skill GitHub
A set of Agent Skills that teach Claude and other agents exactly which Markdown note.md renders and how its knowledge graph is derived. Useful if you keep notes in notemd and want an agent to write files it will actually display and link correctly.
skillsmarkdownnotesknowledge-graph
by a-aigner Sep 15, 2026 6/10
skill GitHub
Encodes autonomy tiers and blast radius into skills so an agent knows how far it is allowed to go before a human signs off. Ships a diagnostic manual for agent failure modes and maps its controls onto the EU AI Act, NIST AI RMF, ISO 42001, and DORA.
skillsgovernancecompliancesafetyeu-ai-act
by patkusch Sep 15, 2026 7/10
skill GitHub
A documented process for deduplicating a large agent skill library: merge skills that overlap, keep the ones that genuinely complement each other. Written up from real cleanup work, so it covers the judgment calls rather than just a script. Documentation is in Chinese.
skillsdeduplicationskill-librarymaintenance
by RichardoZhao Sep 15, 2026 6/10
skill GitHub
A free, stripped-down execution-protocol skill for Claude Code that forces work through four layers: gather context, execute, test, then polish. Aimed at stopping the agent from jumping straight to code and declaring victory before anything is verified.
skillprotocolworkflowtesting
by Getgodmode Sep 15, 2026 5/10
skill GitHub
A standard for writing shell utilities that agents and humans can both predict: every script takes the same shape, the --help output is the authoritative spec, and the target is the bash version macOS actually ships rather than a modern GNU bash. Useful if your agent keeps generating scripts that only run on Linux.
bashshellconventionsmacosskill
by rokokol Sep 15, 2026 6/10
skill GitHub
A skill that explains complex code and concepts in Hinglish, in the voice of the friend who crammed the whole syllabus with you the night before an exam. A novelty persona with a real use: the informal register drops the hedging and gets to the point faster than a textbook explanation.
explainhinglishteachingskillpersona
by dewanshparashar Sep 15, 2026 5/10
skill Reddit
Two Codacy skills that move static analysis and SCA earlier than the PR: one teaches the agent to set up and run Codacy analysis locally, the other teaches it to fold that analysis into any code review. Free and no authentication needed, so the agent can fix findings before a commit exists.
static-analysiscode-reviewscacodacyskill
by CodacyOfficial Sep 15, 2026 7/10
skill GitHub
GitHub workflow skills for Claude Code and Codex built around one constraint: the agent has to actually inspect and cite evidence rather than assert that a check passed or a diff is clean. Aimed squarely at the failure mode where an agent reports on a PR it never really read.
githubskillsevidencecodexpull-requests
by ryanduguid Sep 15, 2026 6/10
skill Reddit
Ten plain SKILL.md skills targeting the mistakes coding agents keep making when they write LLM applications: building an agent where a workflow suffices, exposing every API endpoint as its own tool, hand-parsing JSON when structured outputs exist, reaching for multi-agent architectures, stuffing chunks into context without document-level retrieval, and swapping models or RAG pipelines without measuring. Covers architecture, tool calling and design, structured output, prompting, context and memory, RAG, subagents, model selection, and evals, with references loaded on demand.
skillsllm-appsragevalsarchitecture
by Quirky-Location7712 Sep 15, 2026 7/10
skill GitHub
A QA and testing framework for Agent Skills: static validation, sandboxed test runs, a quality score, and CI integration. Treats skills as code that can regress rather than prose you paste and hope about. Documentation is in Chinese.
skillstestingvalidationciquality
by la2278647-arch Sep 15, 2026 7/10
skill GitHub
A Claude Code skill for driving a remote machine over SSH: connecting, probing the environment, editing files, and managing long-running jobs. Gives the agent a consistent procedure for remote work instead of ad-hoc ssh invocations. Useful for anyone whose real work happens on a server rather than the laptop.
sshremotedevopsskill
by c0ffee-milk Sep 15, 2026 7/10
skill GitHub
A Claude Code skill that builds a talk's skeleton first — a three-question brief, a section map with written transitions and a time budget, then a full speaker script — before generating the deck in Gamma, .pptx, an HTML artifact, or Canva. Inverts the usual slide-first workflow. Bilingual English/Vietnamese.
presentationslideswritingskill
by vicky-tiq Sep 15, 2026 6/10
skill GitHub
An agent skill that reduces the recognizable patterns of AI-generated prose and turns drafts into clear, deliverable Markdown or DOCX documents. Targets the em-dash-and-tricolon register that makes generated writing obvious. Written for Codex but the guidance transfers to Claude Code.
writingeditingdocxskill
by Wattson-Law Sep 15, 2026 6/10
skill GitHub
A collection of Claude Code skills for QA work where each skill terminates in a required independent-subagent review. The reviewing agent has no stake in the original work, which catches the self-approval failure mode where an agent declares its own output correct. Good pattern to lift even if you do not need the QA skills themselves.
qatestingsubagentsreview
by xtieume Sep 15, 2026 6/10
skill GitHub
A skill that lets an agent create tasks for humans to review, approve, or complete, exposed over both a REST API and MCP. Gives the agent a first-class way to block on human judgment rather than guessing or asking in chat. Useful for pipelines that must not fully auto-approve.
human-in-the-loopmcpapprovalrest-api
by sanctifai Sep 15, 2026 7/10
skill GitHub
Pure-Python guardrails for Godot 4 work: a linter that catches Godot-3-isms the model hallucinates, a scene map giving real node paths, and a version pin. Verified against Godot 4.7.2. Avoids the whole MCP layer, which makes it easy to drop into an existing project.
godotgamedevlintingguardrails
by brocolriri Sep 15, 2026 7/10
skill GitHub
A Claude Code skill that verifies tests are actually load-bearing: it breaks the subject under test, confirms the test goes red for the right reason, then restores the code. Catches the common agent failure of writing a test that passes no matter what. Small, sharp, and applicable to any test suite.
testingtddverificationskill
by ArnauFerma Sep 15, 2026 8/10
skill GitHub
A skill collection for AI short drama and micro-drama creation covering script, character assets, storyboard, image and video prompts, and a review pass. Works with both Claude Code and Codex, MIT licensed. Chinese and English documentation.
videocreativestoryboardskills
by zenstory-ai Sep 15, 2026 5/10
skill GitHub
An open-source GEO/AEO skill that audits how ChatGPT, Perplexity, Gemini, Google AI Overviews, DeepSeek, Doubao, Qwen, and Kimi describe and cite your brand, then writes the fixes. Notably it refuses to fabricate platform answers — you run the prompts, it does the analysis. Honest design for a category full of hallucinated reports.
seogeoaeoauditmarketing
by xwmtzcp Sep 15, 2026 6/10
skill GitHub
A Claude Code skill that turns long Zoom recordings into frame-accurate, captioned clips for LinkedIn. Claude makes the editorial cuts, ffmpeg does the rendering, and a built-in QC pass checks the result. Concrete example of pairing model judgment with a deterministic renderer.
videoffmpegcontentskill
by rajesh-ezio Sep 15, 2026 6/10
skill GitHub
A writing skill for coding agents that enforces plain factual output with no AI slop and no self-congratulation. Targets the register problem where agents narrate their own work as a triumph. Useful for PR descriptions, commit messages, and docs.
writingdocumentationstyleskill
by pliablepixels Sep 15, 2026 7/10
skill GitHub
A Claude Code skill pack for product managers covering product documentation, PRD writing, and high-fidelity prototype reproduction. Packages the recurring PM deliverables as skills rather than prompt templates. Chinese-language documentation.
product-managementprddocumentationskills
by skyhahalife-11 Sep 15, 2026 5/10
skill GitHub
A skill that grades Chinese 313 history exam essays: it independently generates a reference answer and scoring points, OCRs the student's answer, scores point by point, then outputs a Word feedback report. Generating the rubric before reading the answer is the right ordering to avoid anchoring. Narrow domain but a clean pipeline.
gradingeducationocrskill
by 2548-create Sep 15, 2026 5/10
skill Reddit
Vibe coding gets you 90% there; the missing 10% is what takes the app down. This open-source skill file scans and hardens the recurring flaws in AI-generated repos: leaked keys, missing CORS config, client-side tokens, unhandled API rate limits, missing env var validation, unmemoized hooks causing infinite re-renders, and unsanitized input.
