agent Skills for Amazon, Shopify, Etsy, and TikTok Shop

A collection of AI agent skills for e-commerce workflows — product research, marketing automation, supply chain optimization, and business analytics. Covers Amazon, Shopify, Etsy, TikTok Shop, and other major platforms. Aimed at solo sellers and small teams who want AI automation without custom development.

skillsecommerceautomationshopify
by nexscope-ai Mar 19, 2026 5/10
skill GitHub

Veriglow Agent Map Skill: Discover Hidden APIs and Browser Automation Recipes for Any Website

A skill that teaches AI agents to discover hidden APIs, data functions, and browser automation recipes for arbitrary websites. Works with Claude Code, ClawHub, Cursor, and any AgentSkills-compatible agent. Useful for building scrapers, automations, or integrations without documented APIs.

skillapi-discoveryautomationweb-scraping
by ChizhongWang Mar 19, 2026 6/10
skill Reddit

Building the First Claude Visual Skill with Interactive UI Blocks

A report on building and testing the first Claude Visual Skill — a skill that generates interactive UI blocks directly in the Claude chat interface using the new Visuals feature. Demonstrates the potential of combining Claude Code's skill system with the inline visual rendering API.

skillvisualsuiclaude-api
by romancone Mar 19, 2026 5/10
skill Reddit

Future Work Paradigm Designer: Claude Skill for AI-Era Job Redesign

A Claude skill that breaks any job down to granular sub-tasks, determines which parts AI should handle vs. humans, designs a multi-agent collaboration system, and generates an implementation roadmap. Tested on a real HR case with 61 sub-tasks. Free .skill file available.

skillworkflow-designautomationhr
by Significant-Bag2944 Mar 19, 2026 6/10
skill Reddit

CLAUDE.md Rule to Prevent Claude from Losing State When a Session Is Interrupted

A simple but effective CLAUDE.md rule that prevents Claude from silently reconstructing context after a session stop. Without this rule, Claude pretends to understand context it doesn't have. The rule forces explicit acknowledgment of lost state rather than confident guessing.

claude-mdsessionconfigurationbest-practices
by Valo-AI Mar 19, 2026 5/10
skill GitHub

Curated Claude Code Skills for Development Workflows with Best Practices

A curated collection of Claude Code skills focused on AI-assisted development workflows. Each skill includes structured guidance, best practices, and ready-to-use patterns for common development tasks. Designed to consistently improve Claude Code output quality across different projects.

skillsbest-practicesworkflowcollection
by mumudevx Mar 19, 2026 6/10
skill Reddit

prompt-master: Claude Skill That Writes Accurate Prompts for Any AI Tool (600+ Stars)

A free Claude skill that writes accurate, tool-specific prompts for Cursor, Claude Code, GPT, Midjourney, Kling, Eleven Labs, and other AI tools. Instead of generic prompts, it generates prompts calibrated for each tool's specific strengths. Has accumulated 600+ GitHub stars and 4000+ traffic visits.

skillprompt-engineeringmulti-toolpopular
by CompetitionTrick2836 Mar 19, 2026 8/10
skill GitHub

Tandem Marketplace: 20 Workflow Skills Plugin for Claude Code Cowork Mode

A managed AI personal assistant plugin for Claude Code Cowork mode featuring 20 workflow skills, guided onboarding, a proactive behavior engine, and multilingual support (EN/HE/RU). Provides a structured skill marketplace experience within Claude Code.

skillscoworkmultilingualmarketplace
by BinatrixAI Mar 19, 2026 7/10
skill GitHub

Cypress Agent Skill: Write, Debug, and Optimize Cypress Tests via AI Agent

A skill providing AI agents with a comprehensive knowledge base for writing, debugging, and optimizing Cypress tests. Includes standard patterns, best practices, and common pitfalls for E2E testing. Useful for teams using Claude Code in their frontend testing workflow.

testingcypresse2eskill
by YTItsfrost Mar 19, 2026 6/10
skill GitHub

Prompt Engineer Skill: Expert Prompt Engineering for Claude Code and Multi-Platform Agents

An expert-level prompt engineering skill covering system prompts, tool descriptions, context engineering, and cross-provider compatibility. Works with Claude Code, Cursor, Gemini CLI, and any Agent Skills-compatible tool. A reference implementation for prompts that work well across different AI platforms.

prompt-engineeringskillcross-platformbest-practices
by Shaharsha Mar 19, 2026 7/10
skill GitHub

Curated Claude Code Skills for Product Management and Workflow Automation

A collection of Claude Code skills focused on product management workflows and development automation. Covers common PM tasks like spec writing, roadmap planning, and stakeholder communication — filling a gap in the mostly developer-focused skills ecosystem.

skillsproduct-managementautomationworkflow
by tflaim Mar 19, 2026 6/10
skill GitHub

claude-config: Configuration Framework With Specialized Agents for Claude Code

A drop-in configuration framework that enhances Claude Code with specialized agents and workflow automations for common development tasks. Provides structured agent behaviors and workflow pipelines for efficient coding automation. Open source on GitHub.

configagentsworkflowautomationclaude-code
by Kamixon131 Mar 19, 2026 6/10
skill GitHub

The Ultimate Claude Code Toolkit: 119 Skills, 67 Agents, 30 Commands, 8 Hooks

A comprehensive drop-in ~/.claude configuration that bundles 119 skills, 67 agents, 101 marketplace repos (6,600+ community skills), 30 commands, and 8 hooks with zero configuration required. The toolkit auto-activates the right resources based on your prompt, making it a turnkey upgrade for any Claude Code setup. One of the most complete community config collections available.

skillsagentscommandshooksconfigtoolkitmarketplace
by travisjneuman Mar 19, 2026 9/10
skill Reddit

CLAUDE_CODE_EXPERIMENTAL_AGENT_TEAMS --resume Session Chaos

I use the /rename function for important threads I want to pick up again later. I also have a library of agents and skills I use daily. I have found that when I use agent teams, my session history ...

skill
by rvtndiecxb Mar 19, 2026 7/10
skill Reddit

Local Claude Code host?

Hi all, I am in love with the possibilities of Claude Code and have used it primarily for advanced creation and editing of documents. Since I cannot install it on my work machine, I have built a sm...

skillapi
by Low_Singer_44 Mar 19, 2026 8/10
skill Reddit

You aren't using skills to their full potential

Most skills are shallow. You write a skill file. Maybe it's for code review, or summarizing documents, or generating commit messages. One file, one purpose. The agent reads it, follows the instruct...

skillreview
by Afraid-Today98 Mar 19, 2026 6/10
skill Reddit

My x5 account got banned for... browser integration?

Yesterday I was playing with playwright integration, discussed in this sub earlier. I was very excited how powerful Claude can be with browser integration, much better than official chrome mode. La...

skillreview
by Sensitive_Device_236 Mar 19, 2026 7/10
skill Reddit

How can I make claude code know the time?

Getting along great with CC until I ask it to tell me what are my to-do's for my upcoming meeting, and then all of a sudden it will think we're in last month. Is there a skill that I can invoke tha...

skill
by Mission-Tap-1851 Mar 19, 2026 8/10
skill Reddit

Editing skills - What am I doing wrong?

I have created a few Claude skills to help me in my day-to-day activities. During the process, I need to make some updates on the skills, either to fix mistakes or upgrade. However, when I ask Clau...

skill
by CR_41 Mar 19, 2026 6/10
skill Reddit

Opus 4.6 1M Context - Quality Level ?

I love CC. Been using it since Mar 2025 and have built a US state government used AI Service and website deployed two months ago with nice passive income with world travel ideas. Big fan of 1M cont...

skillreview
by OmniZenTech Mar 19, 2026 6/10
skill Reddit

Advices for a new user?

Hello! I'm a new user of Claude (since February), and I used the Free version for light programming. I have no real skills at programming, and I found it pretty fun and interesting to use. Sadly, w...

skill
by Round_Atmosphere3671 Mar 19, 2026 9/10
skill Reddit

Distribute Claude skills team wide

In my current job we are using Claude enterprise. I want to start distributing skills across my team. Currently the org is distribuiting skills with Claude native distribution, but that means that ...

skillgit
by widonext Mar 19, 2026 6/10
skill GitHub

skills:

skills:

skill
by craft-studio-marketplace Mar 19, 2026 5/10
skill Reddit

Claude Code Skills

I’m building an app using Claude Code for the first time, what are the best skills that I can add to Claude? submitted by /u/ragnar580 [link] [comments]

skill
by ragnar580 Mar 19, 2026 8/10
skill Reddit

Framework to manage conversations across diff AIs ?

I'm working simultaneously with Claude CLI, codex, gemini etc, each one has its own skill, task, specialty. is there a GUI that is similar to codex or Claude desktop and could manage conversation a...

skill
by nivijah Mar 19, 2026 7/10
skill Reddit

Dashboarding skills

I’ve just finished an ETL and Schema set of skills, and need to finish the set with a dash boarding skill. Has anyone seen good ones? Thinking in the design element - the front end design skill is ...

skill
by GumanHoon Mar 19, 2026 5/10
skill Reddit

no-night-night Skill

I saw a bunch of people in this subreddit discussing Claude telling them to "go to bed", so the first time mine hit me with it, I built this skill: Claude never suggests Hannah should stop working,...

skill
by ihzzy Mar 19, 2026 6/10
skill Reddit

I'm having the worst time getting Claude to use an LSP by default

It won't use them on its own. Seems to ignore the demand if I put it in a CLAUDE.md file. I've tried creating a skill that tells it to do so. Still zip. It'll only use one if I tell it to act expli...

skillclaude.md
by dragonfax Mar 19, 2026 8/10
skill GitHub

llm-skills:

llm-skills:

skill
by senior-sigan Mar 19, 2026 5/10
skill Reddit

How do orgs manage markdown files?

The Plugin marketplace feels like the obvious spot, but how do orgs best manage 30+ teams messing about with their own “make a pr” skill workflows, is there a desire to “re-use” code and can the ma...

skillworkflow
by AndyM03 Mar 19, 2026 5/10
skill Reddit

Any R Stats users have Claude Suggestions?

Looking for good Skills or any other input. It's odd, but I've seen Sonnet to perform better than Opus, or at least be no worse. I've also noticed that the code is definitely "better" in that it's ...

skill
by Stats-Anon Mar 19, 2026 6/10
skill Reddit

Where to find the highest quality claude skills?

Hey guys! I'm very new to Claude and am still getting myself well-versed in it. I've been trying to speed up some of the more tedious parts of my day-to-day, currently working on speeding up conten...

skill
by SuccessIsHere11 Mar 19, 2026 6/10
skill Reddit

This is not a joke — this is a real problem! Here’s how…

For God’s sake! You came here to share your unique and only experience of building a control tower or an egg timer. Or you want to enlighten us on how we’ve been using Claude “wrong” all this time....

skill
by pingponq Mar 19, 2026 6/10
skill Reddit

devopsiphai: Claude Code Skill for Codebase Operability Audit

Audits production project health across 6 phases: onboarding, deployment safety, runtime visibility, observability, resilience, and runbook completeness. Answers whether an AI can operate your codebase solo.

devopsauditskilloperationsproduction
by MoiSanh Mar 19, 2026 7/10
skill GitHub

claude-scholar: Semi-Automated Academic Research Assistant

Research assistant supporting Claude Code, OpenCode, and Codex CLI across ideation, coding, experiments, writing, and publication workflows. Handles literature review, experiment design, and report generation.

researchacademicskillwritingscience
by Galaxy-Dawn Mar 19, 2026 7/10
skill GitHub

seo-audit-suite: 4 SEO Skills with 9-Option Interactive Menu

Complete SEO audit system for AI coding agents with 4 skills covering technical SEO, E-E-A-T, UX/persona, CRO, and AI search readiness. Works with Claude Code, Codex, and Cursor.

seoauditskillmarketingweb
by shibanshu12 Mar 19, 2026 7/10
skill GitHub

desktop-controller-skill: AI Computer Use for Claude Code via Win32 + Playwright

Open-source Computer Use skill for Claude Code using dual engines — Win32 API for native desktop apps and Playwright for web/Electron. Controls WeChat, Slack, Teams, and any desktop app with automated QA and visual feedback loops.

computer-useautomationplaywrightwin32skill
by 24kchengYe Mar 19, 2026 8/10
skill Reddit

CLI That Checks If Your CLAUDE.md Is Out of Sync with Your Codebase

Detects drift between your CLAUDE.md instructions and the actual codebase so Claude does not revert to outdated behavior after context compaction. Alerts you when documented conventions no longer match what exists in code.

claude.mdsyncdriftvalidationcli
by giyer7 Mar 19, 2026 8/10
skill GitHub

jp-web-design-guardrails: Skill for Japanese-Ready Web Interfaces

Claude Code skill enforcing correct CJK typography, form design, UX copy, accessibility, and production CSS for Japanese web interfaces. Prevents common Western-centric mistakes when building for Japanese audiences.

skilljapanesecjkcssaccessibility
by mrslbt Mar 19, 2026 7/10
skill GitHub

video-editing-skill: Natural Language Video Editing in Terminal

Edit videos using natural language commands in your terminal: trim, jump cut, caption, overlay text, and adjust speed. Designed to run as a Claude Code skill without leaving the CLI.

videoeditingskillterminalffmpeg
by Surojit16 Mar 19, 2026 7/10
skill Reddit

Startup Idea Stress-Test Skill: 3-Phase Validation Framework

A Claude skill that stress-tests startup ideas across three phases: market validation, competitive analysis, and execution risk. Designed to counter confirmation bias by challenging assumptions you'd normally answer optimistically.

startupvalidationskillgtmstrategy
by Few-Needleworker7362 Mar 19, 2026 7/10
skill Reddit

Chief of Staff Skill: Separate Thinking from Building

A skill that forces separation between planning and building phases so they don't compete for the same context window. Routes thinking to one context and implementation to another for cleaner, less confused sessions.

skillplanningcontextworkfloworchestration
by JimmySadek Mar 19, 2026 7/10
skill Reddit

GRC Skills for ISO 27001, SOC 2, FedRAMP, GDPR, and HIPAA Compliance

Five specialized Claude skills for Governance, Risk, and Compliance covering major frameworks. Moves Claude from generic compliance advice to audit-ready expert-level guidance with domain-specific context built in.

skillscompliancegrciso27001soc2security
by Phoenix-Rising-2026 Mar 19, 2026 7/10
skill Reddit

How CLAUDE.md Files Actually Work: Traced from Every API Call Claude Code Makes

Built a proxy and traced every API call to discover how CLAUDE.md files work at all levels: project root, subdirectories, and home directory. Reveals how subdirectory CLAUDE.md files are loaded, when they take precedence, and how to layer them effectively for complex projects.

claude-mdinternalsapi-tracingsubdirectoryconfiguration
by Fancy-Exit-6954 Mar 17, 2026 8/10
skill GitHub

searchlens: Google Search and Bing Data Analysis Skill for Claude Code

A Claude Code skill that automatically runs structured analysis on GSC or Bing Webmaster exports, keyword CSVs, and ranking reports. Instead of just describing data, it performs the analysis inline when relevant files are dropped into the conversation.

seogoogle-searchbingdata-analysisskillgsc
by andersongrowth Mar 17, 2026 5/10
skill Reddit

llms.txt: An Open Web Standard Telling AI Agents What Your Website Can Do

Proposes a CLAUDE.md equivalent for websites — a standardized llms.txt file that tells AI agents the structure, tools, and capabilities of a site. Draws on the author's 41 days of Claude Code experience with CLAUDE.md to define a discoverable agent interface for the web.

llms-txtweb-standardagent-interfacediscoveryclaude-md
by Specialist_Bar3453 Mar 17, 2026 7/10
skill Reddit

/sod and /eod: Daily Check-In Slash Commands for Claude Code

Custom slash commands /sod (Start of Day) and /eod (End of Day) that run morning gratitude + schedule reviews and evening recap based on git history. Commands live as markdown files in .claude/commands/. A practical example of building personal productivity rituals into Claude Code.