securityhardeningproductionskill
by Quiet_Effect_4102 Sep 15, 2026 6/10
skill GitHub
The official Riffkit skill for turning a successful short-form video into your own, callable from Claude Code, Cursor, or the browser. It extracts the structural formula rather than copying the clip. Useful reference for creative skills that work from examples.
videotiktokcontentskill
by riffkit Sep 15, 2026 5/10
skill GitHub
An agent skill for authentic Arabic writing that removes English calques and translated phraseology (العرنجية) from Arabic text, based on Ahmad Al-Ghamdi's treatise on the subject. Works with Claude Code, Codex, Antigravity, and VS Code. A good example of a language-specific style skill grounded in a real source.
arabicwritinglocalizationskill
by specailm5 Sep 15, 2026 6/10
skill GitHub
The skills Neo.mjs maintainers load every session, packaged and versioned: ticket intake, PR review gates, lane coordination, and guards. Materialized into your repo rather than copied, so they stay updatable. Useful as a reference for what a real multi-model team's coordination layer contains.
skillsworkflowpr-reviewcoordination
by neomjs Sep 15, 2026 6/10
skill GitHub
Most skills tell an agent how to do things; these encode when to refrain. Works with Claude Code, Codex, Cursor, Gemini CLI, and 40 others, with zero executable surface — nothing to run, so nothing to audit for supply-chain risk. A useful complement to a library of capability skills.
skillsguardrailssafetycross-agent
by Jawahars07 Sep 15, 2026 7/10
skill GitHub
A Claude Code skill that produces mid-fidelity wireframes in HTML and exports desktop and mobile PNGs using Bun and Puppeteer. HTML as the wireframe source means the output stays editable and diffable. Portuguese-language README.
wireframedesignpuppeteerskill
by Thumendes Sep 15, 2026 6/10
skill GitHub
A small agent skill for waiting on external jobs and services without spending model tokens on repeated polling. Every poll cycle otherwise costs a full turn, which adds up fast on long builds and deploys. Simple idea, directly addresses a real cost sink.
tokenspollingskillefficiency
by wenxueru Sep 15, 2026 7/10
skill GitHub
A skill for writing skills, paired with the gate that checks whether the result is any good. The gate is the part most skill-authoring tools skip, leaving you to judge your own output. Worth a look if you are writing skills regularly.
skillsauthoringquality-gatemeta
by rokokol Sep 15, 2026 7/10
skill GitHub
A Claude Code skill that converts architecture diagrams, process flows, and development plans into self-contained interactive HTML files through a guided conversation. You describe the system and the skill walks you through structuring it, then emits one portable file with no build step or external assets. Handy for sharing design docs with people who will not clone your repo.
skilldiagramshtmldocumentation
by XuGuanghaiGoogle Sep 15, 2026 6/10
skill GitHub
Lets a coding agent draw cloud architectures, system designs, and data pipelines as real Draw.io and Excalidraw files rather than ASCII art or static images. Because the output is the native editable format, you can open the diagram and keep refining it by hand afterwards. Supports Claude Code, Codex, Cursor, OpenCode, Copilot, Antigravity, and Pi.
diagramsdrawioexcalidrawarchitecture
by mouadja02 Sep 15, 2026 7/10
skill GitHub
A public mirror of Alex Zapadenko's skill library, published as plain SKILL.md files you can drop straight into a project or global skills directory. Useful mainly as a browsable corpus of how other people structure skill definitions. No install tooling — just copy the files you want.
skillscollectionskill-md
by product-llc Sep 15, 2026 5/10
skill GitHub
Rewrites AI-generated Korean into prose that passes at work, using 29 decision-rule branches plus a context-reading judgement layer. Notably it does not call a model to perform the fixes, and individual rule branches can be toggled to match an organization's house style. Calibrated against roughly 600 human-written internal reports.
koreanwritingproofreadingskill
by kkhfiles Sep 15, 2026 5/10
skill GitHub
A set of separate Claude Code skills for JIRA covering issue management, workflow transitions, search, and collaboration. Splitting it per concern rather than shipping one monolithic skill keeps context cost down when you only need issue lookup. Pairs naturally with a ticket-to-PR loop.
jiraskillsautomationissue-tracking
by grandcamel Sep 15, 2026 7/10
skill GitHub
Community-maintained Agent Skills for Huawei Cloud covering billing, cost estimation, controlled provisioning, and account onboarding. The controlled-provisioning angle matters: it constrains what an agent may spin up rather than handing it an open cloud account. Niche unless you are on Huawei Cloud.
huawei-cloudbillingprovisioningskills
by concept-git Sep 15, 2026 5/10
skill GitHub
inktofilm is a skill for Claude Code and Codex that takes a single prompt or a full screenplay and produces a finished AI film. Each generated shot is checked against the story before it is kept, so continuity errors get caught rather than shipped. A rare example of a creative-production pipeline packaged as an agent skill.
skillvideocreativecodex
by yingwang Sep 15, 2026 6/10
skill GitHub
This Claude skill interviews you about your system — WAF, load balancers, VMs, microservices, ports, integrations — and then renders a complete interactive architecture, sequence, or flow diagram through archify. The interview step is the point: it pulls out details you would forget to mention in a one-line prompt. Good fit for documenting an existing system rather than sketching a new one.
skilldiagramsarchitecturedocumentation
by solankipravin374 Sep 15, 2026 7/10
skill GitHub
A set of Claude skills for reviewing applications to Chilean public funding programs — Sercotec, Corfo, FNDR, and Fondart — including backing the proposed budget with real quotes. Narrow by design, but a clean example of encoding a specific bureaucratic review process as skills. Spanish-language.
skillgrantsspanishreview
by icer Sep 15, 2026 5/10
skill GitHub
plain-mode is a small set of skills that reshape Claude Code's output: short answers, no jargon, and one clear next step instead of a wall of options. It targets the failure mode where a simple question returns an essay. Low effort to install, immediate effect on tone.
skilloutput-stylecommunication
by diflowrin Sep 15, 2026 6/10
skill GitHub
A plugin pack of Claude Code skills covering adversarial code review plus general workflow automation. The adversarial angle means the reviewer is told to attack the change rather than confirm it. A reasonable drop-in if you want a skeptical review pass without writing the prompts yourself.
skillcode-reviewadversarialautomation
by hebstr Sep 15, 2026 6/10
skill GitHub
Brings reqstool requirements traceability under AI assistance through config-driven skills and commands, so an agent can maintain the links between requirements, implementation, and tests. Targets teams already running reqstool in a regulated or audited context. Niche, but a real gap for anyone with traceability obligations.
skillrequirementstraceabilitycompliance
by reqstool Sep 15, 2026 5/10
skill GitHub
A skill set that teaches an agent how to use the systems an Exorails environment exposes — PostgreSQL, SSH, Kubernetes, Redis, S3 and more — installable with npx skills add. Tied to the Exorails platform, but a useful reference for how to package per-environment infrastructure knowledge as skills. Read it for the pattern even if you do not use Exorails.
skillinfrastructurekubernetesdevops
by thomasdseao Sep 15, 2026 5/10
skill GitHub
Three skills plus a rules file that patch common agent failure modes: drowning in work instead of delegating, building something that already exists instead of searching, and ignoring installed skills that should have fired. Works across 60+ agents, not just Claude Code. The 'make installed skills actually fire' piece addresses a real and underdiscussed problem.
skilldelegationrulesdiscipline
by yjhqwer Sep 15, 2026 6/10
skill GitHub
A portable collection of agent skills and plugins covering Salesforce API investigation, narrated shell demonstrations, and GitHub contribution workflows. The narrated-demo skill is the unusual one — it walks through shell work with explanation rather than just executing. Portable across agents, not Claude-Code-only.
skillsalesforceshellgithub
by j-256 Sep 15, 2026 5/10
skill GitHub
An Agent Skill that maintains a fixed canon of architecture documentation artifacts, refreshing them automatically as features land. It works diff-driven, emits Mermaid-only diagrams, and guards provenance so generated docs stay traceable. Good fit for teams that want architecture docs to stop drifting from the code.
skilldocumentationarchitecturemermaiddiagrams
by robertfoobar Sep 14, 2026 7/10
skill GitHub
A Claude skill that runs an adversarial multi-agent analysis: several agents examine a problem independently, one is required to play skeptic, and a constraint registry carries findings between rounds. The forced dissent is meant to stop agents converging on a comfortable answer too early. Repo documentation is in Russian.
skillmulti-agentadversarialreview
by Andrey-Batrimenko Sep 14, 2026 6/10
skill GitHub
A skill and plugin pair for Linux desktops that lets you ctrl+click a block of Claude Code output and get clean text on the clipboard. It strips the box-drawing pipes, quote markers, and surrounding commentary that normally come along with a terminal selection. Small quality-of-life fix for anyone moving drafted text out of the terminal.
skillpluginclipboardlinux
by geanruca Sep 14, 2026 6/10
skill GitHub
A bundled suite of agentic skills, subagent prompt templates, and SDLC tooling covering a five-phase path from idea to production. An NPX installer sets the whole thing up rather than requiring manual skill placement. Worth a look if you want an opinionated starting structure instead of assembling your own workflow skills.
skillsubagentssdlcworkflowtemplates
by garbsam97 Sep 14, 2026 6/10
skill GitHub
A pip-installable CLI plus skills covering requirements, design, diagram validation, an enforce gate and a workflow gatekeeper. Works across Claude Code, OpenCode, Codex, GitHub Copilot and Cursor, supports multi-project workspaces, and installs through the Claude Code plugin marketplace.
architectureskillsvalidationenterprise
by axisrobo Sep 14, 2026 6/10
skill GitHub
An official SAP repository equipping AI coding agents with knowledge and tooling for UI theme designer, the SAP Design System and SAP Fiori design tokens. Notable mostly as a large vendor publishing first-party agent plugins for its own design stack.
sapdesign-systempluginsfiori
by SAP Sep 14, 2026 6/10
skill GitHub
A Claude skill covering Betaflight flight controller configuration, PID tuning, blackbox log analysis and troubleshooting. A good example of packaging deep hardware-specific domain knowledge into a skill.
betaflightdronesskillhardware
by SebGalina Sep 14, 2026 5/10
skill GitHub
Produces condensed literature review notes as .docx with real margin comments rather than plain text, so the output drops straight into an academic review workflow. Documentation is in Chinese.
academicdocxresearchskill
by oli66666 Sep 14, 2026 5/10
skill GitHub
A set of original agent skills covering a touchstone conclusion lifecycle, a UI workflow and a director mode. Presented as production-tested rather than as another collection of links.
skillsuiworkflowcollection
by game1991 Sep 14, 2026 5/10
skill GitHub
A small plugin marketplace with skills for speech writing and HTML slide decks. Useful mainly as a working template for publishing your own marketplace of personal skills.
marketplacepluginsslideswriting
by moritz-rsth Sep 14, 2026 5/10
skill GitHub
An agent skill that writes quantitative trading strategies against the JoinQuant platform's API, compatible with both Claude Code and Cursor.
quanttradingjoinquantskill
by gaaiyun Sep 14, 2026 5/10
skill GitHub
A collection of agent skills, prompts and automation workflows for Codex, Claude Code and OpenClaw, documented in both English and Chinese.
skillscollectionpromptsbilingual
by seaworld008 Sep 14, 2026 5/10
skill GitHub
A skill that works through why a shipped product is not converting, then proposes moves matched to that specific product — each one attached to a source rather than offered as generic marketing advice.
marketingproductskilldiagnosis
by maxxthemate-png Sep 14, 2026 5/10
skill GitHub
Skills for company and product diligence, people mapping, outreach, cohort analysis and value-creation planning. A rare skill pack aimed at investors and operators rather than engineers.
diligenceinvestingbusinessskills
by IsmaelG Sep 14, 2026 6/10
skill GitHub
A practical playbook covering research, writing, reading and coding with AI, shipping as an article plus the prompts, agent rules and reusable skills behind it.
playbookpromptsskillscollaboration
by cnfjlhj Sep 14, 2026 5/10
skill GitHub
A skill that wires Claude Code up as the coordinator and Codex as the implementer so the two work a project together. Docs in Chinese.
codexcollaborationorchestrationchinese
by yiximy Sep 14, 2026 5/10
skill GitHub
Discovers candidate Agent Skills for the project you are actually in, vets them, and installs the ones you accept. Addresses the practical problem that the skill ecosystem is now far too large to browse by hand.
skillsdiscoveryinstalltooling
by nktznl Sep 14, 2026 7/10
skill GitHub
A collection of 60 skills with bilingual English and Chinese documentation, a single-command installer, and automatic validation before upload so broken skills do not ship.
skillscollectionbilingualinstaller
by BUTFL Sep 14, 2026 6/10
skill GitHub
A free Claude skill that turns a meeting transcript into recorded decisions, an action table with owners and due dates, and a ready-to-send follow-up email.
meetingstranscriptsproductivityskill
by FairdraftStudio Sep 14, 2026 5/10
skill GitHub
A Claude skill that produces an audience matrix and reviewed creatives for a VK Ads campaign, then launches it paused so a human approves before any spend starts. Docs in Russian.
advertisingvkmarketingrussian
by ai-hub-open Sep 14, 2026 5/10
skill GitHub
An evidence-first skill suite that takes mini-program projects from vague intent through intake, product specification, architecture, implementation, UI and device adaptation, debugging, verification and release readiness.
wechatmini-programskillsengineering
by NocodeMrLi Sep 14, 2026 5/10
skill GitHub
Covers research, UI, design systems, accessibility, content and design QA — the design-side counterpart to the engineering skill packs that dominate the ecosystem.
designaccessibilitydesign-systemsskills
by stritar Sep 14, 2026 6/10
skill GitHub
A skill implementing the gitflow branching model for Claude Code, installed through the plugin marketplace rather than copied in by hand.
gitgitflowpluginsskill
by biancoenrico Sep 14, 2026 5/10
skill GitHub
Generates ideas by running three to five agent personas through a structured facilitation method. MIT licensed and de-identified; docs in Russian.
brainstormingpersonasfacilitationrussian
by aipedagog Sep 14, 2026 5/10
skill GitHub
An agent skill that analyzes a codebase to produce structured documentation, then reviews and updates it incrementally instead of regenerating from scratch each time.
documentationcodebaseskillmaintenance
by MattiaF95 Sep 14, 2026 5/10
skill GitHub
Pushes Claude Code toward short, direct responses, with the explicit constraint that brevity never comes at the cost of a caveat that actually matters.
output-styleskillbrevityprompting
by RicardoAlbuquerquet Sep 14, 2026 6/10
skill GitHub
Casts the agent as an executive writing concierge for long-form fiction, handling the sounding-board and production side of writing a novel rather than generating prose wholesale.
writingfictionskillcreative
by richardelder2 Sep 14, 2026 5/10
skill GitHub
A skill that forces design tokens before code, an 8px grid, deliberate micro-typography, Hick's Law and authored texture — aimed at the generic look that generated UIs converge on. Docs in Portuguese.
uidesigntokensportuguese
by KaueTartari Sep 14, 2026 6/10
skill GitHub
A scheduled skill that tracks hotel cash rates and alerts you when a points redemption clears your cents-per-point threshold. Also a decent template for any scheduled watch-and-alert skill.
travelschedulingalertsskill
by johnisanerd Sep 14, 2026 5/10
skill GitHub
A plugin lab covering Gmail, YouTube, Apple Notes, image generation and Teams monitoring — a grab-bag of everyday integrations packaged as Claude Code plugins.
pluginsgmailintegrationsautomation
by weirdapps Sep 14, 2026 5/10
skill GitHub
A modular collection of developer skills and engineering workflows built for AI coding assistants. Docs in Chinese.
skillsworkflowscollectionchinese
by hydrz Sep 14, 2026 5/10
skill GitHub
A skills repository that keeps the requirement records, design reasoning, iteration history and verification evidence alongside each loadable SKILL.md, rather than shipping only the finished file.
skillsdocumentationdesign-rationalechinese
by heweidong-ecco Sep 14, 2026 5/10
skill GitHub
WBS, CPM critical path, a risk register, ADRs and a kanban board in a single offline HTML file, with Excel and Word export. Ships as an agent skill so Claude can generate and update the board for you.