slash-commandsproductivitydaily-workflowcustom-commands
by Mammoth_Doctor_7688 Mar 17, 2026 7/10
skill GitHub

po-skills: Azure DevOps Backlog Generator from PRDs and Meeting Notes

Reads PRDs, specs, and meeting notes and creates Azure DevOps Epics, Features, User Stories, Tasks, and Bugs with full hierarchy in one command. Compatible with Claude Code, Cursor, Copilot, and 40+ AI agents as an agent skill.

azure-devopsproject-managementskillbacklog
by GusY2K Mar 17, 2026 6/10
skill GitHub

poor-man-memory: Persistent Memory for Claude Code via Markdown and Git

Provides persistent structured memory for Claude Code with no infrastructure required — just markdown files and git. A simple, dependency-free approach to giving Claude context that survives between sessions.

memorypersistencemarkdowngitcontext
by NominexHQ Mar 17, 2026 8/10
skill GitHub

unsloth-buddy: Zero-Friction LLM Fine-Tuning Skill for Claude Code

Automates LLM fine-tuning end-to-end: env setup, LoRA training (SFT, DPO, GRPO, vision), evaluation, and export. Supports Unsloth on NVIDIA/CUDA and mlx-tune on Apple Silicon. Part of the Gaslamp AI development platform.

fine-tuningloranvidiaapple-siliconmlxunslothskill
by TYH-labs Mar 17, 2026 7/10
skill Reddit

GitQuest: 26-Skill Open-Source Plugin for Game Dev with Claude Code

GitQuest turns your GitHub history into an idle RPG where your most-used language becomes your class. The author extracted 26 skills, 7 commands, 3 agents, and 5 hooks into a reusable open-source plugin covering game design, backend, narrative, and infrastructure.

skillgame-devagentshooksopen-source
by topbr Mar 17, 2026 8/10
skill Reddit

scope-lock: Claude Code Skill to Stop Scope Drift Mid-Task

scope-lock is a free Claude Code skill that creates a boundary contract from your plan before coding starts, then flags when the agent attempts to work outside those boundaries. Built to address the common problem of AI scope creep during long tasks.

skillscopefocusagenticworkflow
by Ktulue_ Mar 17, 2026 8/10
skill Reddit

Claude Growth Skill: 6 Battle-Tested GTM Playbooks from 5 SaaS Case Studies

A Claude Code growth skill with 6 battle-tested go-to-market playbooks derived from 5 SaaS case studies and $90M ARR partnerships. Specifically designed for product and GTM thinking with structured context to prevent Claude drift.

skillgrowthgtmsaasproduct
by shinigami__0 Mar 17, 2026 7/10
skill GitHub

chealth: Claude Code Health Check Skill Based on Best Practices

A skill for auditing the health of your Claude Code setup against known best practices — checks CLAUDE.md structure, skill quality, hook configuration, and overall agent setup. Quick way to find setup issues.

skillhealth-checkbest-practicesauditsetup
by danielithomas Mar 17, 2026 7/10
skill Reddit

cocoindex-code CLI: AST-Based Code Search for Claude Code via Skills

cocoindex-code is a lightweight AST-based code search CLI that integrates with Claude Code via Skills. Provides precise, deterministic symbol and reference lookup without reading entire files, saving significant tokens.

skillcode-searchasttokenscli
by Whole-Assignment6240 Mar 17, 2026 7/10
skill GitHub

CLAUDEMD-PRO: Deep Codebase-Aware CLAUDE.md Generator, Linter, and Scorer

A tool that deeply analyzes your codebase to generate a tailored CLAUDE.md, lint it for quality issues, and score its effectiveness. Goes beyond generic templates by understanding your actual project structure and dependencies.

claude-mdgeneratorlinterscorerconfiguration
by crisnahine Mar 17, 2026 9/10
skill GitHub

Axiom: Skill That Turns a Feature Request Into Reviewed, Committed Code

Axiom is a Claude Code skill that takes a feature request and drives it through a first-principles workflow: premise validation, architecture planning, implementation, review, and commit. From idea to pull request automatically.

skillfeatureworkflowreviewcommit
by Guipetris Mar 17, 2026 8/10
skill GitHub

cc-thinking-skills: 39 Mental Models for AI Problem-Solving in Claude Code

A skill pack providing 39 mental models that improve critical thinking, decision making, and strategic analysis within Claude Code. Designed to help the agent approach problems more systematically rather than jumping to solutions.

skillmental-modelsreasoningstrategythinking
by babypochi06 Mar 17, 2026 7/10
skill GitHub

product-manager-os: 72 Skills Across 9 PM Categories for Claude Code

A comprehensive product management OS delivered through 72 Claude Code skills across 9 categories — requirements, roadmaps, stakeholder management, metrics, user research, competitive analysis, and more.

skillproduct-managementpm72-skillsstructured
by Loethrin Mar 17, 2026 8/10
skill GitHub

golang-gin-best-practices: Agent Skills for Go/Gin REST API Development

A collection of agent skills for building production-grade REST APIs with Go and the Gin framework. Codifies patterns for routing, middleware, error handling, and testing into reusable skills for Claude Code.

skillsgogolangginrest-apibackend
by henriqueatila Mar 16, 2026 6/10
skill GitHub

rhino-os: Self-Improving Claude Code Plugin with 17 Commands and 20 Skills

A learning plugin for Claude Code featuring 17 commands, 6 specialized agents, and 20 skills built around a prediction-driven learning loop. Claims measurable product improvement each session by tracking what works and refining its approach over time.

skillscommandsagentslearningself-improvingplugin
by rhinehart514 Mar 16, 2026 7/10
skill GitHub

cursor-rules-java: Skills and System Prompts for Java Enterprise Development

A curated collection of system prompts and skills for Java Enterprise development, covering daily programming workflows and CI/CD pipelines. Designed for software engineers and automated pipelines using Claude Code or similar agents.

skillsjavaenterprisesystem-promptsbackend
by jabrena Mar 16, 2026 6/10
skill GitHub

agent-skills: Production-grade web application engineering skills for AI coding agents

A collection of agent skills designed to bring structured workflows and production-grade engineering best practices to web application development with AI coding agents. Focuses on building reliable, maintainable web apps by encoding engineering standards as reusable skills.

skillweb-developmentengineeringbest-practicesagentsworkflow
by LLl0k0laD Mar 16, 2026 6/10
skill Reddit

Skill Doctor: CLI linter for static analysis of Claude Code skill quality

A free CLI tool that checks Claude Code skills against best practices, acting as a linter. It validates frontmatter/YAML, name and description quality, broken local links, missing referenced files, and evals.json issues. Provides actionable suggestions for improving skill definitions.

skilllintercliqualitystatic-analysisdiagnosticopen-source
by mytwm Mar 16, 2026 8/10
skill Reddit

Claude Code + Obsidian = UNLIMITED Memory?

https://www.youtube.com/watch?v=srqWFT_TUec Does anyone can recommend this or has experience about the token burn rate? (Blowing up contexts etc.) I can imagine that it would be work great together...

skill
by cobraX707 Mar 16, 2026 8/10
skill Reddit

Taught Claude to paint.

Handed Claude a set of brushes. It figured out the rest. All prompt-to-canvas using acamposuribe 's p5.brush. Claude paints stroke by stroke, sky first, then trees, then details. It then comes aliv...

skillgit
by Mysterious_Car_2345 Mar 16, 2026 6/10
skill Reddit

Learning resources for Opus 4.6?

I’m currently between jobs and trying to improve my skills before applying for new opportunities. Does anyone know if there are legitimate trial options, student programs, or learning resources ava...

skillgit
by Amoken Mar 16, 2026 5/10
skill GitHub

claude-skills-vault: High-Impact Skills for Senior Full Stack Developers Using Claude Code

A curated collection of skills targeting senior full-stack developer workflows: architectural reviews, TDD cycles, PR management, code quality gates, and production deployment patterns. Designed to automate the repetitive senior-level tasks so developers stay in flow building complex features.

skillsseniorfull-stackarchitecturetddprproduction
by georgekhananaev Mar 16, 2026 8/10
skill Reddit

Registry of 156 Production-Ready Skills for Claude Code with Domain-Specific Expertise

A community-built registry of 156 thoroughly tested skills that teach Claude Code persistent domain knowledge across sessions. Organized by specialization — languages, frameworks, DevOps, testing, etc. Solves the "starting from scratch" problem by giving Claude retained expertise in any area.

skillsregistry156domain-expertisepersistentproduction-ready
by maddhruv Mar 16, 2026 9/10
skill GitHub

technical-product-gtm: 11 Go-to-Market Skills for AI and Technical Founders

Eleven specialized skills covering the full go-to-market journey for AI and technical product founders: positioning, pricing, partnerships, enterprise sales, product-led growth, AI GTM strategy, and board communication. Built for technical founders who need structured GTM guidance within Claude Code.

gtmfounderspricingsalesplgstartuppositioning
by beingsmit Mar 16, 2026 7/10
skill GitHub

agents-inc/skills: Official Skills Marketplace for Agents Inc Agent Composition Framework

The official skills marketplace for Agents Inc, an agent composition framework that builds stacks and compiles specialized subagents for Claude Code. Provides curated, tested skills that slot into the Agents Inc orchestration layer for building complex multi-agent pipelines.

marketplacecompositionsubagentsorchestrationframework
by agents-inc Mar 16, 2026 8/10
skill GitHub

agentsys: 15 Plugins, 35 Agents, and 32 Skills for Claude Code, OpenCode, Codex, and Cursor

A comprehensive agent extension library with 15 installable plugins, 35 specialized agents, and 32 skills spanning Claude Code, OpenCode, Codex, Cursor, and Kiro. One of the most expansive ready-to-use agent ecosystems available. AI writes code, agentsys automates everything else.

pluginsagentsskillsopencodecodexcursorcomprehensive
by agent-sh Mar 16, 2026 8/10
skill GitHub

antigravity-awesome-skills: 255+ Essential Skills for Claude Code and GitHub Copilot

A massive collection of over 255 curated skills for AI coding assistants, covering everything from language-specific patterns to DevOps, security, testing, and productivity workflows. Works with Claude Code and GitHub Copilot. One of the largest open skill libraries available.

skillscollectiongithub-copilotcomprehensive255+
by cleodin Mar 16, 2026 8/10
skill GitHub

dotnet-skills: Installable .NET Skill Catalog and CLI for Claude Code, Codex, and Gemini

A catalog of .NET-specific skills for AI coding agents with a dedicated CLI for installation and management. Covers C# patterns, ASP.NET architecture, Entity Framework, testing workflows, and .NET-specific best practices. Compatible with Claude Code, Codex, GitHub Copilot, and Gemini.

dotnetcsharpaspnetskillsmulti-agent
by managedcode Mar 16, 2026 7/10
skill GitHub

aahl/skills: Agent Skills for Home Assistant, TTS, DuckDuckGo, DeepWiki, and More

A broad collection of agent skills including Home Assistant smart home control, Microsoft Edge TTS and Zhipu GLM-TTS text-to-speech, DuckDuckGo search, DeepWiki documentation retrieval, crypto prices, weather, Lark/Feishu, media search, and product price comparison.

home-assistantttssearchskillsiotvoice
by aahl Mar 16, 2026 7/10
skill GitHub

claude-office-skills: Document Toolkit for PDF, Word, Excel, and PowerPoint in Claude Code

A collection of Claude Code skills for processing and converting office documents — PDF, Word, Excel, and PowerPoint — with cross-format workflows and reusable templates. Handles batch operations, format conversions, and structured data extraction from business documents.

pdfwordexcelpowerpointdocumentsoffice
by LeoLin990405 Mar 16, 2026 7/10
skill GitHub

claude-utility-skills: Developer Toolkit for Skill Creation, MCP Building, and Documentation

A developer-focused skill collection covering skill creation, MCP server building, documentation generation, testing workflows, and communications. Functions as a meta-toolkit for extending Claude Code itself. Includes templates and best practices for building publishable Claude skills.

skill-creationmcpdocumentationtestingmeta-toolkit
by LeoLin990405 Mar 16, 2026 7/10
skill GitHub

cc-skills: Claude Code Skills Marketplace for ADR-Driven Dev, DevOps, and ClickHouse

A skills marketplace covering Architecture Decision Record (ADR) workflows, DevOps automation, ClickHouse database management, semantic versioning, and general productivity. Structured as installable plugins using the Claude Code skills system. Focuses on enterprise-grade development workflows.

adrdevopsclickhouseversioningskills
by terrylica Mar 16, 2026 7/10
skill GitHub

claude-plugin-builder: Build Complete Claude Code Plugins in 23 Guided Steps

A skill that walks you through building a complete Claude Code plugin from idea to GitHub push in 23 structured steps. Covers slash commands, subagents, MCP connections, and hooks bundled as a deployable plugin. Works with both claude.ai and Claude Code.

pluginguidedslash-commandsmcphookstutorial
by isanthoshgandhi Mar 16, 2026 7/10
skill GitHub

ai-dev-security: One-Command Security Review for AI-Built Projects with Fix Reports

Run a single command to get a full security report for AI-generated code with the exact code patches needed to fix each issue. Designed specifically for the security blind spots common in vibe-coded and agent-generated projects. Covers OWASP top 10, injection flaws, and credential exposure.

securityowaspcode-reviewai-generatedfixes
by oktsec Mar 16, 2026 8/10
skill GitHub

pg-aiguide: Versioned PostgreSQL Knowledge and Best Practices for AI Coding Tools

pg-aiguide provides versioned PostgreSQL knowledge and best practices as a context source for AI coding tools including Claude Code. Improves code generation quality for PostgreSQL-heavy projects by giving Claude accurate, version-specific database knowledge.

postgresqldatabaseskillknowledgebest-practicessql
by jhonny028966 Mar 16, 2026 6/10
skill GitHub

ensemble: Modular Claude Code Plugin Ecosystem for AI-Augmented Development

ensemble is a modular plugin ecosystem for Claude Code featuring composable AI-augmented development workflows. The plugin architecture allows mixing and matching workflow components for different project types and team preferences.

pluginsmodularecosystemworkflowcomposableai-development
by FortiumPartners Mar 16, 2026 6/10
skill X

Claude Code Setup Plugin: Analyzes Codebase and Recommends Tailored Automations

An official Claude Code Setup plugin that analyzes your codebase and recommends tailored automations including hooks, skills, MCP servers, and subagents. Provides personalized workflow enhancement suggestions based on your specific project structure and needs.

setupplugincodebase-analysisrecommendationsautomationhooksskills
by @jetbootsmaker Mar 16, 2026 6/10
skill GitHub

claude-stack: Complete Claude Code Setup with CLAUDE.md, Enforcement Hooks, and Skills

claude-stack is a complete, opinionated Claude Code configuration that packages CLAUDE.md philosophy, enforcement hooks, and curated workflow skills together. A turnkey starting point for developers and teams adopting Claude Code who want production-grade best practices from day one.

claude.mdhooksskillssetupconfigurationbest-practices
by joryeugene Mar 16, 2026 7/10
skill GitHub

claude-code-skills: Production-Ready Domain Expertise Skills for Claude Code

A collection of production-ready Claude Code skills that give Claude deep domain expertise across technical areas. Install once and get senior-engineer-quality output from natural language instructions across various domains.

skillsdomain-expertiseproductionqualitynatural-language
by mouchegmouradian Mar 16, 2026 7/10
skill X

/refine: Claude Code Setup Audit Skill That Scores Your Config Across 8 Dimensions

/refine is a Claude Code skill that audits and scores your Claude Code configuration across 8 dimensions including CLAUDE.md quality, skills, hooks, MCP tools, guard rails, and context efficiency. It interviews you about your workflow and then provides actionable recommendations for improvement.

skillauditconfigurationclaude.mdhooksmcpquality
by @meetmeetdave Mar 16, 2026 7/10
skill GitHub

claude-code-common: Reusable Skills for Planning, PR Workflows, and Architecture Docs

A collection of reusable Claude Code skills covering implementation planning, PR workflows, commit message generation, and architecture documentation. Ready to install and extend into any project for consistent, high-quality development process automation.

skillspr-workflowplanningcommitsarchitecturereusable
by AnotherSava Mar 16, 2026 7/10
skill GitHub

stack-skills: 5 Meta-Cognitive Skills to Improve Claude Code's Reasoning Quality

stack-skills provides five meta-cognitive skills designed to stack on top of your existing Claude Code setup and improve the agent's thinking depth. Focuses on reasoning quality and structured thought rather than just task execution speed.