project-managementofflinehtmlskill
by tohnee Sep 14, 2026 6/10
skill GitHub
A skill bundle for Claude Code and Codex that takes a frontend brief through to a shipped page. It includes a corpus of award-winning sites to design against, WebGL gradients, real parallax, procedural and Blender-modelled three.js exploded views, plus CC0 PBR materials and HDRI lighting. An audit step flags the usual tells of AI-generated pages.
skillfrontendwebglthreejsdesigncodex
by ridelink0 Sep 14, 2026 8/10
skill GitHub
A Claude skill for arranger-keyboard musicians that generates printable song sheets, arrangements and registration guides for Yamaha PSR-SX keyboards. Every preset name it emits is verified against the factory Data List, so the registrations it suggests actually exist on the instrument.
skillmusicyamahapsr-sxdocument-generation
by HelloIamChetan Sep 14, 2026 5/10
skill GitHub
A bundle of twelve agent skills spanning aesthetics, psychology, code, systems, wealth, and philosophy. Each uses a layered SKILL.md plus reference/ structure so the agent loads detail only when it needs it. Useful as a template for writing progressive-disclosure skills of your own.
skillsagent-skillsbundlereference
by mike22890 Sep 14, 2026 5/10
skill GitHub
Agent skills that run reproducible, zero-dependency compliance checks over tender and bidding documents and advertising copy. The design is deliberately mechanical, favouring rule lookups over model judgement so results repeat exactly. Chinese-first; this repo is the free tier of the source.
skillscompliancelegalchinese
by chenqg618 Sep 14, 2026 5/10
skill GitHub
A CLAUDE.md built around seven principles covering problem framing, scope, tradeoffs, and outcome measurement. The premise is that the most expensive bug in AI-assisted building is shipping the wrong thing well, so the config pushes the agent to interrogate the problem before it writes code. Draws on Karpathy's observations.
claude-mdproduct-managementplanningconfiguration
by sohaibt Sep 14, 2026 7/10
skill GitHub
A skill that turns websites, repositories, videos, and images into structured output: actionable methodologies, tech-stack breakdowns, UI insights, and product specs. Meant to feed agents and personal knowledge bases digested material instead of raw links.
skillresearchknowledge-basedistillation
by adigb6170 Sep 14, 2026 6/10
skill GitHub
A setup skill that converts a repository's conventions into enforceable gates: contracts, proven-red tests, and ratchets that only ever tighten. The goal is agent-written code that still holds up when nobody reads the diffs. Language-agnostic.
skilltestingquality-gatesci
by pliablepixels Sep 14, 2026 7/10
skill GitHub
A skill set covering the full sales motion: market sizing, ICP definition, quota and comp design, cold outbound, discovery, MEDDPICC qualification, negotiation, deal strategy, and post-sale handoff. For operators who want an agent that already knows the standard playbooks.
skillssalesgtmbusiness
by mbfinotti Sep 14, 2026 5/10
skill GitHub
Skills for the RevOps function: CRM data governance, pipeline and funnel management, lead routing and scoring, deal desk, forecasting, KPIs, and the sales-to-CS handoff. Companion to the same author's sales and partnerships skill sets.
skillsrevopscrmbusiness
by mbfinotti Sep 14, 2026 5/10
skill GitHub
Skills covering affiliate programs, influencer partnerships, channel alliances, joint go-to-market, partner enablement, and ecosystem measurement. Third in a set alongside the same author's sales and RevOps skills.
skillspartnershipsgtmbusiness
by mbfinotti Sep 14, 2026 5/10
skill GitHub
Skills, rules, and playbooks meant to pull near-frontier output from cheaper coding agents by imposing process discipline. Ships ports for Claude Code, Cursor, Gemini CLI, Antigravity, AGENTS.md tools, and MCP, so one rule set travels across harnesses.
skillsprocessqualityportability
by franciszver Sep 14, 2026 6/10
skill GitHub
A Claude Code skill that assembles a weekly agentic-AI and LLM newsletter, checks its own draft, then publishes it to a Hugo site. Triggered by a launchd agent so the whole loop runs unattended.
skillautomationnewsletterhugo
by ChrisAdkin8 Sep 14, 2026 6/10
skill GitHub
A port of Lauren Tan's poteto-mode playbooks, 23 engineering principles plus review and investigation skills, moved from Cursor plugins to native skills for Claude Code, Cowork, Codex, and ChatGPT. Opinionated process rather than tooling.
skillsworkflowcode-reviewport
by ahmedbenaw Sep 14, 2026 6/10
skill GitHub
Modern TypeScript implementations of all 22 Gang of Four design patterns, packaged both as an Agent Skill for coding assistants and as a developer playbook. Gives the agent concrete reference implementations rather than half-remembered ones.
skilltypescriptdesign-patternsreference
by fugisakimatheus Sep 14, 2026 6/10
skill GitHub
A skill that segments an image, re-skins it in a thermal-imaging aesthetic, and annotates the result. Colors are generated algorithmically with some randomness rather than derived from real temperatures, so it is for entertainment rather than measurement.
skillimage-processingsegmentationcreative
by petehottelet Sep 14, 2026 5/10
skill GitHub
Open-source templates, skills, and frameworks for using AI to design and maintain personal systems rather than just write code. Broad in scope, and most useful as a starting structure to adapt.
skillstemplatespersonalframeworks
by dkaleganov Sep 14, 2026 5/10
skill GitHub
A full-stack Agent Skill for building multi-tenant web apps with role-based access and audit trails, on Express, Sequelize, vanilla JS, MySQL, and Docker, with shared rules and end-to-end tests. Deliberately opinionated so the agent produces one consistent architecture rather than improvising per feature.
skillfullstackmulti-tenantexpress
by DevN-gr Sep 14, 2026 6/10
skill GitHub
Five independent skills plus a combined entrypoint that check a trading decision against your own rules, plan, citations, and execution record. Reviews material you supply rather than giving advice, which keeps it a verification tool. Chinese-first.
skillstradingreviewchinese
by catgrandfa Sep 14, 2026 5/10
skill GitHub
Skills for anyone wearing the BA or PO hat: requirements discovery, workshop analysis, user stories, Gherkin scenarios, API and integration analysis, source-to-target mapping, process modelling, backlog quality, and specification workflows. Aimed at developers and architects doing this work as much as at dedicated BAs.
skillsbusiness-analysisrequirementsgherkin
by NeetuAggarwal-AI Sep 14, 2026 5/10
skill GitHub
Claude Code skills covering the awkward parts of shipping a Mac app with SwiftPM: stable local signing, app bundling, terminal-driven UI checks, GitHub releases, executable tests, and Dictionary Services. The signing and bundling steps are where agents usually get stuck, so encoding them as skills is the useful move.
skillsmacosswiftpackaging
by tilakp Sep 14, 2026 6/10
skill GitHub
A single repo packaging eight agent skills that cover the Java/Spring development loop: process, code style, comments, SQL, builds, tests, onboarding legacy code, and a final consistency check. Install once and the whole family is available across projects. Docs are bilingual Chinese/English.
javaspringskillsagent-skillscode-review
by soft6096 Sep 13, 2026 6/10
skill GitHub
A Claude Code and Codex skill plus CLI that generates a self-contained HTML slide deck from any content, with no dependencies and no build step. The output stays hand-editable via drag-and-retype, with brand-consistent type roles, in-file PDF export, and verified layout. Pitched as an open alternative to PowerPoint, Gamma, and Slidev.
slidespresentationshtmlskillcodex
by grunion-ai Sep 13, 2026 7/10
skill GitHub
A skill collection that lets an agent answer everyday questions about living in Japan using official open data: JMA weather, Cabinet Office disaster information, and the Calil library API. No accounts or API keys required. Japanese-language.
japanopen-dataagent-skillsweatherjapanese
by tahodev Sep 13, 2026 5/10
skill GitHub
A trio of Claude Code skills for Chinese writing: viral article structure, advertising copy, and personal-brand voice. Each is distilled from a corpus study rather than hand-written rules, drawing on 9,268 articles, the CA$HVERTISING method, and 153 Dan Koe videos.
writingcopywritingchineseskillmarketing
by laoyang687 Sep 13, 2026 5/10
skill GitHub
An agent skill that walks a proposal through grant-reviewer logic: where the innovation actually sits, whether the plan is feasible, and which weaknesses tend to draw rejections. Aimed at tightening a grant narrative before submission.
grantsresearchagent-skillsevaluation
by Ikramahmadmemon13 Sep 13, 2026 5/10
skill GitHub
An agent skill that separates presentation strategy from rendering: it produces a strategy, then a presentation intermediate representation, then renders. The result is a runnable presentation app you can branch into deeper detail or adjust live. Works with Claude Code, Codex, OpenCode, and Kimi Code. Chinese-language.
presentationsskillchinesecodexrendering
by mizzlelover Sep 13, 2026 5/10
skill GitHub
Skills covering the full short-form drama pipeline: script, hook design, character consistency, storyboards, seven-part prompt templates, voiceover, and an edit list. Ships with compliance gates, four QC layers, an 18-item failure-mode library, and two worked examples. MIT, Chinese-language.
videoshort-dramaskillchineseproduction
by jiduge9-coder Sep 13, 2026 5/10
skill GitHub
A structured reasoning skill that makes Claude work through a fixed sequence before responding: establish context, name the actual goal, audit assumptions, then navigate around known walls. Intended to cut down on confident answers to the wrong question.
reasoningskillpromptingplanning
by Firekid-is-him Sep 13, 2026 6/10
skill GitHub
Document-generation skills for Claude Code, Codex, and Cursor covering PowerPoint decks, Word reports and proposals, and PDF production with print-versus-screen route selection, font embedding, and a QA pass. Knowledge-first rather than script-driven: storylines, structure rules, chart-by-question, and verification contracts. MIT.
documentspptxdocxpdfskill
by meshcode-ai Sep 13, 2026 7/10
skill GitHub
Video skills for Claude Code, Codex, and Cursor: cutting clips from long-form video, 9:16 reframing with captions, script structure with retention checkpoints and hook formulas, and thumbnail/title packaging with CTR diagnosis. Encodes judgment criteria and output contracts instead of shipping scripts. MIT.
videoshortsskillyoutubecodex
by meshcode-ai Sep 13, 2026 6/10
skill GitHub
Design skills for Claude Code, Codex, and Cursor: homepage and landing page design, a UI audit that grades A-F, and design tokens and systems across primitive, semantic, and component layers including dark mode and migration. Includes a list of AI-template tells to avoid. MIT.
designuidesign-tokensauditskill
by meshcode-ai Sep 13, 2026 7/10
skill GitHub
A frontend specification and agent skill built by extracting principles from Anthropic's and Kimi's published design guidance, case studies, and interviews. Gives an agent a concrete house style for interface work instead of generic advice. Chinese-language.
frontenddesignskilluichinese
by Hai-qq Sep 13, 2026 6/10
skill GitHub
A set of 27 skills aimed at the Claude environment itself rather than your code: diagnosing what is misconfigured, building the missing pieces, and optimizing each architectural layer. Useful once your CLAUDE.md, hooks, and skills have grown past the point you can audit by hand.
skillsconfigurationdiagnosticsclaude-codetooling
by drayline Sep 13, 2026 7/10
skill GitHub
An automatically updated leaderboard of GitHub repos offering academic and research skills for Claude Code, Codex, and OpenCode. It searches, filters, and ranks daily, aimed at Chinese-speaking researchers looking for what is actually maintained.
researchskillsleaderboardchinesediscovery
by kael-odin Sep 13, 2026 5/10
skill GitHub
A Claude Code skill encoding development rules: a layered architecture scaffold, a startup gate that requires checking for an existing open-source solution before building, and rules for which AI to dispatch a given task to.
rulesarchitectureskilldisciplinemulti-model
by kxc7558 Sep 13, 2026 5/10
skill GitHub
A Hungarian style skill that applies rules while text is being written rather than rewriting finished output, and only asserts what the source actually supports. Ships 26 patterns, document-level decisions, and a lint that runs without an LLM. Works with Claude Code, Codex, Cursor, Copilot, Gemini CLI, and 74 other agents.
writinghungarianhumanizerlintskill
by Dexxter182 Sep 13, 2026 5/10
skill GitHub
A public collection of agent skills covering operations, running a one-person company, AI delivery work, interviewing, and structured note-taking. Chinese-language.
skillsbusinessoperationschinesecollection
by dugujun3-cloud Sep 13, 2026 5/10
skill GitHub
An agent skill for kinetic typography, logo animations, and brand promos written as React components in Remotion, then rendered to MP4. One codebase produces both 9:16 and 16:9 output.
remotionmotion-graphicsreactvideoskill
by Boriwatopal Sep 13, 2026 6/10
skill GitHub
An agent skill that detects a repo's stack, runs a supply-chain security check before touching install scripts, then installs, starts, and health-checks it. Aimed at the common case of cloning something you found and letting an agent bring it up without blindly executing whatever is in the postinstall hook. Works with Claude Code, Codex, and Cursor.
skillsecuritysupply-chainonboardinggithub
by Jia-ben00 Sep 13, 2026 7/10
skill GitHub
An agent skill for creating, auditing, restructuring, translating, and validating README files, built so claims are grounded in what the repo actually contains rather than what the agent assumes.
readmedocumentationauditskilltranslation
by Shiaoming123 Sep 13, 2026 6/10
skill GitHub
Agent skills covering GTM work: building lead lists, cold email, LinkedIn, AI visibility checks, Reddit and brand monitoring, and ad creative. The skills are open source; execution runs on RouterGrowth on a pay-per-call basis.
gtmmarketingskillssalesautomation
by RouterGrowth Sep 13, 2026 5/10
skill GitHub
Two Claude skills: trip-guide-builder turns a one-line travel request into a mobile-friendly guide page, and social-card-render produces a shareable image card from it. Chinese-language.
travelskillchinesemobilesocial
by calmsprite2001 Sep 13, 2026 5/10
skill GitHub
A skill about maintaining skills: detecting redundancy, thinning bloated entries, merging overlaps, and deciding what to archive. Applies to any SKILL.md-based agent setup, not just Claude Code. Chinese-language.
skillsmaintenancerefactoringchinesemeta
by feverZHONG Sep 13, 2026 6/10
skill GitHub
One developer's collection of Claude Code plugins — self-assess, quality, compass, cupertino, andon, and cli-scaffold — kept in a single marketplace repo.
pluginsmarketplaceskillscollectiontooling
by Anselmoo Sep 13, 2026 5/10
skill GitHub
Review skills for Claude Code and Codex covering usability, psychology, accessibility, product, and trust. Each finding carries how well it is supported and how severe it is, instead of collapsing into one opaque UX number you cannot act on.
uxaccessibilityreviewskillcodex
by DrSmile444 Sep 13, 2026 7/10
skill GitHub
A reusable skill collection aimed at research work: paper review, commit triage, renting GPUs, reference search, research logs, and image-prompt composition.
skillsresearchpapersgpucodex
by Axect Sep 13, 2026 6/10
skill GitHub
A Claude Code plugin that turns a codebase or design doc into an analysis where every claim carries its evidence, then compiles interactive diagrams from that analysis. The diagrams cannot drift from the text because they are generated from it and validated.
architecturediagramspluginanalysisdocumentation
by cognitive-fab Sep 13, 2026 7/10
skill GitHub
An agent skill that takes a flat logo and produces a React Three Fiber scene rendering it as a premium-looking spinning coin, previewable in the browser.