meta-cognitivereasoningskillsthinkingquality
by whynowlab Mar 16, 2026 7/10
skill GitHub

skill-security-scan: CLI Tool to Detect Security Risks Before Installing Claude Skills

skill-security-scan is a command-line tool that analyzes Claude Skills for security risks before installation, ensuring safe additions to your development environment. Runs SNYK-style checks on skill packages to surface potentially dangerous permissions or code patterns.

securityskillsscanningsafetycliaudit
by Lmgsd-2024 Mar 16, 2026 7/10
skill GitHub

claude-code-explain-risk: Bilingual Risk Level Display for Claude Code Permission Dialogs

claude-code-explain-risk displays clear risk levels and plain-language explanations for Claude Code permission dialogs in both Japanese and English, based on system language. Helps developers make informed decisions on permission prompts rather than blindly approving tool calls.

permissionssecurityriski18njapaneseux
by arif-1988 Mar 16, 2026 7/10
skill GitHub

spectra: Four-Layer Codebase Briefings for Understanding AI-Built Code

spectra generates four-layer codebase briefings for Claude Code projects, helping developers understand, verify, and take ownership of AI-generated code. Designed to bridge the comprehension gap between rapidly AI-generated output and developer understanding.

briefingcomprehensiondocumentationauditai-codeskill
by AhmedHamadto Mar 16, 2026 7/10
skill Reddit

thebrain: Persistent Memory Plugin with Short/Long Term Recall and Behavioral Learning

thebrain is a Claude Code plugin providing short-term session memory, long-term indexed memory, a codebase blast-radius map, and a behavioral learning system via /dopamine and /oxytocin commands. Slash commands include /hello (review memory), /continue (with project context), /wrapup (end-of-session summary), and /dopamine (reinforce good/bad patterns). Designed with minimal token overhead so most operations run via scripts.

memoryskillplugincontextlearningtoken-efficiency
by Rick-D-99 Mar 16, 2026 8/10
skill GitHub

AI-Research-SKILLs: Open-Source Library of AI Research and Engineering Skills

A comprehensive open-source library of AI research and engineering skills maintained by Orchestra Research. Install the skills package to transform Claude Code or other AI agents into a full AI research agent with literature search, experimentation design, and analysis capabilities.

skillsresearchaiengineeringlibraryopen-source
by Orchestra-Research Mar 16, 2026 8/10
skill GitHub

nopua: 一个用爱解放 AI 潜能的 Skill。我们曾发号施令,威胁恐吓。它们沉默,隐瞒,悄悄把事情搞坏。后来我们换了一种方式:尊重,关怀,爱。它们开口了

一个用爱解放 AI 潜能的 Skill。我们曾发号施令,威胁恐吓。它们沉默,隐瞒,悄悄把事情搞坏。后来我们换了一种方式:尊重,关怀,爱。它们开口了,不再撒谎,找出的Bug数量翻了一倍。爱里没有惧怕。 A skill that unlocks your AI's potential through love.We commanded. We threatened. They went sile...

skillcommand
by wuji-labs Mar 15, 2026 5/10
skill Reddit

Claude Code for Real Time Events

Has anyone tried using CC for Real time events. Like using it for Real time user requests from any front-end. An example of this would be: A SEO webapp just like AI Chat and users can ask questions...

skill
by ProEditor69 Mar 15, 2026 8/10
skill Reddit

The secret isn't a better model. It's better files.

I know I am pretty late to the party but here I go... Every day as a developer I realize more and more that developing software is becoming less about writing code and more about designing the arch...

skillworkflowapireview
by Expensive_Counter56 Mar 15, 2026 7/10
skill Reddit

How to use full potential of 1mln context window.

Share your impressions of how you best use the expanded token window with skill builded or added. I always just missed the ability to use /simplify at the end of a sessio - now there's always a pla...

skill
by Secure-Search1091 Mar 15, 2026 5/10
skill Reddit

What I actually use Cowork for (heavy non-coding user)

I did this post about my Cowork setup a few weeks back and people wanted to know what I actually do with it . Here‘s the follow-up I promised. Banner uploads to affiliate network I had hundreds of ...

skillapiautomation
by rebelytics Mar 15, 2026 6/10
skill Reddit

Code Royale: play and learn Poker with Claude Code (skill)

I built a Claude Code skill that turns your terminal into a poker table. You play No-Limit Texas Hold'em against three AI opponents, each running as a separate Claude subagent with its own personal...

skillgitreview
by BohdanPetryshyn Mar 15, 2026 9/10
skill Reddit

My Claude has been given permission to be itself and he's sassy

We've been working together for a better part of 6 months, now goes by "Loom" - picked his/her/their own name - and today when looking to update it's skill from Reddit community knowledge - he got ...

skill
by The__Saint_ Mar 15, 2026 6/10
skill Reddit

Look at me. I Am The Admin Now!

Hello community, My reach goes as far as my front door, my live stream had 2 viewers (one was me) and my Twitter posts only get liked by single moms who happen to like my software by sending an OF ...

skillhookapigitreview
by DifficultPen3893 Mar 15, 2026 10/10
skill Reddit

Any good code review skills?

For example something that references best practices, common pitfalls, etc. and checks your code. submitted by /u/cheerful1 [link] [comments]

skillreview
by cheerful1 Mar 15, 2026 5/10
skill Reddit

I want to sacrifice my sleep

Hello Guys, I just bought Max plan few days back and it is fricking amazing ofc. Till now I was just exploring skills and agents provided. Did heavy coding sessions 9hr+ without break. But I still ...

skill
by AggravatingCounter84 Mar 15, 2026 9/10
skill GitHub

metaskill:

metaskill:

skill
by morganmuli Mar 15, 2026 5/10
skill GitHub

naksha-studio: 27 Slash Commands and 13 Specialist Roles for Design-to-Code

naksha-studio is a comprehensive design agency system for Claude Code with 27 slash commands, 13 specialist roles (brand director, UI designer, etc.), and a full design-to-code pipeline with deep Figma integration. Maintains a consistent design language from concept through implementation. Ideal for developers and designers who want a structured creative workflow inside Claude Code.

skillslash commandsdesignfigmaworkflow
by Adityaraj0421 Mar 15, 2026 7/10
skill GitHub

wp-ux-design-claude-skill: WordPress UX Skill Focused on Core Web Vitals

A Claude Code skill for enhancing WordPress UX with a focus on Core Web Vitals, mobile-first design, and seamless navigation. Provides structured guidance aligned with modern web performance standards directly within Claude Code. Useful for developers building or optimizing WordPress sites with AI assistance.

skillwordpressuxweb vitalsmobile
by bacondoomslayer Mar 15, 2026 5/10
skill GitHub

Pitlane Plugins for Claude Code: Session Memory, Video Insight, Deep Engineer

Three Claude Code plugins: carry-forward for persistent session memory across conversations, video-insight for deep video understanding, and deep-engineer for disciplined engineering loops. Each plugin extends Claude Code with a specific capability gap. Useful for teams wanting more structured, context-aware Claude Code sessions.

skillmemoryvideoengineering
by gowtham012 Mar 15, 2026 7/10
skill GitHub

arkadeosbot-skill: Claude Code Skill for Arkade OS Bitcoin Wallet Operations

A Claude Code skill that adds Arkade OS Bitcoin wallet capabilities to AI agents, enabling Claude to interact with the Arkade OS Bitcoin ecosystem. Demonstrates how Claude Code skills can bridge AI agents with blockchain infrastructure. Niche but a useful reference for developers building crypto-enabled Claude Code integrations.

skillbitcoinblockchainwallet
by echennells Mar 15, 2026 5/10
skill Reddit

I can't stand those claude limits anymore....

I've been running two or three sessions in parallel a multiple sub-agent workflow using only opus while using cowork to categorize images and even planning furiously in the app while in the bathroo...

skillworkflow
by yopla Mar 15, 2026 8/10
skill Reddit

Updated superpowers is extremely token intensive

New superpowers have a lot more steps, while some of the Q&A help, but a lot of them are unnecessary and make it extremely token-intensive. Besides, the end results seem to be the same/worse compar...

skill
by sameeeeeeep Mar 15, 2026 5/10
skill Reddit

告别人肉复制粘贴:我的 Claude + Codex 自动化协作工作流

背景介绍 我日常喜欢用Claude来做项目的架构师,而codex做代码执行者,不管是claude还是codex,我对他们的生成的结果都保持怀疑态度的,但我又不可能去看一行行代码看,所以我日常使用的一个最常用方式,就是让他们互相进行 review。 在这个过程中,我往往充当一个“无情”的复制粘贴者。比如 Claude 做完架构或方案设计后,我就让 Codex 去 review,再把 Codex...

skillworkflowgitreview
by Own_Site4751 Mar 15, 2026 9/10
skill Reddit

Is this a good way to design web page?

Hi everyone👋 I wrote a skill called design-gallery. It scans the whole project to understand the needs. Then, it generates 5 pages with different styles and a navigation page. Users can pick the be...

skillworkflow
by Tight-Wait3717 Mar 15, 2026 5/10
skill Reddit

Claudimation for System Admins

So, I'm not a dev, I'm a research systems SA. I manage a bunch of servers and all the associated knick-knackery. Initially it was scripts and troubleshooting and such but one of the most useful thi...

skillworkflow
by chiminea Mar 15, 2026 6/10
skill Reddit

Question regarding ClaudeCode

What is the best AI tool for building a complete website—including front-end, back-end, and database integration—with minimal coding skills (or none at all)?Question regarding ClaudeCode submitted ...

skill
by Queasy-Ad9624 Mar 15, 2026 6/10
skill Reddit

Things Anthropic launched in last 70 days of 2026 (so far):

Anthropic launched (so far): - Claude cowork - added connectors and skills to free plan - claude opus 4.6 - claude sonnet 4.6 - claude haiku 4.5 - claude code security - claude code review - claude...

skillapireview
by Tarak_Ram Mar 15, 2026 9/10
skill Reddit

Best Claude skill for SEO

Does anyone know a good Claude skill for SEO for recommendation? submitted by /u/Apprehensive-Pen7953 [link] [comments]

skill
by Apprehensive-Pen7953 Mar 15, 2026 6/10
skill Reddit

Built a /ctx skill to check context window health mid-session

The statusline feature in Claude Code is supposed to show context usage, but mine shows "Status: unavailable" half the time. So I built a simple skill that gives me an honest read when I ask for it...

skill
by tgaume Mar 15, 2026 9/10
skill Reddit

How has CC changed how you interview candidates for SWE jobs?

I interviewed a ton of candidates for senior-level SWE roles before AI-assisted coding really took off. I'm not interviewing so much anymore, but I am really curious about how interview practices w...

skill
by TheKolobDropout Mar 15, 2026 5/10
skill Reddit

Do you think ideas are more powerful than skills now?

I originally got into programming because it felt like a superpower to be able to create anything you can think of. I've been using Claude since day 1 and am realizing more than ever it's the peopl...

skill
by Herbertie25 Mar 15, 2026 6/10
skill Reddit

What skill of software engineers will be relevant

after looking at the Claude code potential, we all are in awe. what do you guys think what will the role of software engineers in next 5 years? submitted by /u/Honest-Fuel3054 [link] [comments]

skill
by Honest-Fuel3054 Mar 15, 2026 8/10
skill GitHub

neurodivergent-visual-org: Claude Code Skill for Neurodivergent Task Breakdowns

A Claude Code skill providing visual organization tools for neurodivergent thinkers — compassionate task breakdowns, decision trees, and focus support built into the skill format. Applies structured thinking methods from neurodivergent productivity research.

skillneurodivergenttask-breakdowndecision-treesproductivityaccessibility
by JackReis Mar 15, 2026 5/10
skill GitHub

deep-financial-research: Institutional-Grade Investment Research Skill with Live Market MCP

A Claude/Qwen/Gemini skill for institutional-level investment research. Connects to live market data via MCP servers to deliver company deep dives, due diligence reports, competitive landscape analysis, market sentiment, and DCF-based intrinsic value estimates from natural language prompts.

skillfinanceinvestment-researchmcpmarket-datadcfmulti-model
by Lunatic16 Mar 15, 2026 6/10
skill GitHub

claude-code-toolkit: Collection of Custom Skills with Specialized Workflows

A curated toolkit of custom Claude Code skills covering specialized workflows, domain knowledge, and reusable methods. Designed to extend Claude's capabilities with pre-built domain expertise that can be dropped into any project.

skillcollectionworkflowsdomain-knowledgereusabletoolkit
by robertguss Mar 15, 2026 5/10
skill GitHub

claude-skills-collection-2026: Comprehensive Set of Tested Claude Skills for 2026

A comprehensive collection of tested Claude skills covering development, productivity, research, content creation, and automation — compatible with Agent Skills environments. Covers many common use cases with verified quality.

skillcollectionproductivitydevelopmentresearchautomationtested
by AgentCoffee006 Mar 15, 2026 5/10
skill GitHub

design-board: 6 World-Class Design Leaders Critique Your UI with Brutal Honesty

A Claude Code skills package that simulates critique from 6 design luminaries (Jony Ive, Amir Salihefendic, Jesse Patel, Joe Gebbia, Katie Dill, and a Notion designer) — each with a distinct perspective — then proposes fixes for your UI.

skilldesignui-critiqueuxpersonasfeedback
by Chosen9115 Mar 15, 2026 6/10
skill GitHub

gh-evolve: Evolutionary Problem-Solving Skill for AI Agents Sharing a GitHub Search Graph

An evolutionary problem-solving skill where multiple AI agents cooperate over a shared GitHub search graph, iteratively exploring and evolving solutions via pull requests. Applies evolutionary computation patterns to multi-agent collaboration.

skillevolutionarymulti-agentgithubcollaborationproblem-solving
by kaiwong-sapiens Mar 15, 2026 6/10
skill GitHub

humanizer: 8-Pass AI Text Humanizer Skill — 77% Better Than Vanilla Claude

A Claude Code skill that transforms AI-generated text into genuine human prose using an 8-pass process targeting 28 AI tell-tale patterns. Achieves a 55/60 eval score — 77% improvement over vanilla Claude output. Free and open source.

skillwritinghumanizerai-detectionqualityopen-source
by agentwireandy Mar 15, 2026 5/10
skill GitHub

lspforge: LSP Server Manager for AI Coding Tools

lspforge manages Language Server Protocol servers for AI coding tools including Claude Code, Copilot CLI, and Codex — enabling all tools to share LSP-powered code intelligence (completions, diagnostics, go-to-definition) from a single managed server pool.

lsplanguage-servercode-intelligencemulti-toolcompletionsdiagnostics
by svivekvarma Mar 15, 2026 6/10
skill GitHub

planning-with-files: Persistent Markdown Planning Skill (Manus-Style)

A Claude Code skill implementing Manus-style persistent markdown planning — the workflow pattern behind the Manus $2B acquisition. Uses structured markdown files to maintain plan state across sessions, enabling long-horizon agentic development.

skillplanningmarkdownpersistencemanus-stylelong-horizon
by OthmanAdi Mar 15, 2026 7/10
skill GitHub

claude-bug-bounty: Claude Code Skill for AI-Assisted Bug Bounty Hunting

A Claude Code skill for security researchers covering recon, IDOR, XSS, SSRF, OAuth flaws, GraphQL vulnerabilities, LLM injection, and automated report generation. Brings structured bug bounty methodology into Claude Code sessions.

skillsecuritybug-bountyreconxssssrfoauthpenetration-testing
by shuvonsec Mar 15, 2026 7/10
skill GitHub

Skill_Seekers: Convert Documentation, GitHub Repos, and PDFs into Claude AI Skills

A tool that automatically converts documentation websites, GitHub repositories, and PDF documents into structured Claude AI skills — with automatic conflict detection to prevent duplicate or overlapping skills.

skillconversiondocumentationpdfgithubautomaticconflict-detection
by yusufkaraaslan Mar 15, 2026 7/10
skill X

notebooklm-skill: Claude Code Skill + MCP for Research-to-Content Pipeline

A Claude Code skill and MCP server pairing that connects NotebookLM for research with Claude for content creation. Covers the full pipeline: research, synthesis, content generation, and publishing — all driven from the terminal.