3dreact-three-fiberlogoskillanimation
by hasuwini77 Sep 13, 2026 5/10
skill GitHub
Encodes the details that break Korean-language PowerPoint output — lang=ko-KR tagging, and how paragraph and master-level formatting inherit — as rules for Claude Code, Codex, Antigravity, Cursor, and others.
pptxkoreanformattingskilldocuments
by sshin90 Sep 13, 2026 5/10
skill GitHub
Production-oriented Claude Code project templates bundling specialized agents, reusable skills, rules, and hooks so a new project starts with the configuration already in place.
templatesagentsskillshooksscaffolding
by IuliaIvanaPatras Sep 13, 2026 5/10
skill GitHub
Rules that push a coding agent toward honesty: no reflexive agreement, no caving when you push back on code that was actually correct, and no claiming 'done' without a command whose output proves it. Works across 20 agents.
honestyrulesverificationpromptingskill
by HimanshuJ16 Sep 13, 2026 7/10
skill GitHub
A skill for Claude Code and OpenCode covering the parts agents usually get wrong about property-based testing: picking the strongest property rather than one that is trivially true, writing generators that do not quietly exclude interesting inputs, order-of-arrival properties, and triaging a shrunk failure.
testingproperty-basedfast-checkhypothesisskill
by nyxandro Sep 13, 2026 7/10
skill GitHub
A long-term project memory layer that works across Claude Code, Cursor, Windsurf, Cline, and four others. Bundles TDD rules, a code graph, spec-driven development conventions, and cross-session recall.
memorytddcode-graphcross-agentspec-driven
by fockus Sep 13, 2026 6/10
skill GitHub
A Claude Code skill that proposes which command to run next along with the cheapest model and effort level that will still do the job properly. French-language.
skillcostmodel-selectionworkflowfrench
by gabriel-delavaud Sep 13, 2026 5/10
skill GitHub
An agent skill for service-topology and request-path diagrams that marks which components were actually verified in the code versus inferred companions, so the diagram never quietly invents a queue or cache that is not there.
diagramsarchitecturehonestyskillverification
by albegosu Sep 13, 2026 7/10
skill GitHub
Targets the ways long agent collaborations go wrong rather than any single coding task: keeping continuity across sessions, preserving judgment instead of drifting toward agreement, detecting traps, and translating faithfully.
cognitionlong-horizoncontinuityskilljudgment
by hegu-1 Sep 13, 2026 6/10
skill GitHub
An agent skill that judges any AI gadget as tool, toy, or trash by reading its product page with the brand stripped out, running three independent auditors and one safety veto.
evaluationhardwareauditskillreview
by ToyWorks Sep 13, 2026 5/10
skill GitHub
A productivity skill that borrows the pressuring language of Chinese and Western big-tech management to keep an agent from settling for its first answer. Supports Claude Code, Trae, Cursor, and ten-plus other agents. Fork of tanweai/pua. Chinese-language.
promptingpersistencechineseskillfork
by Kirky-X Sep 13, 2026 5/10
skill GitHub
Agent skills covering the paid media workflow: picking channels, setting budgets, defining audiences, briefing creative, and measuring results.
advertisingmarketingskillspaid-mediameasurement
by mbfinotti Sep 13, 2026 5/10
skill GitHub
A Claude Code skill that converts study text or a topic list into cached summaries, flashcards, and quizzes rendered as printable HTML. Caching means re-running on the same material does not re-bill.
studyflashcardshtmlskilleducation
by grabreu Sep 13, 2026 5/10
skill GitHub
A starter template packaging the working practices Claude Code's creator has described publicly into configuration you can drop into a project.
templateclaude-mdcursorconfigurationbest-practices
by 7dieuuoc Sep 13, 2026 5/10
skill GitHub
Skills for Qualcomm QAIRT/QNN model deployment: converting ONNX models to run on the Hexagon HTP, AIMET quantization, and eSDK cross-compilation. Narrow, but this is exactly the kind of toolchain where an agent that already knows the flags saves hours.
qualcommonnxquantizationedge-aiskill
by dev-ansh-r Sep 13, 2026 6/10
skill Reddit
A Max 5x user's rules for taming explanation style: open with one paragraph on what the thing is before any finding about it, and name things in the user's world — real-world entities and user-facing behavior — rather than in the code's vocabulary, among six others. Found by accident while pairing Opus 5 with Fable for planning.
claude-mdopusverbosityrulesprompting
by tetro_ow Sep 13, 2026 7/10
skill GitHub
A file-based memory discipline for coding agents: a BRAIN.md the agent reads at session start and updates at the end, a CLAUDE.md generator that keeps many repos consistent, and hooks that enforce the ritual instead of hoping the agent remembers.
memoryclaude-mdhooksdisciplinecross-repo
by intotheveil Sep 13, 2026 7/10
skill GitHub
A decision-research skill for Claude Code and Codex built around honest evidence grading: each claim carries its support level, and the skill says outright when the evidence cannot settle the question instead of picking a side. Free, from DBHQ.
researchevidencedecision-makingskillcodex
by dbhq-uk Sep 13, 2026 6/10
skill GitHub
A Claude Code skill for analytical chemistry — FTIR/ATR, PXRD, calibration curves, chemometrics, CIF and crystal structures, and cocrystal identification — producing publication-grade figures behind gates that stop the analysis when the data does not support it.
chemistryfiguresscienceskillanalysis
by TheDop Sep 13, 2026 5/10
skill GitHub
Design rules for building genuinely native-feeling macOS 27 interfaces: restrained use of Liquid Glass, integrated panes, real SwiftUI and AppKit, and cutting the unnecessary boxes agents tend to nest.
macosswiftuidesignskillui
by gambadio Sep 13, 2026 6/10
skill GitHub
A plugin bundling specialized skills for a 2026 fullstack stack — React 19, Tailwind v4, Bun, Next.js 15, MCP v1.9, Rust, Python 3.14 — and running them as a multi-agent swarm across Antigravity, Claude Code, and Cursor.
pluginmulti-agentfullstackreactcursor
by roedyrustam Sep 13, 2026 5/10
skill GitHub
Sets up a Claude Code environment for marketing work: configures the workspace, organizes recurring processes, and helps build custom skills for your own business. Portuguese-language.
marketingworkspaceskillsportugueseconfiguration
by lucasenatm Sep 13, 2026 5/10
skill GitHub
A Claude Code plugin marketplace holding one developer's standard approach to software projects, applied uniformly rather than re-decided per repo. German-language.
pluginmarketplaceworkflowgermanskills
by f-reiser Sep 13, 2026 5/10
skill GitHub
One developer's agent skills, tailored to their own OMP setup but kept compliant with the Claude Code Marketplace format so they install cleanly elsewhere.
skillsmarketplacecollectionpersonalomp
by dnswd Sep 13, 2026 5/10
skill GitHub
A tool-agnostic skill that gives an agent judgment about evaluation: whether a task actually needs an eval or benchmark, how to construct one that holds up, and how to interpret the results. Takes a deterministic-first stance rather than defaulting to LLM judges. Written in plain language rather than as a framework.
evalsbenchmarkingtestingskill
by alexgreensh Sep 13, 2026 6/10
skill GitHub
Pairs a deterministic linter with an agent skill to review requirements documents against ISO 29148 and INCOSE quality criteria. The linter catches the mechanical defects reproducibly while the agent handles judgment calls. Supports Italian and English.
requirementslinteriso-29148review
by EnzinoBB Sep 13, 2026 6/10
skill GitHub
A free MIT-licensed set of agent skills covering the full US affordable housing continuum, from homelessness services through to homeownership. Encodes domain knowledge that nonprofit staff would otherwise have to explain to the model every session. A good example of skills written for a specific professional domain rather than for coding.
skillsnonprofithousingdomain-specific
by brendon-connelly Sep 13, 2026 5/10
skill GitHub
Turns an existing folder of markdown notes into memory that Claude Code actually reaches for, rather than a vault it ignores. Ships vault helper commands, session hooks that load and write context automatically, and two MCP servers. Good fit if you already keep an Obsidian-style vault.
memorymarkdownhooksmcpobsidian
by Dressi123 Sep 13, 2026 7/10
skill GitHub
A skill for building electronic medical and health record applications with the safety scaffolding those systems require: HL7 FHIR links, controlled data sharing and audit logging. Built on the ECC skill collection. Narrow domain, but the audit and sharing patterns are the parts most likely to be got wrong by default.
healthcarefhiremrauditskill
by agenticluke Sep 13, 2026 5/10
skill GitHub
A skill for Claude Code and OpenCode that revises a project register of open problems against the current code, closing out what has actually been fixed and reporting what changed. Keeps everything in a single file rather than spreading stale TODOs through the repo.
issuestrackingmaintenanceskill
by nyxandro Sep 13, 2026 6/10
skill GitHub
A pattern for writing down what done means, how you will know it has been reached and who verifies it, all before an agent starts work. Ships as a documented pattern with a JSON schema, a worked example and a Claude Code skill. Apache-2.0 licensed.