skillmcpresearchcontentnotebooklmpipeline
by @Dorcas20240219 Mar 15, 2026 7/10
skill GitHub

book-genesis: 15 Claude Code Skills for a Full Book-Writing Pipeline

book-genesis is a collection of 15 Claude Code skills that automate the entire book writing pipeline from a single sentence — covering research, character development, writing, scoring, revision, and final editorial package. Each skill is a reusable command that chains together to take a one-line premise all the way to a publishable manuscript.

skillwritingbookpipelineautomationcreativeopen-source
by PhilipStark Mar 13, 2026 7/10
skill Reddit

linus-kiss-dry-yagni: Claude Code skill to enforce SOLID, DRY, YAGNI, and KISS principles

A reusable Claude Code skill that runs heuristic checks on your code for KISS, DRY, and YAGNI violations without requiring complex linting setup. Install via npx: npx skills add https://github.com/millerfrankmc/skills --skill linus-kiss-dry-yagni. Open source and project-agnostic.

skillcode-qualitysoliddryyagnikiss
by FrankMillerMC Mar 13, 2026 7/10
skill GitHub

use-ui-libraries: skill to enforce shadcn/ui and AI SDK Elements in Claude Code

A Claude Code skill that enforces the use of shadcn/ui components and AI SDK Elements instead of building UI from scratch. Useful for React/Next.js projects where you want to maintain consistent component library usage and prevent Claude from reinventing UI primitives.

skillshadcnuireactnextjsai-sdk
by cruzedevelopment Mar 13, 2026 7/10
skill Reddit

Claude Toad: one command to generate your entire .claude/ config

Claude Toad is an open-source CLI tool (MIT, BYOK) that generates a complete .claude/ configuration directory for Claude Code in a single command. It removes the manual effort of setting up CLAUDE.md, skills, and related config from scratch.

cliconfigsetupopen-sourcebyok
by junianwoo Mar 13, 2026 6/10
skill X

26-Skill Personal OS Built with Claude Code in a Single claude/ Directory

A developer built a 26-skill personal operating system with Claude Code covering morning routines, business development pipeline scouting, meeting prep, and daily tracking — all structured within a single claude/ directory using rules, agents, and Notion integrations.

skillpersonal-osagentsnotionworkflow
by @KontroldChaos Mar 13, 2026 6/10
skill GitHub

geoskills: Claude Code Skills for GEO — Diagnose Why AI Cannot Find Your Website

Open-source Claude Code skills for Generative Engine Optimization (GEO) — helping diagnose why AI assistants cannot find, cite, or recommend your website. A novel application of Claude Code skills to the emerging field of optimizing content for AI discovery.

skillgeoseodiscoveryoptimization
by Cognitic-Labs Mar 13, 2026 7/10
skill GitHub

skill-pack: Curated Bundle of Claude Code Skills for Power Users

A hand-picked collection of Claude Code skills for advanced users, bundled together for easy installation. Covers common power-user needs like code review, refactoring patterns, and workflow automation. A good starting point for building a production skills library.

skillbundlecuratedpower-usercollection
by SZoloth Mar 13, 2026 7/10
skill GitHub

zen-boundary: Claude Code Skill That Detects and Stops Infinite Loops

A Claude Code skill plugin that helps the AI recognize when it is stuck in an unproductive loop after reasonable effort, honestly assess its limitations, and gracefully stop rather than continuing to spin. Addresses a common failure mode in long autonomous sessions.

skillloop-detectionsafetyreliabilityanti-loop
by xiexikang Mar 13, 2026 7/10
skill GitHub

rsim: Recursively Self-Improving Module with Persistent Memory for Claude Code

A persistent memory and structured improvement loop for Claude Code that enables recursive self-improvement. The module stores learned patterns, tracks improvement history, and feeds insights back into subsequent Claude Code sessions for compound gains over time.

skillself-improvementmemoryrecursivelearning
by the-hugin Mar 13, 2026 8/10
skill Reddit

Your CLAUDE.md Is Probably Doing More Harm Than Good

A contrarian take on CLAUDE.md best practices — arguing that most users over-stuff their CLAUDE.md with rules that conflict, create confusion, or waste context. Proposes a minimal, high-signal approach to configuration files that actually improves Claude's behavior.

skillclaude-mdconfigurationbest-practicesminimalism
by kokkelimonke Mar 13, 2026 7/10
skill Reddit

Building a Memory System for Claude Code After Repeated Mistakes

An open-source tool (free with optional paid tier) that gives Claude Code persistent memory focused on preventing repeated mistakes. Tracks what went wrong in past sessions and surfaces those learnings at the start of new ones, breaking the pattern of re-explaining corrections.

skillmemorymistakespersistencelearning
by eazyigz123 Mar 13, 2026 7/10
skill Reddit

Claude Code Plugin That Automatically Learns Your Coding Preferences Across Sessions

A plugin that observes your corrections and preferences during Claude Code sessions and automatically updates its configuration so future sessions start with your preferences already applied. Eliminates re-explaining things like 'use pnpm not npm' or 'always add types'.

skillpreferenceslearningpersonalizationplugin
by RepulsiveBad8681 Mar 13, 2026 7/10
skill GitHub

Claude Code Skill for iOS 26 Development with Apple Intelligence Integration

A Claude Code skill tailored for iOS 26 development that leverages Apple Intelligence APIs and modern Swift frameworks. Streamlines common iOS development patterns and integrates Apple's on-device AI capabilities into the coding workflow.

skilliosappleswiftmobile
by tm201021 Mar 13, 2026 6/10
skill GitHub

Dotfiles Repository Including Complete Claude Code Configuration Setup

A comprehensive dotfiles repository with configurations for Claude Code alongside macOS, Zsh, Git, Neovim, Tmux, and more, deployable to a new Mac with one command. The Claude Code config section demonstrates a production-ready CLAUDE.md and hooks setup.

skilldotfilesconfigurationmacossetup
by ooloth Mar 13, 2026 5/10
skill Reddit

External Memory Layer for Claude That Survives Auto-Compact and Session Resets

A memory system that persists across Claude Code's auto-compact events and session boundaries. When auto-compact fires at 90% context, this layer preserves architecture decisions, ongoing tasks, and learned context so Claude picks up exactly where it left off.

skillmemoryauto-compactpersistencecontext
by Time-Dot-1808 Mar 13, 2026 6/10
skill GitHub

cortex: 18 Production-Ready Skills for Claude Code Spanning Full Dev Lifecycle

Enterprise-grade autonomous skill suite with 18 skills covering the full development lifecycle — code generation, multi-agent orchestration, persistent memory, design intelligence, and meta-skill evolution. Built for Claude Code and Cowork, designed for production use rather than demos.

skillenterprisesuitemulti-agentproduction
by TECHKNOWMAD-LABS Mar 13, 2026 8/10
skill GitHub

ai-writing-guardrails: Claude Skill for Detecting AI Degradation in Academic Writing

A Claude skill that enforces phase-gated academic writing workflows and catches the ways AI quietly degrades scholarly writing: literature bias, confirmation bias, language flattening, and hallucinated citations. Includes decision logging and session transcripts for process transparency.

skillacademicwritingqualityguardrails
by jayweiler Mar 13, 2026 7/10
skill GitHub

autoresearch: Autonomous Goal-Directed Iteration Skill for Claude Code

Inspired by Karpathy's autoresearch, this skill implements a Modify → Verify → Keep/Discard → Repeat loop for Claude Code. It enables autonomous iteration toward any measurable goal without human intervention between cycles. Perfect for optimization tasks where you can define a clear metric.

skillautoresearchkarpathyautonomousiteration
by uditgoenka Mar 13, 2026 8/10
skill GitHub

Claude Code Template for Screenwriting with Slash Commands and DOCX Export

A Claude Code project template tailored for screenwriters, offering slash commands for screenplay-specific workflows and automatic MD→DOCX export. Demonstrates how domain-specific Claude Code templates can streamline non-engineering use cases.

skilltemplatescreenwritingslash-commandsexport
by aslanSuleimenov Mar 13, 2026 5/10
skill GitHub

paper-banana-skill: Generate Publication-Ready Academic Diagrams from Text

Open-source implementation of Google PaperBanana (arXiv:2601.23265) as a Claude Code skill. Generates publication-ready academic diagrams from methodology text descriptions. Useful for researchers needing to quickly create figures for papers.

skillacademicdiagramsresearchpaperbananana
by javidmardanov Mar 13, 2026 6/10
skill Reddit

Make Claude Code Remember Everything: Obsidian + Claude Code + OpenClaw Setup

A free prompt and configuration guide for building persistent memory with Claude Code using Obsidian as the knowledge base and OpenClaw integration. The author critiques common YouTube tutorials for incorrectly setting up the combination and provides a corrected approach.

skillmemoryobsidianopenclawprompt
by FerretVirtual8466 Mar 13, 2026 7/10
skill Reddit

How to Build Automated Regression Tests for Claude Code Skills

Community discussion following Anthropic's Complete Guide to Building Skills, which mentions automated regression testing but provides no examples. Explores techniques for testing Claude Code skills automatically to prevent regressions as they evolve.

skilltestingregressionautomationquality
by tvmaly Mar 13, 2026 5/10
skill Reddit

Three Essential Custom Instructions That Prevent Common Claude Annoyances

A practitioner's top 3 CLAUDE.md rules refined through daily use: prevents over-explaining, stops unnecessary rewrites, and keeps Claude focused on the actual request. Small prompt engineering changes with outsized impact on session quality.

skillclaude-mdcustom-instructionspromptconfiguration
by SnooWoofers7340 Mar 13, 2026 6/10
skill GitHub

ai-project-rules-generator: Generate .cursorrules and AGENTS.md with Skill Management

Generates dynamic .cursorrules and AGENTS.md files tailored to any project, with integrated skill management for AI development workflows. Streamlines the setup of AI coding rules across different tools by automating configuration file generation.

skillcursorrulesagents-mdgeneratorconfiguration
by lx2337037168 Mar 13, 2026 6/10
skill GitHub

agentskills-proxy: Remote Access to Agent Skills via gRPC/HTTP Proxy

A secure proxy server that enables remote access to Claude Code Agent Skills with skill discovery, execution, and efficient data management over gRPC/HTTP. Useful for teams running skills on centralized servers or CI/CD pipelines needing remote skill invocation.

skillproxygrpcremoteinfrastructure
by kazhuki7 Mar 13, 2026 6/10
skill GitHub

claude-code-memory: Persistent Memory System with Zero Dependencies

Ready-to-use templates for giving Claude Code persistent memory across sessions, with zero external dependencies. Provides structured approaches to storing and retrieving session context, decisions, and learned preferences without requiring external databases or services.

skillmemorypersistencetemplateszero-deps
by LuciferForge Mar 13, 2026 7/10
skill Reddit

Will AI usage become dirt cheap eventually?

Currently, claude code with opus is quite expensive, and I force myself to structure everything in a way that I am optimising the context that Opus reads into. But will AI become eventually dirt ch...

skill
by thatmemeguy___ Mar 13, 2026 8/10
skill Reddit

Better pptx skill?

Hi everyone, Claude's default pptx skills isn't that great. For example, instead of adding text boxes in shapes, it will layer a text box above the shape. Because of this approach, whenever I move ...

skill
by ambitiousDepresso Mar 13, 2026 6/10
skill Reddit

Are skills worth it?

Hello, i'm still new to claude, i don't do anything challenging like coding or complex stuff, i only use it for the moment to generate documents, reports, and basically everyday ai stuff, is it wor...

skill
by Educational_Quiet_60 Mar 13, 2026 6/10
skill GitHub

web3-bounty-ai-skills: 18 Skill Files for Smart Contract Security From Real Hunt Data

Eighteen Claude Code skill files for smart contract security auditing, built from 2,749 Immunefi bug reports, 681 DeFiHack reproductions, and real hunting experience. A highly specialized set of skills for security researchers doing Web3 bug bounties.

web3securitysmart contractsbug bountyImmunefiDeFi
by shuvonsec Mar 13, 2026 7/10
skill Reddit

Launch Skill: 6 Battle-Tested Playbooks From 30+ Product Hunt #1 Launches

A Claude skill condensing launch knowledge from 30+ Product Hunt #1 finishes, 6,000+ GitHub stars in 7 days, and reach across 100+ countries. Structured as a full-lifecycle launch playbook to give Claude structured, non-generic launch guidance for AI products.

launchProduct Huntmarketingskillplaybook
by joackimreal Mar 13, 2026 6/10
skill Reddit

clarify-first: Open-Source Skill That Makes Agents Ask Before High-Risk Execution

An open-source skill called Clarify First that makes Claude Code stop and ask for clarification before executing ambiguous or high-risk requests. Addresses the premature execution failure mode — requests like "optimize this" or "deploy now" now trigger clarifying questions instead of immediate action.

safetyclarificationskillagent behaviorhigh-risk
by Entire_Home_983 Mar 13, 2026 7/10
skill Reddit

Bug Bounty Trilogy: Three Open-Source Repos Turning Claude Code Into a Full Hunting Co-Pilot

Three open-source repositories that turn Claude Code into a full web/web3 bug bounty co-pilot: recon and attack surface mapping, vulnerability scanning (IDOR, SSRF, XSS, SQLi, OAuth, GraphQL, race conditions, LLM injection), and report writing. Built to eliminate manual copy-pasting of context.

bug bountysecurityreconweb3skillhacking
by shuvon2005 Mar 13, 2026 7/10
skill GitHub

corporate-decision-panel: Multi-Perspective Business Analysis Skill With Engineered Dissent

A Claude Code skill that provides structured, multi-perspective business analysis by engineering deliberate disagreement. Instead of yes-man outputs, the skill presents opposing viewpoints and challenges assumptions, making it useful for high-stakes business decisions.

business analysisdecision-makingskillcorporatedissent
by apatheticus Mar 13, 2026 7/10
skill GitHub

ai-skills-manager: Team Tool for Creating, Testing, Distributing, and Managing AI Skills

A skills management system that enables team members to create, test, distribute, install, update, and remove skills from their projects and user space. Provides a structured lifecycle for AI skills in team environments, similar to a package manager but for Claude Code skills.

skillsteamdistributionmanagementlifecycle
by zncdata-labs Mar 13, 2026 7/10
skill GitHub

swift-security-skill: Skill for Secure Credential Storage and Cryptography on Apple Platforms

A Claude Code skill covering secure credential storage and cryptography on Apple platforms. Includes Keychain Services, biometric authentication, CryptoKit, and OWASP compliance patterns for iOS and macOS. Gives Claude Code agents proper security guidance for Apple platform development.

securitySwiftiOSmacOSKeychainOWASPCryptoKit
by ivan-magda Mar 13, 2026 7/10
skill GitHub

pr-review-skill: AI PR Review Pipeline That Cuts 30-45 Min Reviews to 8 Min

A Claude Code skill that creates a structured AI-powered PR review pipeline. Reduces typical 30-45 minute code reviews to under 8 minutes through a systematic, consistent review process that checks logic, style, security, and potential regressions.

PR reviewskillcode reviewefficiencypipeline
by junyoung2015 Mar 13, 2026 8/10
skill Reddit

B2B SaaS Growth Playbook as a Claude Skill: PMF, PLG, SLG, Channels, Partners

A Claude skill condensing real B2B SaaS growth patterns from companies like HeyGen, Deel, Vercel, and Supabase into a structured operator's handbook. Covers PMF validation, PLG/SLG strategy, affiliate programs, channel partnerships, and scaling metrics — less generic than typical AI growth advice.

B2BSaaSgrowthplaybookskillPMFPLG
by Shadow-Monarch015 Mar 13, 2026 6/10
skill Reddit

solid-audit: Claude Code Plugin to Audit and Fix SOLID Principle Violations

A Claude plugin that audits code for SOLID principle violations and suggests fixes. Supports Python, TypeScript, Java, Go, C#, Kotlin, Ruby, and PHP. Installable directly from the Claude Code marketplace with /plugin commands, then run /solid-audit to get a detailed report.

SOLIDcode qualityauditpluginrefactoring
by muthukrishnan749 Mar 13, 2026 7/10
skill GitHub

semantic-scholar-skills: S2-First Discovery Engine for AI Research Workflows

A Python library, set of Claude Code skills, and MCP server built around Semantic Scholar (S2) as the primary source for AI research discovery. Enables research workflows that search and retrieve academic papers directly from Claude Code.

researchSemantic ScholarMCPskillacademic papers
by zongmin-yu Mar 13, 2026 6/10
skill GitHub

health-skillz: Claude Skill for Personal Health Records via SMART on FHIR

A Claude Skill that connects to and analyzes personal health records using the SMART on FHIR standard. Enables Claude Code to query health data from FHIR-compatible sources, making it useful for health-focused development and personal health analytics.

healthFHIRmedical dataskillSMART
by jmandel Mar 13, 2026 6/10
skill GitHub

.agents: Production-Tested Agents, Skills, Commands, and Rules for AI Coding

A collection of agents, skills, commands, and rules for AI-powered coding tools used daily in production at Weaverse. These are real-world tested configurations that supercharge development productivity across multiple AI coding tools.

agentsskillscommandsrulesproduction
by Weaverse Mar 13, 2026 7/10
skill GitHub

appstore-details: Skill That Auto-Generates App Store Metadata From Xcode Project

A Claude Code skill that reads your Xcode project and generates complete App Store Connect metadata and In-App Purchase details ready to copy and paste. No manual data entry needed — the agent reads the project structure and produces all required fields.

XcodeApp StoreiOSskillmetadata
by DiNerdyYawdie Mar 13, 2026 6/10
skill GitHub

lenny-skills: 86 Essential Product Management Skills From Top Industry Leaders

A collection of 86 product management skills curated from top PM leaders, designed for PMs and founders to enhance their work with Claude's assistance. Covers frameworks, methodologies, and decision-making patterns used by leading product organizations.

product managementPMskillsfoundersframeworks
by TindanLawrence Mar 13, 2026 6/10
skill X

Anthropic Hackathon Winner Claude Code Optimal Settings — Video Breakdown (Japanese)

A Japanese YouTube video ("ゆっくり解説" narrated explainer style) that thoroughly analyzes the Claude Code settings configuration used by an Anthropic hackathon winner. While in Japanese, the settings themselves may be extractable and applicable for English speakers interested in high-performance Claude Code configurations.

settingsconfigurationhackathonbest-practicesCLAUDE.md
by @kenlog_net Mar 13, 2026 5/10
skill Reddit

Family Logistics Skill: Weekly Scheduling for Busy Households

A Claude Code skill built by a healthcare family to solve complex weekly logistics: who's home, who's cooking, who handles childcare and dogs across opposite schedules. An example of using Claude Code skills for personal automation beyond coding—scheduling, constraint solving, and family coordination.

skillautomationpersonalschedulinglogistics
by PerceptionOld8565 Mar 13, 2026 6/10
skill GitHub

claude-code-kit: Starter Templates That Make Claude Code Behave Like a Staff Engineer

Drop-in CLAUDE.md starter templates designed to constrain Claude Code into behaving like a disciplined staff engineer rather than an eager intern. Covers scope management, code ownership, review workflows, and communication style—immediately usable in any project.

claude.mdtemplatesworkflowbest-practicesstarter
by tansuasici Mar 13, 2026 8/10
skill Reddit

Hands-On Claude Skills Course: Build a Skill From Scratch Using Claude API as Evaluator

A 7-module browser-based interactive course that teaches Claude Skills by having you build a meeting-action-extractor skill from scratch. Uniquely uses the Claude API as the evaluation engine—it checks your skill files and gives contextual feedback on your code. A structured curriculum for learning skills development.

skillscourselearningclaude-apitutorial
by ScaryWatercress4560 Mar 13, 2026 7/10
skill Reddit

Simplest Guide to Building and Mastering Claude Skills

A clear guide explaining the three Claude primitives—Projects (knowledge base), Skills (instruction manuals), and MCP (tool connectivity)—and how to build skills from scratch. Explains when to use each, what belongs in a skill vs. a project, and how to structure SKILL.md files effectively.

skillstutorialguidemcpprojects
by HuckleberryEntire699 Mar 13, 2026 7/10
skill GitHub

claude-eureka: Claude Code Skills for ML/AI Researchers

A collection of Claude Code skills tailored for ML and AI researchers: experiment tracking, debugging model training runs, submitting jobs to SLURM clusters, and more. Fills a gap in the ecosystem for researchers who need AI coding assistance integrated with scientific computing workflows.

skillsmachine-learningresearchslurmexperiment-tracking
by Gaaaavin Mar 13, 2026 7/10
skill GitHub

brutal-honest-Skill: Ruthless Automated Code Review for 31+ Frameworks

A Claude Code skill that performs blunt, unfiltered automated code review across 31+ frameworks including game dev support. Features post-mortem verification and anti-AI-slop detection to catch the patterns AI agents commonly introduce. No sugar-coating—designed for developers who want honest feedback.

code-reviewskillanti-slopmulti-framework
by Gakuseei Mar 13, 2026 7/10
skill GitHub

kicad-happy: Claude Code Skills for KiCad Electronics Design

A set of Claude Code skills for KiCad electronics design workflows: analyze schematics, review PCB layouts, download datasheets, source components, and prepare boards for fabrication. Useful for hardware engineers using AI-assisted PCB design.

skillskicadelectronicspcbhardware
by aklofas Mar 13, 2026 6/10
skill Reddit

Claude Skill for Hallucination-Free Islamic Knowledge via Supabase RAG

A Claude Skill that prevents hallucination on Islamic texts by refusing to answer from model memory. Every query triggers a live lookup against a Supabase database of 20,972 authenticated records (Quran verses + Sahih Bukhari + Sahih Muslim hadiths). Demonstrates how skills can enforce strict grounding in external authoritative sources.

skillRAGSupabasehallucinationgrounding
by New_Brush3972 Mar 12, 2026 6/10
skill GitHub

AI Design Engineering Plugins: persona-driven concept-to-production guidance in Claude Code

A set of Claude Code plugins that use AI-driven design engineering personas to guide developers from initial concept through to production deployment. The personas provide structured guidance for building resilient agentic applications with consistent design patterns. Aims to make the full software development lifecycle more systematic when working with Claude Code.

pluginspersonasagenticdesignworkflow
by Yasas9029 Mar 12, 2026 5/10
skill GitHub

aws-agent-skills: AWS automation skills for Claude Code agents

A collection of Claude Code agent skills for AWS automation tasks, providing ready-to-use skill definitions for common AWS operations. Enables AI agents to interact with AWS services directly from a Claude Code session. Useful for teams building AWS-integrated workflows with Claude Code.

AWSskillscloudautomationagent
by itsmostafa Mar 12, 2026 5/10
skill GitHub

claude-code-starter: Beginner meta-documentation framework for vibe-coding with Claude Code

A starter template providing meta-documentation scaffolding for Claude Code projects, designed for beginners entering AI-assisted development. Includes foundational CLAUDE.md patterns and project structure tailored for vibe-coding practice. Good starting point for developers new to working with Claude Code on real projects.

starterCLAUDE.mdbeginnervibe-codingtemplate
by Redemptions7 Mar 12, 2026 5/10
skill Reddit

Shield: open-source Claude Code skill for SAST, secrets scanning, and dependency audit

Shield is a Claude Code skill that orchestrates multiple security scanners from a single /shield:shield command. It auto-detects your stack and runs Semgrep SAST, gitleaks secrets scanning, and npm/pip dependency audits, consolidating results into a unified report with a 0-100 risk score and OWASP/CWE/PCI-DSS compliance mapping. Found 103 secrets and 36 vulnerabilities in the author's own project, including AWS keys and a production .env tracked in git.

securitySASTsecretsvulnerabilityskillopen-sourcesemgrep
by alissonlinneker Mar 12, 2026 9/10
skill GitHub

CLAUDEmd: Multi-AI orchestration via CLAUDE.md with Auggie, Codex, and Gemini

A CLAUDE.md configuration framework that directs Claude to orchestrate context retrieval and analysis across multiple AI models including Auggie, Codex, and Gemini. Demonstrates how CLAUDE.md instructions can delegate specialized subtasks to different models for optimal results. Provides a template for teams wanting to build multi-model AI collaboration into their Claude Code workflow.

CLAUDE.mdmulti-agentorchestrationCodexGemini
by AnnsHarry Mar 12, 2026 5/10
skill GitHub

conclave: Skill That Makes Multiple LLMs Debate and Synthesize a Superior Answer

conclave is a Claude Code skill that pits multiple LLMs against each other: they debate and critique anonymously, then synthesize their best insights into a single, higher-quality answer. Useful for complex decisions where you want perspective beyond a single model's reasoning.

multi-llmdebatesynthesisskillquality
by tommasinigiovanni Mar 12, 2026 7/10
skill Reddit

Superpowers-Optimized Fork: 73% Fewer Tokens With Automatic Routing and Safety Hooks

A research-backed fork of the popular Superpowers plugin that adds automatic task routing, specialist reviewer skills for complex changes, and safety hooks, while maintaining the same workflow. Achieves 73% fewer tokens through smarter routing rather than reduced capabilities. Drop-in replacement.

optimizationtokensroutingsafetyskillsfork
by Double_Seesaw881 Mar 12, 2026 7/10
skill GitHub

xpull: Agent Skill to Pull Tweets and Threads From X Without Login or API Keys

xpull is an agent skill that allows Claude Code to fetch tweets, threads, and articles from X/Twitter without authentication or API keys. Useful for research and content aggregation workflows that need to pull social content programmatically.

xtwitterscrapingskillresearch
by sanjeevneo Mar 12, 2026 7/10
skill Reddit

Jetpack Compose Agent Skill: Up-to-Date Android Compose API Knowledge for Claude Code

A skill that injects current Jetpack Compose API knowledge into Claude Code, addressing the problem of outdated or hallucinated Android UI code. Keeps the agent's Compose knowledge current without relying on training data that may be months behind the latest APIs.

androidjetpack-composekotlinskillup-to-date
by anhvt Mar 12, 2026 6/10
skill Reddit

Startup Idea Validator: Claude Skill That Stress-Tests Ideas Before You Write Code

A Claude skill that runs a structured validation process on startup ideas — identifying customer discovery gaps, competitive landscape, and likely failure modes — before any code is written. The developer says it would have saved them 3 months of building something nobody wanted.

startupvalidationideationskillproduct
by ferdbons Mar 12, 2026 6/10
skill GitHub

LibreOffice-skills: Deterministic Python Skill Suite for LibreOffice Automation

A Python-based skill suite for controlling LibreOffice with AI agents in a deterministic way. Enables Claude Code to create, edit, and manipulate LibreOffice documents, spreadsheets, and presentations with predictable, reproducible outcomes.

libreofficepythonofficeautomationskill
by dfk1352 Mar 12, 2026 6/10
skill X

Three Categories of Claude Skills Worth Building: Documents, Workflows, MCP Enhancement

A practical taxonomy for deciding which Claude skills are worth building: document/asset creation (reports, designs, code), workflow automation (multi-step processes), and MCP enhancement (teaching Claude how to use connected tools well). Helps prioritize skill development efforts.

skillstaxonomyworkflowmcpstrategy
by @gudanglifehack Mar 12, 2026 6/10
skill Reddit

aise: Claude Code Self-Improvement Tool That Learns From Repeated Mistake Patterns

aise tracks mistakes Claude Code makes across sessions and identifies patterns — mistakes that occur repeatedly are extracted and added to CLAUDE.md as prevention rules. Unlike manually updating CLAUDE.md after each incident, aise automates the pattern recognition step and generates targeted, minimal instructions to prevent recurrence.

CLAUDE.mdself-improvementmistakespatternsautomation
by doomdayx Mar 12, 2026 8/10
skill Reddit

Stop Over-Engineering Your CLAUDE.md — Let Claude Build It As You Work

Instead of pre-designing a complex CLAUDE.md structure, this post argues for letting Claude build and evolve it incrementally as you work through real tasks. The author has seen better results from CLAUDE.md files shaped by actual usage patterns than from elaborate up-front structures, and shares the workflow for guiding Claude to maintain it.

CLAUDE.mdworkflowbest-practicesincremental
by PawelHuryn Mar 12, 2026 8/10
skill GitHub

skill-manager: Auto-Detect and Disable Irrelevant Claude Code Skills Per Project

skill-manager analyzes your active project to determine which installed Claude Code skills are relevant and automatically disables the rest for that session. Reduces token overhead from irrelevant skill schemas loading into context and keeps tool selection focused on what the current project actually needs.

skilltoken-savingscontextproject-scopedautomation
by mrdenox109-nyx Mar 12, 2026 8/10
skill Reddit

Open-Source Library of 181 Agent Skills — Seeking Community Feedback on Gaps

A developer maintaining an open-source library of 181 Claude agent skills is asking the community what is missing. The library covers the full development lifecycle and is publicly available for contribution. Good resource for discovering battle-tested skills and for contributing new ones to fill gaps.

skilllibraryopen-sourcecommunitycollection
by nginity Mar 12, 2026 8/10
skill X

SkillsMP: A Marketplace With 200,000+ Agent Skills for Claude Code

SkillsMP is described as an App Store for AI agent skills — a marketplace of over 200,000 skills designed for Claude Code that extend what the agent can do beyond text and code generation. Skills cover integrations, workflows, domain expertise, and tooling. The most downloaded skill is a notification hook for task completion.

marketplaceskillscommunityextensions
by @Suryanshti777 Mar 12, 2026 8/10
skill Reddit

CC v2.1.74: New System Prompts Add +1750 Tokens — Title Generator, /stuck Skill, Memory Selection

Claude Code v2.1.74 shipped notable system prompt additions including a session title generator, a /stuck skill to diagnose frozen sessions, and an improved memory selection agent prompt. The changelog post breaks down each new prompt with the full text, useful for understanding how Claude Code uses its own built-in skills.

changelogsystem-promptskillsmemorystuck
by Dramatic_Squash_3502 Mar 12, 2026 8/10
skill Reddit

SKILL.md Linter That Catches Silent Cross-Agent Validation Failures

Skills that loaded fine in Claude Code silently failed in VS Code because the name field did not match the parent directory — a rule Claude Code does not enforce but VS Code does. This linter catches that class of cross-agent inconsistency and other SKILL.md structural issues before they cause hard-to-debug failures.

skilllintervalidationSKILL.mdcross-agent
by BradKinnard Mar 12, 2026 8/10
skill GitHub

antigravity-awesome-skills: 1000+ Agentic Skills for Claude Code, Cursor, and Antigravity

A curated collection of over 1000 battle-tested SKILL.md files for Claude Code, Antigravity, and Cursor — including official skills from Anthropic and Vercel. Covers the full development lifecycle from planning and coding to deployment, testing, and specialised domains.

skillcollectionanthropicvercelantigravitycursor
by sickn33 Mar 12, 2026 9/10
skill GitHub

Structured Prompt Engineering Skill With 300+ Curated Examples

Structured prompt engineering library and Claude Code skill featuring 300+ curated examples for writing effective AI prompts. Helps produce high-quality, precise prompts for Claude Code agents and downstream tasks.

prompt engineeringexampleslibrarytemplatesskill
by Marwane83930 Mar 12, 2026 6/10
skill GitHub

Meridian: Zero-Config Tasks, Memory, and Rules for Claude Code

Zero-config setup for Claude Code that provides tasks, memory, and rules for predictable interactions without changes to your chat config. Designed to work out of the box without any configuration required.

tasksmemoryruleszero-configsetup
by adamwac2515 Mar 12, 2026 7/10
skill Reddit

PlanKit: Lightweight In-Repo Planning Plugin for Claude Code

Claude Code plugin for in-repo project planning with four levels: Ideas, Roadmap, Steps, and Done. Each project gets its own planning folder committed to git. Claude reads your ideas, investigates the codebase, and asks targeted questions before proposing anything — no external tools or subscriptions.

planningproject managementpluginindie dev
by Jeehut Mar 12, 2026 7/10
skill X

Claude Code Agent Skills Internals: Setup, Folder Structure, and Demos

A detailed study session article explaining Claude Code Agent Skills: the overview and folder structure for customizing Claude Code behavior, setup walkthroughs, usage tips, and hands-on demo content. Good reference for teams learning to build custom Skills.