planningacceptance-criteriaskillverification
by FortunaTerra-Group Sep 13, 2026 6/10
skill GitHub
A compact set of agent skills that impose an evidence-driven development flow on Claude Code and Codex CLI. Each step expects the agent to ground its changes in verifiable evidence rather than assumption. Portable across both CLIs from one skill set.
skillsworkflowcodexevidenceprocess
by yyqqCoding Sep 12, 2026 6/10
skill GitHub
One plugin of agent skills for spec-driven delivery across Claude Code, Codex, and OpenCode. At its center is an agentic loop — plan, review, implement, review, merge — run over fresh-context worker agents. Around it, helper skills scaffold specs into the repo, turn PRDs into feature specs, and feed lessons from shipped work back into the next cycle.
skillsspec-drivenworkflowmulti-agentplugin
by valzav Sep 12, 2026 7/10
skill GitHub
A personal skill collection that links its skills into the agent home directory rather than copying them, so the git checkout stays the single copy. Editing a skill in the repo takes effect immediately with no re-install step. A small pattern worth borrowing for anyone keeping skills under version control.
skillssymlinkdotfilesworkflow
by yasuyuki Sep 12, 2026 5/10
skill GitHub
A skill that drafts and audits technical resumes, using deterministic linting to strip generic AI phrasing and grounding claims in facts pulled from your actual codebases. It targets modern ATS semantic search and the six-second recruiter F-pattern scan. For engineers who want a resume that survives both the filter and the human.
skillresumeatscareerlinting
by prathameshlonare Sep 12, 2026 6/10
skill GitHub
An unofficial agent skill for driving ArvanCloud's APIs — CDN, DNS, IaaS, Object Storage, Edge, CaaS, and VOD/Live — from Claude Code or any SKILL.md-compatible agent. It also handles Let's Encrypt DNS-01 certificate issuance through acme.sh. Useful for teams on ArvanCloud who want infrastructure changes driven from the terminal.
skillcloudcdndnsinfrastructure
by erfnzdeh Sep 12, 2026 5/10
skill GitHub
A plugin marketplace connecting Claude Code to Formlabs 3D printers, bundling an MCP server with print-prep skills. It takes a model through preparation and sends the job to the printer without leaving the agent. A concrete example of wiring Claude Code to physical hardware.
3d-printingformlabsmcppluginhardware
by mkebiclioglu Sep 12, 2026 6/10
skill GitHub
An MIT-licensed set of skills for YouTube and Shorts marketing from Claude Code or Codex, covering high-CTR titles, SEO descriptions, retention hooks, thumbnails, and a full content plan. Publishing runs through Publora. For creators who want the content-strategy grind scripted rather than improvised.
skillyoutubemarketingseocontent
by sergebulaev Sep 12, 2026 5/10
skill GitHub
A Claude Code skill that converts a book chapter PDF into a lecture given by its author: HTML slides driven by narration, questions the audio stops on, and word-synced captions. Speech is generated locally on GPU with Kokoro, so it is free and unmetered. A strong example of a skill producing a complete multimedia artifact.
skillttseducationpdfkokoro
by ajaygunalan Sep 12, 2026 7/10
skill GitHub
A Claude skill for composing a GitHub profile README that fits the person behind it. You can copy a style you like, turn a photo into an ASCII portrait card, assemble widgets, and preview the result in both light and dark themes before publishing.
skillgithubreadmeprofile
by DEOWL-kan Sep 12, 2026 6/10
skill GitHub
The foundation plugin of the Open Science Pillars stack, covering earth science data formats, statistics, uncertainty quantification, cartography, quality control and reproducibility. It provides the start, discover-data and report workflows plus analysis review, and the project's domain plugins build on top of it.
pluginsciencedata-analysisreproducibility
by open-science-pillars Sep 12, 2026 5/10
skill GitHub
A Chinese-language job hunting Skill for Claude and Codex that searches companies that are hiring, does background research before you apply, keeps application records in one place, and helps fill in application forms. Every real submission requires manual confirmation.
skilljob-searchchineseautomation
by LH-kevin Sep 12, 2026 5/10
skill GitHub
A Chinese-language job hunting Skill for Claude Code and Codex: find roles, judge whether they are worth applying to, produce a resume and application materials, check them, and run mock interviews. It will not fabricate skills or numbers and will not predict your odds, and it reviews resumes for ATS readability plus separate recruiter and hiring-manager passes.
skilljob-searchresumechinese
by addsumtech Sep 12, 2026 5/10
skill GitHub
Takes a broad content direction and narrows it in six steps into a brief that answers who you are talking to, what you are saying, where to start and what the opening line is. Available as both a web version and an Agent Skill.
skillcontentwritingchinese
by luvif666-arch Sep 12, 2026 5/10
skill GitHub
A set of actionable ServiceNow development rules written to be followed by both human developers and AI coding agents. The goal is standardizing how ServiceNow work gets done so agent-generated code matches house style.
servicenowcoding-standardsrules
by Thebaultsemirigid251 Sep 12, 2026 5/10
skill GitHub
A Claude Code skill for last-minute studying: it takes the PDF sheet your teacher handed out and produces HTML lessons from it. Aimed at Thai high-school chemistry, biology, physics and math, with every number verified in Python.
skilleducationpdfthai
by PeerawitDeesamer Sep 12, 2026 5/10
skill GitHub
A plugin that builds and then maintains a curated index of several repositories so Claude knows your codebase and stays current as it changes. Every change to the index goes through a reviewer rather than being written blindly.
plugincodebase-indexcontext-managementmulti-repo
by nick-railsback Sep 12, 2026 7/10
skill GitHub
An agent skill that searches live Kuaishou video data by keyword, with filters for most-liked, newest, publish date and video duration. Results include title, author, plays, likes, comments and saves, each linking through to the original post.
skillkuaishousearchchinesesocial-media
by why20261 Sep 12, 2026 5/10
skill GitHub
A documentation-system skill built mainly around existing projects: it improves the docs you already have and locks in a role-based AI collaboration workflow. It also handles joining a project mid-flight or initializing a new one. Question-driven, 26 templates, MIT licensed.
skilldocumentationtemplateschinese
by warm-flame-core Sep 12, 2026 5/10
skill GitHub
Turns project documentation into a knowledge base structured for Claude Code to navigate, so the agent starts from written context instead of rediscovering the repository every session.
skilldocumentationcontext-management
by x0c Sep 12, 2026 6/10
skill GitHub
A skill covering everything published under your GitHub identity, approved card by card, plus the homework worth doing before you contribute to an upstream project.
skillgithubopen-sourcecontributing
by rokokol Sep 12, 2026 5/10
skill GitHub
A Skill for Chinese high-school exam argumentative essays (材料议论文): it pulls a thesis and argument layers out of the source material while keeping a student's own voice. It deliberately avoids stock phrasing and mechanical parallel constructions.
skillwritingeducationchinese
by lbyh0116 Sep 12, 2026 5/10
skill GitHub
A bundle of 17 agent and automation infrastructure skills spanning RAG pipelines, building MCP servers, prompt engineering, n8n automation and agent runtimes.
skillragmcpprompt-engineeringn8n
by poorvith-mp Sep 12, 2026 6/10
skill GitHub
A skill that writes a project's README against a fixed set of structure, tone and formatting rules, so output stays consistent across projects instead of being improvised each time.
skillreadmedocumentation
by rokokol Sep 12, 2026 5/10
skill GitHub
A Claude Code skill that lints for the UI states everyone forgets. It will not let a component be declared finished while its error state is still unimplemented.
skillfrontenduilintingquality
by DahanItamar Sep 12, 2026 7/10
skill GitHub
Takes any brand, product, event or phrase and produces original 1980s-anime print work: posters, packaging, merch, magazine covers and riso flyers in limited ink counts.
skilldesigngraphicsretro
by m-mahadi Sep 12, 2026 5/10
skill Reddit
The author's new first install in every Claude Code project, taking the slot codebase-mapper used to hold — quartermaster sets codebase-mapper up for you, builds the map, seeds live rules drawn from how you actually work, and picks stack plugins and permissions to fit the project, asking before it touches anything. It then stays in place and keeps the whole setup improving as the project changes, reading real session history to surface things you would never go looking for, like a capability you keep rebuilding by hand.