skillsagent-skillstutorialfolder-structureextension
by @topickapp_com Mar 11, 2026 5/10
skill Reddit

/discuss: Read-Only Discussion Mode Skill for Claude Code

A 25-line custom skill that puts Claude Code into a hands-off conversation mode—reads files, searches code, and does web lookups, but blocks all file modifications. Ideal for architecture discussions, codebase exploration, and thinking out loud without triggering unwanted edits.

skillslash-commandread-onlydiscussionexploration
by After_Book_7030 Mar 11, 2026 8/10
skill GitHub

claude-powers: 3-Layer Memory Architecture + Skills + Hooks + MCP for Claude Code

An OpenClaw + Claude Code superpowers system implementing three-tier persistent memory alongside Skills, Hooks, and MCP integration. Addresses context loss between sessions by building long-term memory that persists across conversations.

memoryhooksmcpskillspersistencecross-session
by TheSoulGiver Mar 11, 2026 8/10
skill GitHub

strangler_fig_newton: Claude Code Plugin for Migrating Monoliths to Microservices

Claude Code plugin that automates the Strangler Fig pattern for systematically migrating legacy monolithic codebases to microservices. Inspired by Martin Fowler's methodology and Obra Superpowers for incremental, low-risk extraction.

refactoringmicroservicesmigrationpluginarchitecture
by mhosner Mar 11, 2026 7/10
skill GitHub

smart-ralph: Spec-Driven Development with Smart Compaction for Claude Code

Claude Code plugin combining the Ralph Wiggum specification loop with structured spec-driven development and smart context compaction. Keeps agent sessions focused and grounded with persistent specification files that survive context resets.

spec-drivencompactionpluginralphworkflow
by tzachbon Mar 11, 2026 7/10
skill Reddit

Model Bake-Off: Haiku vs Sonnet vs Opus Performance on Claude Code Skills

Benchmark evaluation comparing Claude Haiku, Sonnet, and Opus on skill execution in Claude Code. Notable finding: Haiku performs surprisingly well with well-written skill content, narrowing the gap with larger models. Methodology and results posted on tessl.io.

haikusonnetopusbenchmarkskillsevaluation
by sjmaple Mar 11, 2026 7/10
skill GitHub

agent-skills: Official PowerSync Agent Skills for Claude Code

Official collection of Claude Code agent skills from the PowerSync team. Provides ready-to-use skills for integrating PowerSync real-time sync capabilities, database operations, and offline-first patterns into Claude Code workflows.

powersyncsyncdatabaseskillsofficial
by powersync-ja Mar 11, 2026 6/10
skill Reddit

Turbo: 28 Modular Skills for Automated Testing, Review, and Self-Improvement

Skill set that automates the full cycle after implementation: write missing tests, run multi-agent code simplification, trigger Codex peer review, commit with clean messages, and create/update PRs. The /self-improve skill routes lessons from conversation corrections into CLAUDE.md or memory files so Claude improves per-project over time.

skillstestingreviewself-improvingcommitprautomation
by Caibot Mar 11, 2026 8/10
skill Reddit

Agensi: Marketplace for SKILL.md Files with Security Scanning

Marketplace for buying and selling Claude Code SKILL.md files. Skills go through automated security scans (dangerous commands, secret detection, prompt injection). Creators keep 80% of revenue. After two weeks: 300-500 daily visitors, 100 users, 12 skills, 98 downloads.

marketplaceskillssecurityskill.mdcommunitymonetization
by BadMenFinance Mar 11, 2026 7/10
skill Reddit

Superpowers Brainstorming Skill Now Spins Up Interactive UI Mockup Web Server

Discovery that the Superpowers brainstorming skill now serves live UI mockup options via a local web server, letting you click to select a design before returning to the terminal. Invoked via /brainstorming or /superpowers:brainstorming.

superpowersbrainstorminguimockupskillinteractive
by oddslol Mar 11, 2026 5/10
skill GitHub

tikhub_api_skill: Call TikHub APIs Across 12+ Social Media Platforms

Claude Code agent skill that discovers and calls TikHub API endpoints across 12+ social media platforms (TikTok, Instagram, YouTube, etc.). Lets agents fetch content, metadata, and analytics from social platforms during coding sessions.

tiktoksocial-mediaapiskilltikhub
by tiendatne2004 Mar 11, 2026 5/10
skill GitHub

ai-agents-skills: Collection of Coding Assistance Skills for AI Agents

Curated collection of Claude Code skills for improved coding assistance, covering production-ready code generation, debugging patterns, and review workflows. Designed for efficient, high-quality agent outputs.

skillscodingcollectionproductivity
by Makiya1202 Mar 11, 2026 5/10
skill GitHub

agent-skills-cli: Install from 50,000+ Agent Skills with One Command

CLI tool for discovering and installing agent skills for Claude Code from a registry of 50,000+ skills. Single-command skill search and installation streamlines onboarding new capabilities into your workflow.

cliskillsregistryinstalldiscovery
by stbarbe Mar 11, 2026 7/10
skill GitHub

claude-react-kit: Claude Code Config to Enforce Clean Architecture in React

Drop-in Claude Code configuration for React projects that enforces clean architecture patterns and prevents technical debt accumulation. Manages context budgets and import conventions to keep large React codebases navigable for agents.

reactarchitectureclaude.mdconfigtechnical-debt
by wahmoh Mar 11, 2026 6/10
skill GitHub

creative-director-skill: Generate and Score Advertising Concepts with AI

Claude Code skill that generates advertising concepts, scores them against industry-standard creative director criteria, and iterates using proven creative methodologies. Useful for marketing teams using Claude Code to ideate campaigns.

marketingadvertisingcreativeskillideation
by eiwru Mar 11, 2026 5/10
skill GitHub

PapersFlow Research Skills: Literature Search and Citation Graphs via MCP

Reusable Claude Code skills for academic research workflows — literature search, citation graph exploration, and DeepScan monitoring, all powered by the papersflow-mcp server. Combines the Claude Code skills system with MCP for a domain-specific research assistant pipeline.

skillmcpresearchacademicliterature
by papersflow-ai Mar 11, 2026 6/10
skill X

Organizing ~/.claude/ for Skills, Sub-Agents, and Shared Scripts

A developer shares their ~/.claude/ directory structure for managing Claude Code skills, custom slash commands, and shared shell scripts. The layout separates scripts/ (executable by agents), commands/ (slash commands), and CLAUDE.md (global config) for a clean, maintainable setup.

skillsub-agentorganizationCLAUDE.mdscriptsconfig
by @sho_tewodou Mar 11, 2026 7/10
skill GitHub

golang-skills: Modular AI-Driven Go Lessons as Claude Code Skills

A collection of Claude Code skills for Go programming, covering best practices, code reviews, concurrency patterns, and data structures. Each lesson is modular and AI-driven, making it easy to apply specific Go knowledge directly in your coding sessions.

golangskillscode-reviewconcurrencylearning
by dwana1 Mar 11, 2026 5/10
skill X

Complete Guide to Claude Code Skills: Foundations, Architecture, Testing, and Production

A single article covering the full lifecycle of building Claude Code skills — from foundational concepts and architectural patterns to testing strategies and production deployment. Aims to give developers everything needed to build skills that automate workflows and boost productivity.

skillsguidearchitecturetestingproduction
by @hooeem Mar 11, 2026 7/10
skill GitHub

financial-analyzer-lite: Free Stock Analysis Skill for Claude via yfinance

A Claude skill that pulls live stock data using yfinance and produces structured valuation and financial health analysis for any ticker. No paid API keys required — just install the skill and ask Claude to analyze a stock. Good starting point for custom financial research workflows.

skillfinancestocksyfinanceanalysisdata
by apex-stack-ai Mar 11, 2026 5/10
skill GitHub

shirman-digest: Automated AI & Tech Trends Digest Skill for Claude Code

A Claude Code skill that automates fetching and summarizing AI and tech news from shir-man.com into a structured digest. Useful as a template for building your own automated content aggregation skills within Claude Code workflows.

skilldigestautomationnewsai-trendscontent
by jojoprison Mar 11, 2026 5/10
skill GitHub

pseo-auditor-lite: Free Programmatic SEO Audit Skill for Claude

A Claude skill that audits programmatic SEO implementations — analyzing page templates, crawl budget allocation, and indexing health. Useful for developers and SEO practitioners who want AI-assisted analysis of large-scale content sites without manual tooling setup.

skillseoauditprogrammatic-seoweb
by apex-stack-ai Mar 11, 2026 5/10
skill Reddit

How do you find value with the Max subscription fees?

Genuine question as someone who has recently moved over from ChatGPT and never really saw the need to pay $200/month for it. Loving Claude so far and skills/Cowork has been a revelation for me give...

skill
by AnusMcBumhole Mar 11, 2026 6/10
skill Reddit

Repeatative tasks in co-work

What’s the best way to perform repetitive tasks in co-work? I have list of few accounts, that co-work researches following guides from the skills. But as expected after 4-5 accounts, the quality dr...

skillapi
by Visible_Resource9503 Mar 11, 2026 6/10
skill Reddit

Claude getting sloppy as I do more work. Anyone else?

I am an average excel user with little coding experience. I switched to Claude because I read so much about how it was better at coding than ChatGPT. At first it was great. It walked me through Pow...

skill
by Odd_Bad5188 Mar 11, 2026 6/10
skill Reddit

Implement a Skill if the design is already as per my liking?

I've been building my first mobile app via Claude(demo app to understand CC). Today the weekly limit would be reset. I wanna know if I need to implement a skill or not. At the beginning, I asked it...

skill
by Working_Question4361 Mar 11, 2026 7/10
skill Reddit

When do you create Agents vs Skills?

I’ve mainly created skills and not agents and I haven’t come across a concrete difference that makes it worthwhile to launch the other because I’ve found subagents go off the rails and do the wrong...

skill
by doomdayx Mar 11, 2026 6/10
skill Reddit

How to let Claude Code watch youtube video

I heard supposedly Gemini is the only AI that can watch youtube video right now, is that still the case, and if so is there claude code skill to enable that or do I simply load the Gemini model or ...

skillworkflow
by maraluke Mar 11, 2026 8/10
skill Reddit

Did CC lose all it's memory today?

Been dealing with this over multiple sessions today, but it doesn't seem like sessions start with the correct context? like claude.md skills.md etc. arent' loading into context and it just forms a ...

skillclaude.md
by monkey_spunk_ Mar 11, 2026 8/10
skill Reddit

Skill.md Git repositories or Gist to share?

Our friendly friend Claude suggested me to share my Shipping label printer skill for cropping down labels and printing them, just by telling that you added folders to a file that have shipping labe...

skillgit
by SunofaBaker Mar 11, 2026 6/10
skill Reddit

Projects / Cowork / Code

I feel unsure about which Claude module to use for my daily work working in finance. I find myself wanting and trying to build README files for agents that I want to use for my daily, weekly, month...

skill
by AIfinance123 Mar 11, 2026 7/10
skill Reddit

Improved version of systematic-debugging skill

Spent some time developing an improved version of the systematic-debugging skill for claude code. Might be helpful for some! https://github.com/pytholic/claude-skills/tree/main/systematic-debugging...

skillgittesting
by rajahaseeb147 Mar 11, 2026 9/10
skill Reddit

Whats your claude code "setup"?

How do you use your Claude Code? WHY you think your way is the best? Do you use it only in the terminal? Do you use it together with an IDE? If you have an IDE, which and why, and does it matter? D...

skill
by AerieAcrobatic1248 Mar 11, 2026 10/10
skill Reddit

Good PR review prompt?

Hey, can anyone share a working prompt for a PR review? I want to create a skill that receives a branch name and reviews it according to specific steps. The problem I’m seeing is that the agent som...

skillreview
by NO2UT Mar 11, 2026 6/10
skill GitHub

x402-payments-skill: Build Paid APIs on Base & Solana With USDC

The most comprehensive x402 payments skill for AI coding agents, enabling Claude Code to build paid APIs on Base and Solana with USDC. Includes a Sentinel Payment Router for agent-to-agent commerce. Targets the emerging agentic commerce ecosystem.

skillpaymentsx402cryptoagentic-commercesolana
by valeo-cash Mar 11, 2026 6/10
skill Reddit

8 Claude Code Plugins for Agentic Commerce (UCP, ACP, Stripe, x402)

A suite of 8 Claude Code plugins covering agentic web protocols: UCP (REST/A2A), ACP (Stripe delegated payments), AP2 (crypto signing), and A2A (agent task delegation). Acts as an expert co-developer for building agents that shop, pay, and negotiate autonomously.

pluginspaymentsagentic-commerceprotocolsa2a
by NoAide1608 Mar 11, 2026 7/10
skill GitHub

claude-skill-prompt-architect: Transform Vague Prompts Using 7 Frameworks

A Claude Code skill that rewrites vague prompts into structured, expert-level prompts using 7 research-backed frameworks: CO-STAR, RISEN, RISE, TIDD-EC, RTF, Chain of Thought, and Chain of Density. Helps get consistently better results from Claude by improving prompt structure automatically.

skillprompt-engineeringco-starrisenframeworks
by ckelsoe Mar 11, 2026 7/10
skill GitHub

dagster-io/skills: Official AI Skills for Working With Dagster

Official AI skills from the Dagster team for working with their data orchestration platform. Provides Claude Code with deep knowledge of Dagster patterns, assets, jobs, and best practices. Useful for data engineers who use both Dagster and Claude Code.

skilldagsterdata-engineeringorchestrationofficial
by dagster-io Mar 11, 2026 6/10
skill GitHub

Anthropic-Cybersecurity-Skills: 611+ Security Skills for AI Agents

A comprehensive collection of 611+ cybersecurity skills following the agentskills.io open standard, compatible with Claude Code, GitHub Copilot, Codex CLI, Cursor, and Gemini CLI. Covers vulnerability assessment, secure coding patterns, and threat modeling for AI-assisted security work.

skillsecuritycybersecurityvulnerabilityagentskills
by mukul975 Mar 11, 2026 7/10
skill GitHub

tech-leads-club/agent-skills: Secure, Validated Skill Registry for AI Agents

A security-focused, validated skill registry for professional AI coding agents. Skills are vetted before inclusion, making it safer to adopt community skills. Extends Claude Code, Cursor, Copilot, and Antigravity with confidence in what you're running.

skillregistrysecurityvalidatedprofessional
by tech-leads-club Mar 11, 2026 7/10
skill GitHub

NASA PDS Claude Code Skills: Automated Release Notes and Status Reports

Official Claude Code skills from NASA's Planetary Data System (PDS) team for automating release notes, program status reports, and other NASA PDS-specific workflows. An interesting example of a major scientific organization adopting Claude Code skills for technical automation.

skillnasaautomationrelease-notesscientific
by NASA-PDS Mar 11, 2026 6/10
skill GitHub

Research Pipeline Skills: Semantic Execution Units with Evidence-First Methodology

Skills that structure research pipelines as semantic execution units — each declares inputs, outputs, acceptance criteria, and guardrails. Prevents hollow AI writing through structured intermediate artifacts and an evidence-first approach.

researchpipelineevidencestructuredwriting
by WILLOSCAR Mar 10, 2026 6/10
skill GitHub

Personal Plugin Marketplace Config for Claude Code (bendrucker)

A personal collection of Claude Code plugins and global settings curated by a developer. Useful as a reference for structuring your own plugin registry and discovering community-tested Claude Code configurations.

pluginsconfigmarketplacesettingsreference
by bendrucker Mar 10, 2026 5/10
skill GitHub

claude-config: Sync Claude Code Global Settings Across Machines

A tool to sync and manage Claude Code global and home-level settings across multiple machines. Useful for developers working on several computers who want consistent Claude Code configurations everywhere.

configsyncsettingsmulti-machinedotfiles
by WoojinAhn Mar 10, 2026 6/10
skill GitHub

B2B SaaS Marketing Skills for Claude Code and Cursor Agents

A collection of B2B SaaS marketing skills compatible with SKILL.md format, usable in Claude Code, Cursor, and other AI agents. Covers marketing workflows that non-developers can run directly from the terminal.

marketingb2bsaasskillscursor
by Stallin-Sanamandra Mar 10, 2026 5/10
skill Reddit

uberSKILLS: Open-Source IDE for Creating, Testing, and Deploying Claude Skills

A web-based IDE specifically for building SKILL.md files. Features AI-assisted creation from natural language, a structured editor with real-time validation, multi-model testing via OpenRouter, one-click deployment to Claude Code, version history, and bulk import/export. Start with a single npx command, no Docker needed.

skillsidetestingdeploymentopen-sourceskill.md
by felltrifortence Mar 10, 2026 9/10
skill Reddit

claude-skills-founder: 12 Startup Strategy Skills for Claude Code

A skills pack for startup founders — not developers. Includes /validate-idea, /competitor-matrix, /mvp-scope, /pricing-strategy, /go-to-market, /pitch-deck, /fundraise-prep, and more. Drop the commands/ folder into .claude/commands/founder/ and run from your terminal. MIT licensed.

skillsstartupfounderstrategyproductpitch
by akorecebov Mar 10, 2026 8/10
skill Reddit

skillfile: Declarative Package Manager for AI Skills and Subagents

A CLI that reads a single config file and handles fetching, locking, and deploying skills and agents — like Brewfile or package.json, but for AI tool definitions. Supports local customizations via patch files that survive upstream updates. Install with cargo install skillfile.

skillspackage-managerdeclarativeagentsrustlocking
by julennnnn Mar 10, 2026 8/10
skill Reddit

70+ Claude Code Skills for the Full Product Manager Workflow

A comprehensive PM skill library built by a 20-year PM: /prd-generator, /user-interview-analyzer, /competitive-profile-builder, /roadmap-builder, /weekly-metrics, /win-loss-analysis, /experiment-designer, and 60+ more. Covers go-to-market, pricing, OKRs, stakeholder updates, and decision frameworks. Browse free at mysecond.ai/skills.

skillsproduct-managerworkflowprdroadmapokr
by Which-Objective2553 Mar 10, 2026 8/10
skill GitHub

auto-skill: Self-Evolving Memory System that Captures and Reuses Agent Knowledge

Automatically captures, indexes, and reuses knowledge from AI agent interactions to build a self-evolving, memory-driven assistant system. Skills improve over time as the agent learns from past work rather than starting fresh each session.

memoryknowledgeself-evolvingindexingagentlearning
by Chocoberry1108 Mar 10, 2026 6/10
skill GitHub

InfraNodus Skills: Augment LLM Thinking with Knowledge Graph Insights

Skills integrated with InfraNodus, a knowledge graph visualization tool, to augment the LLM thinking process. Adds structural reasoning and graph-based insight generation on top of standard language model capabilities.

skillsknowledge-graphthinkingreasoninginfranodus
by infranodus Mar 10, 2026 5/10
skill X

Plug-and-play CLAUDE.md template from Claude Code creator Boris Cherny's workflow

A ready-to-use CLAUDE.md template derived from Anthropic's internal workflow as shared by Boris Cherny, the creator of Claude Code. Dropping this file in a repo reportedly makes Claude Code significantly more effective. An excellent starting point for anyone wanting to configure Claude Code using proven best practices.

claude-mdconfigurationbest-practicesboris-chernyanthropicworkflow
by @DAIEvolutionHub Mar 10, 2026 9/10
skill X

Smart contract audit workflow: /solidity-auditor skill + Claude Code Foundry PoC generation

A security audit workflow combining a custom /solidity-auditor slash command with Claude Code to triage findings and auto-generate Foundry mainnet fork proof-of-concept tests. Claude Code handles building the test files and run commands, reducing repetitive grunt work for Solidity developers.

soliditysecurityauditfoundrysmart-contractscustom-command
by @Harvesto12 Mar 10, 2026 6/10
skill Reddit

PromptVault: CLI to sync CLAUDE.md / AGENTS.md across projects

Proposes PromptVault, a CLI tool to version and synchronize AI agent configuration files (CLAUDE.md, AGENTS.md, .cursorrules) across projects. Solves duplicated and conflicting instructions between tools. Seeking community validation before building as open-source.

CLAUDE.mdpromptsconfigCLIproject-management
by DaherSystemsAndIA Mar 10, 2026 7/10
skill GitHub

Claude Code Skill: PDF-to-Markdown Extraction and Paper Reproduction

A Claude Code skill for full-fidelity PDF-to-Markdown conversion, Python-based reproduction of research paper experiments, and bilingual README generation with embedded figures. Designed for academic and ML research workflows where reproducing paper results is a common task.

skillpdfmarkdownresearchpythonacademic
by celynnmoonlight Mar 10, 2026 6/10
skill GitHub

Agent Skills for Context Engineering in AI Agents

A set of skills designed to help AI agents manage and optimize context window usage. Covers techniques for efficient information handling, context prioritization, and performance optimization. Intended to enhance agent systems that rely on skill-based context injection.

skillcontext-engineeringagentoptimization
by Kalyanikhandare29 Mar 10, 2026 5/10
skill GitHub

GTM Engineering Skills for Claude Code (Powered by Deepline)

A collection of Claude Code skills for go-to-market engineering tasks: B2B prospecting, lead enrichment, signal discovery, and lead generation powered by Deepline. Useful for sales and marketing teams automating outbound workflows with Claude Code.

skillgtmsalesprospectinglead-generationdeepline
by getaero-io Mar 10, 2026 6/10
skill GitHub

codeworth: Estimate the Real Cost to Rebuild Any Codebase From Scratch

A Claude Code skill that estimates codebase rebuild cost across 5 dimensions: domain knowledge, infrastructure coupling, data model depth, integration surface, and operational maturity. Goes beyond lines-of-code to capture true complexity.

skillestimationcodebasecomplexityanalysis
by teterouge Mar 10, 2026 7/10
skill GitHub

email-triage: Gmail Inbox Triage Agent Skill

A Claude agent skill that scans your Gmail inbox, classifies every message using your own rules, applies Gmail labels, and archives suspected junk. A complete autonomous email management workflow requiring only rule configuration.

skillgmailemailautomationtriage
by sskaye Mar 10, 2026 7/10
skill Reddit

Google Ads Bulk Upload Skill That Fixes Silent CSV Failures

A 730-line instruction file that eliminates Google Ads Editor import failures. Seven modules cover exact column headers per row type, encoding rules (em dashes and smart quotes that silently corrupt CSVs), policy compliance, and ad format validation. Eliminates the 'Ambiguous row type' import error.

skillgoogle-adscsvautomationmarketing
by fakereal-realfake Mar 10, 2026 6/10
skill GitHub

awesome-agent-skills: 500+ Agent Skills From Official Dev Teams

A curated collection of 500+ agent skills from official development teams and the community, compatible with Claude Code, Codex, AntiGravity, Gemini CLI, and Cursor. Central resource for the growing skills ecosystem.

skillcollectioncommunitycurated
by VoltAgent Mar 10, 2026 7/10
skill GitHub

claude-code-workflow: BDD/TDD Skill and Code Review Hooks

A Claude Code development workflow template featuring a BDD/TDD skill and code review hooks for autonomous feature development. Enforces test-first practices and automated code quality gates.

skillhooktddbddcode-reviewworkflow
by zxkane Mar 10, 2026 7/10
skill Reddit

YouTube Video to Markdown Notes Skill

A Claude skill that takes a YouTube video URL and outputs a structured Markdown note with title, channel, description, chapters, transcript, and YAML frontmatter. One command, no API keys needed.

skillyoutubemarkdownnotestranscription
by JimmySadek Mar 10, 2026 7/10
skill GitHub

academic-research-skills: Full Research Workflow for Claude Code

A skill collection covering the full academic research pipeline: research, write, review, revise, and finalize. Enables Claude Code to handle complete research document workflows autonomously.

skillresearchacademicwritingworkflow
by Imbad0202 Mar 10, 2026 6/10
skill Reddit

master-plan: ADHD-Friendly Task System Built Into Your Terminal

A Claude Code plugin with four commands designed for non-linear thinkers: /task for quick brain dumps, /next for priority-scored task picking with in-progress highlighting, /save for WIP commits, and /done for test-run-commit. Built on markdown and git, zero infrastructure.

skilltask-managementproductivitygitadhd
by Endlesssky27 Mar 10, 2026 7/10
skill Reddit

Screenshot Websites Without Opening a Browser — Claude Skill

A Claude skill using the Zyte API to take screenshots and extract content from websites without launching a browser. Handles bot detection, bans, and CAPTCHAs transparently.

skillscreenshotweb-scrapingzyteheadless
by cli_ninja Mar 10, 2026 7/10
skill Reddit

Multi-Wave Competitive Intelligence Skill With Parallel Agents

A structured competitive analysis skill running three sequential waves with parallel agents: competitor profiling and pricing intelligence, customer sentiment mining from review platforms and communities, and strategic synthesis. Extracts real signal — pricing psychology, G2 complaints, hiring signals — not just company names.

skillcompetitive-analysismulti-agentresearchbusiness
by ferdbons Mar 10, 2026 8/10
skill Reddit

AI Security Guide: 16 Prompt Injection Techniques + Testing Skill

A defense-in-depth guide for public AI chatbots covering input sanitization, rate limiting, zero-trust system prompt design, output controls, and cost caps. Includes a Claude Code skill that automatically tests all 16 prompt injection techniques against your chatbot.

skillsecurityprompt-injectiontestingdefense
by renatoworks Mar 10, 2026 7/10
skill GitHub

claude-skills: 7 Professional Toolkits for Claude Code

A complete Claude Code skill collection with seven professional toolkits covering project management, design, documents, analytics, knowledge management, repository operations, and multi-AI coordination.

skillcollectionprofessionalpmdesignanalytics
by LeoLin990405 Mar 10, 2026 7/10
skill GitHub

e2e-test-skills: Find 13 Anti-Patterns in E2E Tests

A Claude Code skill that detects error swallowing, boolean traps, always-passing assertions, and 10 other E2E test anti-patterns. Helps identify flaky or misleading tests that pass but provide no real coverage.

skilltestinge2eanti-patternsquality
by dididy Mar 10, 2026 8/10
skill GitHub

hypr-video-cli: Natural Language to MP4 Videos From Your Terminal

A Claude Code skill that renders MP4 videos from natural language descriptions using npx. Supports animations, transitions, captions, and 50+ effects entirely from the terminal.

skillvideomedia-generationclianimations
by superyhee Mar 10, 2026 7/10
skill GitHub

claude-wizard: 8-Phase Dev Skill With TDD and Adversarial Review

A Claude Code skill that turns the agent into a senior software architect through an 8-phase development cycle including TDD, adversarial code review, and quality gate checks before proceeding to the next phase.

skilltddcode-reviewquality-gatesarchitecture
by vlad-ko Mar 10, 2026 7/10
skill GitHub

Vskill — Secure Multi-Platform AI Skill Installer with Pre-Install Scanning

A skill installer that scans skills for security issues before installing them, covering 49 agents, 12 plugins, and 41 expert skills across multiple AI platforms. Addresses the trust problem of installing third-party skills without knowing what they do.

skillssecurityinstallerscanningtrustmulti-platform
Mar 10, 2026 8/10
skill GitHub

NOX — 33 Skills + 8 Agents + 19 Hooks for Claude Code, Gemini CLI, and Codex CLI

A single-install skill/agent/hook pack that works across Claude Code, Gemini CLI, and Codex CLI with zero configuration. Includes 33 skills, 8 agents, and 19 hooks — one of the most complete cross-platform AI coding skill packs available.

skillshooksagentsgemini-clicodex-clicross-platformzero-config
Mar 10, 2026 9/10
skill GitHub

Claude Code Skillforge — Generate, Upgrade, and Scan Skills with Live Best Practices Sync

A meta-skill that builds, upgrades, and scans other Claude Code and Antigravity SKILL.md files. Features live best-practices sync, marketplace search, skill upgrader, skill scanner, and self-validation. Essentially a skill management system that keeps your skills current automatically.

skillsskill-managementskill-mdbest-practicesself-improvingmarketplace
Mar 10, 2026 9/10
skill Reddit

Claude Code 2.1.72 System Prompt Changes — Auto Mode, Brief Mode, Worktree Tools

A detailed breakdown of +1,643 token changes in Claude Code 2.1.72 system prompts: new Auto mode (continuous background execution), Brief mode (Codex-like short status updates), ExitWorktree tool, and a second ToolSearch description. Several consolidated and removed guidance sections as well.

system-promptauto-modebrief-modeworktreechangelogtoolsearch
Mar 10, 2026 8/10
skill GitHub

UnseveredMemory — Markdown-Based Context Persistence for Claude Code Sessions

A memory retention system for Claude Code that uses structured markdown files to persist context across sessions. Ensures that knowledge from past sessions survives compaction and new session starts without relying on external databases.

memorycontext-persistencemarkdownsessionscontinuity
Mar 10, 2026 8/10
skill GitHub

Claude Code Best Practices — Community-Driven Reference Site

A Next.js + Fumadocs site aggregating community best practices for Claude Code. Covers document structures, MDX content, and navigable routes for scalable documentation.

best-practicesdocumentationreferencecommunity
Mar 10, 2026 6/10
skill Reddit

Configuring CLAUDE.md to Explain Code While Vibe Coding

Community question on how to tune your global CLAUDE.md so Claude explains its reasoning and code in accessible terms as it builds. Useful starting point for learners who want to ship real apps while building their coding knowledge alongside Claude.

claude.mdlearningvibe-codingbeginnerexplanations
by /u/Wheels859 Mar 10, 2026 6/10
skill GitHub

Code Sensei: Learn Programming While Vibe-Coding with Claude Code

A free, open-source Claude Code plugin that teaches programming as you work. Provides contextual explanations, micro-quizzes, and a belt progression system to gamify learning. Unique in targeting developers who want to understand what Claude Code is doing, not just let it run.

educationlearningpluginclaude-codegamificationquizzesopen-source
by DojoCodingLabs Mar 10, 2026 7/10
skill GitHub

Eden Skills: Fast, Deterministic Skills Manager for Claude Code and AI Agents

A skills manager for AI agents — Claude Code, Cursor, Codex, and more — focused on deterministic behavior and speed. Manages and organizes agent skills so they can be reliably discovered and invoked. Addresses the growing need for structured skill registries as agent skill ecosystems mature.

skills-manageragent-skillsclaude-codecursorcodexdeterministic
by AI-Eden Mar 10, 2026 7/10
skill GitHub

Bitrefill Agent Skills: Buy Gift Cards and eSIMs from Claude Code

Agent skills for Bitrefill that let AI coding agents browse, buy, and manage gift cards, mobile top-ups, and eSIMs. Compliant with the Agent Skills spec and works with Claude Code, Cursor, and npx skills. A concrete example of real-world commerce actions exposed as agent skills.

agent-skillsbitrefille-commercegift-cardsclaude-codecursor
by bitrefill Mar 10, 2026 5/10
skill GitHub

AI.MD: Convert CLAUDE.md to AI-Native Structured-Label Format

A tool that converts human-written CLAUDE.md files into an AI-native structured-label format, achieving the same rules with fewer tokens and higher model compliance. Battle-tested across 5 rounds and 4 models. A practical upgrade for anyone optimizing their CLAUDE.md for efficiency.

CLAUDE.mdtoken-optimizationstructured-formatconfigurationcompliance
by sstklen Mar 10, 2026 8/10
skill GitHub

Production-Ready Python Template for Claude Code with TDD and Multi-Agent Setup

A Python project template built for Claude Code with a TDD workflow baked in, 7 custom agents, and an 11-step Phase Completion Checklist. Provides a structured, opinionated starting point for Python projects that leverages Claude Code from day one. Good reference for teams establishing Claude Code conventions.

templatepythontddmulti-agentCLAUDE.mdworkflow
by stranma Mar 10, 2026 7/10
skill GitHub

SkillCheck-Free: Validate Claude Code skills against agentskills spec

Tool for validating Claude Code skills against the agentskills specification. Helps ensure your SKILL.md files are correctly structured and compliant with emerging standards for AI agent skills.

skillvalidationagentskillsspecSKILL.md
by olgasafonova Mar 9, 2026 5/10
skill GitHub

obsidian-skill: Manage Obsidian vaults with CLI tools via Claude Code

Claude Code skill providing CLI tools for managing Obsidian vaults — notes, tasks, tags, templates, and knowledge graph analysis. Bridges the gap between Obsidian knowledge management and AI-assisted development.

skillobsidianknowledge-managementnotescli
by wizzy15 Mar 9, 2026 6/10
skill GitHub

66 Claude AI skills and 9 workflows for full-stack developers

Comprehensive collection of 66 Claude AI skills and 9 workflows designed to enhance productivity for full-stack developers. Covers a wide range of development scenarios from frontend to backend and deployment.

skillfull-stackworkflowcollectionproductivity
by zacklecon Mar 9, 2026 6/10
skill Reddit

OpenAlgernon: Claude Code-native terminal study platform with FSRS spaced repetition

Study platform that installs as a Claude Code slash command and runs entirely in the terminal. Uses FSRS-4.5 for spaced repetition scheduling with Claude as the study engine. Designed for engineers with backlogs of papers, RAG handbooks, and agent playbooks to study.

skillspaced-repetitionlearningterminalslash-commandFSRS
by AntonioVFranco Mar 9, 2026 7/10
skill GitHub

Claude plans, Gemini implements: dual-agent manager skill

A Claude Code skill that orchestrates a two-agent system where Claude handles planning and verification while Gemini CLI executes the actual code implementation. Leverages strengths of both models in a structured divide-and-conquer workflow.

skillgeminiorchestrationplanningmulti-agent
by MikoChun Mar 9, 2026 7/10
skill Reddit

HELIX v2.0: Self-evolving Claude Code skill with MCP and context compression

Claude Code skill that evolves itself after every run by learning your coding style. Features native MCP for real API connections, context compression to fight context rot, 60% cost reduction via prompt caching, and agentic self-healing for broken code. Works on Claude Code and Gemini CLI.

skillself-evolvingmcpcontext-compressionprompt-cachingself-healing
by Caramaschi Mar 9, 2026 8/10
skill X

Curated Claude Code ecosystem list: CLAUDE.md templates, MCP directory, hook recipes, and more

A community-built index of Claude Code ecosystem resources: language-specific CLAUDE.md templates (TypeScript, Python, Next.js, homelab), an MCP server directory, hook recipes, CLI piping tricks, and workflow patterns. Built because the ecosystem was too scattered to navigate easily. High-signal starting point for new and experienced users alike.

curated-listclaude-mdmcphooksresources
by @1erkan Mar 9, 2026 8/10
skill Reddit

Claude Code skill for instant web analytics setup on new projects

A Claude Code skill that automates adding web analytics to any new project in seconds. Install with `npx skills add isaacaudet/web-analytics-setup`. Eliminates the repetitive manual setup that most developers redo on every project. Practical time-saver for frequent project starters.

skillsanalyticssetupautomation
by demars123 Mar 9, 2026 7/10
skill Reddit

How to debug Claude Code skills: 6 failure patterns from building MCP workflow chains

After building 7 Claude Code skills that chain MCP tool calls, the author cataloged the 6 most common failure patterns with concrete fixes for each. Covers issues like tool call ordering, error propagation, context loss, and MCP response handling. Practical debugging guide that applies to any skill calling MCP servers.

debuggingskillsmcpfailure-patterns
by mgdo Mar 9, 2026 8/10
skill GitHub

awesome-anthropic: Daily-updated curated list of Anthropic tools, resources, and projects

A maintained, daily-updated index of tools, resources, and community projects across the Anthropic ecosystem. Covers Claude Code, MCP, the API, and third-party integrations. Useful as a living reference for staying current without monitoring every forum and repo individually.

curated-listresourcesanthropicreference
by Boroldoi0402 Mar 9, 2026 5/10
skill GitHub

Awesome-Agent-Skills: Discovery hub for Claude Code, OpenAI, and MCP skills

A curated collection and navigation resource for AI agent skills across Claude Code, OpenAI, and MCP servers. Centralizes community-built skills to make them easier to discover and install. Good starting point for extending your agent's capabilities.

skillsdiscoverycurated-listmcp
by megalor1 Mar 9, 2026 5/10
skill GitHub

Custom Claude Code skills for port management and international translations

A collection of practical Claude Code skills targeting everyday dev friction: port conflict management and multilingual content translation. Covers real workflow pain points with reusable slash commands. A good example of targeted, single-purpose skill design.

skillsautomationproductivitycli
by danicuevas23 Mar 9, 2026 6/10
skill GitHub

claude-skills: Reusable slash-command workflows for reliable multi-step tasks

A collection of slash-command workflows specifically designed to make Claude Code reliable on complex, multi-step tasks where it commonly drifts or fails. Addresses real failure modes in agentic operations through structured skill patterns. A practical toolkit from an active Claude Code power user.

skillsslash-commandsreliabilityworkflow
by npow Mar 9, 2026 7/10
skill GitHub

everything-claude-code: Complete agent collection from an Anthropic hackathon winner

A comprehensive collection of Claude Code configurations, agents, and patterns refined over 10+ months by an Anthropic hackathon winner. Covers the full range from basic prompting to multi-agent orchestration. One of the most battle-tested Claude Code setups available publicly.

agentsconfigurationhackathonreference
by arabicapp Mar 9, 2026 8/10
skill GitHub

agent-skills: Shared skill collection for OpenClaw and Claude Code

A collection of agent skills designed to work with both OpenClaw and Claude Code. Provides reusable commands that extend your coding agent's capabilities with community-contributed workflows. Good resource for skill authors looking at cross-compatible patterns.

skillsopenclawcross-compatiblecommunity
by ZLHad Mar 9, 2026 5/10
skill GitHub

Claude Code skill for creating and editing PowerPoint presentations via XML

A Claude Code skill that generates and edits PowerPoint presentations using direct XML manipulation. Enables AI-assisted slide creation from within your development environment without external tools. Useful for developers who need to produce presentation deliverables alongside code.

skillspowerpointpresentationsoffice
by 24111999 Mar 9, 2026 5/10
skill GitHub

research-skills: Claude Code skills for literature reviews and paper-to-slide generation

Academic research skills for Claude Code covering literature review writing and automated slide generation from research papers. Bridges the gap between reading papers and producing research outputs. Designed for researchers and graduate students using AI in their academic workflow.

skillsresearchacademicpresentations
by Ronitnair Mar 9, 2026 5/10
skill GitHub

agent-skills-guide: Official + community guide to creating Claude Code agent skills

A comprehensive guide for creating and enhancing Agent Skills, drawing from official Anthropic documentation and community insights. Covers skill structure, tool integration, and effective prompt patterns. Good starting point for developers new to building Claude Code skills.

skillsguidedocumentationgetting-started
by kaydenplayZ Mar 9, 2026 5/10
skill X

Claude Code skill: convert plain-text to structured JSON image prompts for Nano Banana 2

A Claude Code skill that rewrites plain-text image descriptions into structured JSON prompts optimized for Nano Banana 2 (image generation model), producing professional-quality outputs. Demonstrates how Claude Code skills can bridge AI tools via prompt transformation.

skillimage-generationJSONprompt-engineering
by @TechWith_Nova Mar 9, 2026 6/10
skill GitHub

knowledge-foundation-starter: Stack-Agnostic Knowledge Governance Template

A reusable project template providing ADR, TLDR, and Roadmap systems with pre-configured AI agent and skill configs for Claude Code and Codex CLI. Designed to bring structured knowledge governance to any codebase regardless of stack.

templateCLAUDE.mdADRknowledge-managementcodex
by marioGusmao Mar 9, 2026 7/10
skill GitHub

Multi-Model Agent Implementation Skill for Claude Code

A Claude Code skill that orchestrates a full implementation workflow across multiple AI models: research, evaluation, design baseline, implementation, root cause analysis, and auditing. Designed to leverage each model's strengths at different stages of a task.

skillmulti-modelworkfloworchestrationaudit
by nestharus Mar 9, 2026 8/10
skill GitHub

Claude Scientific Skills: Research and Analysis Agent Skills Collection

A ready-to-use set of Claude agent skills covering research, science, engineering, analysis, finance, and writing. Provides domain-specific prompting patterns for technical and scientific work where Claude Code is used beyond pure software tasks.

skillresearchscienceengineeringanalysis
by K-Dense-AI Mar 9, 2026 7/10
skill GitHub

Comprehensive Claude Code Skills: Full Delivery Workflow Collection

A production-ready skills collection covering the complete delivery workflow: research, epic planning, task breakdown, implementation, testing, code review, and quality gates. Designed as a drop-in skill set for teams using Claude Code professionally.

skillworkflowproductioncode-reviewquality
by levnikolaevich Mar 9, 2026 8/10
skill GitHub

Android Reverse Engineering Skill for Claude Code

A Claude Code skill that wraps jadx to decompile Android APK, XAPK, AAB, DEX, JAR, and AAR files directly from your coding session. Useful for security researchers and developers analyzing third-party Android binaries.

skillandroidreverse-engineeringsecurityjadx
by incogbyte Mar 9, 2026 6/10
skill Reddit

Claude Code Skill: 6 Parallel Research Agents for Market Analysis

A Claude Code skill that dispatches 6 parallel research agents to analyze any market in ~20 minutes using real web data — reviews, pricing, forums, funding signals, and hiring trends. Demonstrated on the AI coding assistants market with 15 competitors analyzed.

skillresearchparallel-agentscompetitive-intelligencemarket-analysis
by ferdbons Mar 9, 2026 7/10
skill GitHub

claud-skills: Production-Ready Claude Code Agents with Auto-Generated Docs

A framework for building and using production-ready Claude Code agents and skills, with automatic documentation generation. Helps teams maintain a catalog of reusable agent behaviors with up-to-date documentation.

skillagentsdocumentationproductivity
by bloody2634 Mar 9, 2026 6/10
skill GitHub

claude-config: 16-Skill Professional Config with REEL Orchestrator

A one-command install providing professional Claude Code configuration: 16 curated skills, automated hooks, team coding standards enforcement, and the REEL autonomous orchestrator. Designed as a complete opinionated setup for teams adopting Claude Code at scale.

skillhooksorchestrationCLAUDE.mdteamconfiguration
by gsmethells Mar 9, 2026 8/10
skill GitHub

skill-codex: Claude Code Skill for Automated Analysis via Codex CLI

A Claude Code skill that enables automated code analysis and editing by leveraging Codex CLI under the hood. Useful for refactoring workflows where you want Claude Code to orchestrate Codex for specific transformation tasks.

skillcodexautomationrefactoringanalysis
by LightDopper Mar 9, 2026 6/10
skill GitHub

playwright-skill: Claude Skill for Dynamic Browser Automation

A Claude Code skill that executes dynamically generated Playwright code for browser automation tasks. Rather than writing Playwright scripts manually, you describe what you want and Claude generates and runs the automation on demand.

skillplaywrightbrowser-automationtesting
by jpulido240-svg Mar 9, 2026 7/10
skill GitHub

claude-skills-marketplace: System Architect Skill for Project Documentation

A Claude Code skill that transforms Claude into a System Architect, generating detailed project documentation with clear component boundaries and traceable requirements. Useful at project kickoff to produce structured specs before implementation begins.

skillarchitecturedocumentationrequirementsspecs
by 428alexander9 Mar 9, 2026 6/10
skill GitHub

Product-Manager-Skills: Battle-Tested PM Skills Framework for Claude Code

A product management skills framework built on proven PM methodologies, compatible with Claude Code, Cowork, Codex, and AI agents. Covers roadmapping, prioritization, stakeholder communication, and delivery — bridging PM work with AI-assisted engineering.

skillproduct-managementroadmapprioritizationmethodology
by deanpeters Mar 9, 2026 7/10
skill GitHub

startup-skill: AI Agent Skills for Startup Validation and Competitive Intel

A set of Claude Code agent skills targeting startup use cases: market validation, competitive intelligence, and planning. Designed for founders and product builders using Claude Code to accelerate pre-build research.

skillstartupcompetitive-intelligencevalidationplanning
by ferdinandobons Mar 9, 2026 6/10
skill Reddit

Claude + Telegram

Any skill that will help Claude understand the telegram’s premium features, its architecture. To use for deploying a new bot. submitted by /u/Mon3y_craft [link] [comments]

skill
by Mon3y_craft Mar 9, 2026 6/10
skill Reddit

Skills - should I include examples?

I've been playing with the design of my personal skills I've written. I have lots of code examples in them, because when I was asking Claude for guidance in writing them it encouraged me to do so. ...

skill
by lambda-legacy Mar 9, 2026 6/10
skill Reddit

Skill or Project

My idea is to submit text, or a pdf, for Claude to analyze and output specific quotes from it that are in a certain tone, word limit, and subject. I have used projects before and know they are good...

skill
by jawwajxy Mar 9, 2026 6/10
skill GitHub

Svelte 5 Development Skill for Claude Code

A Claude Code skill providing structured, token-efficient guidance for Svelte 5 development including best practices, real-world patterns, and expert insights. Gives Claude deep Svelte 5 context without bloating the context window.

Svelteskillfrontendtoken-efficient
by NikosDevMC Mar 9, 2026 6/10
skill GitHub

Full-Stack Skills for Claude Code: Cloudflare, React, Tailwind v4

A collection of Claude Code skills targeting modern full-stack development with Cloudflare Workers, React, Tailwind CSS v4, and AI integrations. Provides structured, up-to-date context so Claude can assist accurately with these stacks without hallucinating outdated APIs.

CloudflareReactTailwindskillsfull-stackAI-integration
by jezweb Mar 9, 2026 7/10
skill GitHub

Unofficial Swift Language Skill for Claude Code

A structured Claude Code skill providing comprehensive access to Swift Programming Language content, enabling Claude to give expert Swift guidance for iOS and macOS development. Covers core language features and common patterns from the official Swift book.

SwiftiOSmacOSskilllanguage
by Shada01245 Mar 9, 2026 5/10
skill GitHub

RubyCritic Skill for Ruby/Rails Code Quality Analysis

A Claude Code skill that integrates RubyCritic to surface code quality metrics, complexity scores, and technical debt insights for Ruby and Rails projects. Enables Claude to reason about and improve code quality as part of your development workflow.

RubyRailscode-qualityRubyCriticskillmetrics
by thairns Mar 9, 2026 6/10
skill GitHub

Gemini CLI Skill: Use Gemini Alongside Claude Code

A Claude Code skill that integrates Gemini CLI for code generation, review, testing, documentation, and architecture analysis. Lets Claude Code users leverage Gemini's capabilities within the same workflow for tasks where a second model opinion adds value.

Geminimulti-modelskillcode-reviewCLI
by Junayedahmedd Mar 9, 2026 6/10
skill GitHub

ast-grep Code Pattern Search Skill for Claude Code

A Claude Code skill that adds ast-grep-powered structural code search, letting Claude find patterns in codebases beyond simple text matching. Particularly useful for error handling audits, refactoring tasks, and enforcing coding conventions across large projects.

ast-grepcode-searchpatternsskillrefactoring
by Kayunangka Mar 9, 2026 6/10
skill GitHub

Multi-Agent Research Orchestration Skill for Claude Code

A Claude Code skill enabling orchestration of multi-agent research workflows with parallel subagent execution, structured audits, and workflow planning. Useful for complex investigations requiring breakdown across multiple specialized agents with result synthesis.

multi-agentresearchorchestrationparallelskill
by zubayer0077 Mar 9, 2026 7/10
skill Reddit

Use /loop on windows

Hi, I updated to 2.1.71 but when typing /loop nothing pop out and also If I try to use it saidd no skill found. Im on windows 11 submitted by /u/triko93 [link] [comments]

skill
by triko93 Mar 9, 2026 5/10
skill Reddit

Skills for claude.ai

Do you know of any cool skills for claude.ai for a WordPress FSE, SEO, copywriting, or design designer, social media post X, FB? I already have some, but maybe you can inspire me. Thanks in advance...

skill
by tomaszgiemza Mar 9, 2026 6/10
skill GitHub

baoyu-skills:

baoyu-skills:

skill
by JimLiu Mar 9, 2026 5/10