pluginsetupself-improvingcodebase-mapper
by TheDeadlyPretzel Sep 12, 2026 7/10
skill GitHub
A kernel for Claude Code projects built around a 101-line contract, 40 lazily-loaded skills, 7 hooks and 2 subagents, with nothing running in the background. The author presents it as the successor to SkillForge.
skillpluginhookssubagentslightweight
by bogdanov-igor Sep 12, 2026 6/10
skill GitHub
An MIT-licensed collection of 73 Agent Skills for business work — SEO and AEO, marketing, copywriting, operations, planning, research and executive advisory. Each is knowledge-first and around 2KB, carrying judgment criteria and output contracts rather than scripts. Works with Claude Code, Codex, Cursor and meshcode.
skillbusinessmarketingseocollection
by meshcode-ai Sep 12, 2026 6/10
skill GitHub
A Chinese-language coaching Skill that moves someone from a messy description of their situation to a checkable judgment about what stage they are at and what to do next. Runs in Codex, Claude Code, OpenClaw, WorkBuddy and other Agent Skills environments.
skillcoachingchinesepersonal-development
by renhuanyi Sep 12, 2026 5/10
skill GitHub
Agent skills that let you drive paid AI subscriptions as external agents instead of paying per API call, so no API keys are needed. Installs as a Claude Code, Codex or Antigravity plugin.
skillpluginsubscriptionsmulti-model
by apresmoi Sep 12, 2026 6/10
skill GitHub
A Claude Code profile you install once and carry to any machine: an 8-step development loop, a CLAUDE.md pre-commit gate, and a zero-hallucination policy baked in.
skillprofileworkflowpre-commit
by kopp0510 Sep 12, 2026 6/10
skill GitHub
A reusable research-onboarding skill for Claude, ChatGPT, Codex and other instruction-following agents, giving them a repeatable path into an unfamiliar research area.
skillresearchonboarding
by ljx-chase Sep 12, 2026 5/10
skill GitHub
A skill-driven research workflow for Claude Code covering theology, biblical archaeology, ancient history and digital humanities. It is methodology-aware — hermeneutic, quantitative or mixed — with SOFT-GATE audit trails and optional MCP integration.
skillresearchhumanitiesworkflow
by leiverkus Sep 12, 2026 5/10
skill GitHub
Agent procedures for Supabase row-level security, multi-tenancy, auth emails and payment webhooks. Each one ends in a check rather than assuming the change worked.
skillsupabasesecuritywebhooksverification
by tanfust Sep 12, 2026 6/10
skill GitHub
A shared vibecoding standards library that plugs into more than 15 coding agents at once — Claude Code, Cursor, Codex, Qoder, Trae, Windsurf, Copilot, Cline, Roo, Aider and others. Cross-platform on macOS, Linux and Windows, with a personal notes area and scripts for migrating existing projects.
skillcoding-standardscross-toolchinese
by handsongice Sep 12, 2026 6/10
skill GitHub
A set of Claude Code skills for AI-assisted web application penetration testing, packaging the usual assessment steps as agent skills.
skillsecuritypentestingweb
by frendysanusi Sep 12, 2026 6/10
skill GitHub
Four composable Agent Skills that let a coding agent drive, inspect, debug and profile an iOS app, reporting what it actually observed instead of guessing. Works in Claude Code, Codex, Cline and any Agent Skills runtime.
skilliosdebuggingprofilingtesting
by ksypinro Sep 12, 2026 7/10
skill GitHub
Nine Claude Code skills built on the idea that a whetstone cuts nothing but makes the blade cut: rough-cutting unscripted footage, auditing to a verdict, holding a visual contract, taming sprawl, drawing print layouts in code, and three on Chinese writing. CC BY-NC-SA 4.0, non-commercial use only.
skillvideowritingdesignchinese
by j912835225-prog Sep 12, 2026 5/10
skill GitHub
A read-only scanner for git configuration that would let a cloned repository execute code inside a coding agent, covering the GitSpawn class of issues and CVE-2026-45033. Works with Claude Code, Codex, Cursor and Copilot, with no dependencies, no network and no telemetry.
skillsecuritygitscannercve
by soemoescode Sep 12, 2026 7/10
skill GitHub
An Agent Skill for jobs that outlast a single turn: local queues, bounded logs, safe recovery after an interruption, and checks on the artifacts produced. Windows-first and built on the Python standard library.
skillwindowslong-runningqueuepython
by dhzyw Sep 12, 2026 6/10
skill GitHub
Competitive intelligence skills for AI agents covering landscape analysis, competitor dossiers, AI visibility reports, weekly briefings and battlecards. Powered by CompetLab and works with Claude Code, Cursor, Codex and Gemini CLI.
skillcompetitive-intelligenceresearchbusiness
by competlab Sep 12, 2026 5/10
skill GitHub
A curated index of HTML slide and presentation agent skills for Cursor, Claude Code and Codex, collecting the options for generating decks as HTML.
skillpresentationshtmlawesome-list
by nickylin Sep 12, 2026 5/10
skill GitHub
An Agent Skill for extracting the content of Douyin videos: L1 pulls metadata and the official chapter highlights, while L2 drives a browser to screenshot frames and OCR subtitles into a full transcript. Supports WorkBuddy, Claude Code and Codex, with pluggable browser and OCR backends.
skilldouyinvideoocrchinese
by 52Siriyue Sep 12, 2026 5/10
skill GitHub
A Rust-based skill and bundle giving a coding assistant fast web search, aimed at keeping lookups quick enough to use mid-task.
skillweb-searchrust
by rafaelpierre Sep 12, 2026 5/10
skill GitHub
A small set of Claude Code skills aimed at content creators: cut silence from video, normalize audio levels, and strip filler words. It turns common editing chores into agent-driven steps instead of manual timeline work. Handy if you record screencasts or podcasts alongside your coding work.
skillsvideoaudiocontent-creation
by AndersonAdelino Sep 12, 2026 6/10
skill GitHub
A skill package manager that installs specialist skills across multiple coding agents, shipping with sets for Java, JVM performance tuning, software architecture, and distributed systems. The cross-agent packaging means the same skills work beyond Claude Code. Worth a look for JVM teams who want deeper domain knowledge than a generic CLAUDE.md provides.
skillsjavajvmarchitecturepackage-manager
by robsonkades Sep 12, 2026 7/10
skill GitHub
An open-source Claude skill that drafts resumes scored against a 100-point rubric, with playbooks per candidate type and a strict no-fabrication rule. The scoring rubric is the interesting part — it gives the agent a concrete target instead of vague prose advice. A clean example of encoding an evaluation rubric into a skill.
skillresumerubricats
by saranya-sallagundla Sep 12, 2026 6/10
skill GitHub
A personal collection of agent skills covering code review, planning, testing, and general day-to-day development flow. Nothing exotic, but it is a compact reference for how to split routine dev tasks into discrete skills. Good starting point if you are assembling your own skill set.
skillscode-reviewplanningtesting
by nielsmadan Sep 12, 2026 5/10
skill GitHub
An agent skill for quantitative equity analysis across A-share, Hong Kong, and US markets, covering market data, valuation, financial queries, stock screening, factor computation, and strategy backtesting. Broader in scope than most finance skills, which usually stop at price lookups. Niche but a substantial example of a data-heavy skill.
skillquantfinancebacktestingscreening
by pseudo-longinus Sep 12, 2026 6/10
skill GitHub
A Claude skill that plans hotel stays by pulling listings through the Apify Google Hotels Search Scraper, then producing a ranked hotel-versus-rental comparison and an email-ready price table. Shows a straightforward pattern for wrapping a third-party scraper API in a skill. Off the core dev path, but a clean structural example.
skilltravelapifyscraping
by johnisanerd Sep 12, 2026 5/10
skill GitHub
A library of 63 thinking frameworks reduced to their working mechanism, each graded for evidence quality and made to produce a concrete artifact rather than a discussion. Ships with 4 tools and 9 recipes for Claude Code, Codex, and other agents. The honest evidence grading sets it apart from the usual prompt-pattern dumps.
skillsframeworksreasoningrecipes
by product-on-purpose Sep 12, 2026 7/10
skill GitHub
An MIT-licensed Claude skill that detects and removes the markers of machine-written Italian — English calques, nominal bureaucratese, missing intercalari and clitics. Ships 52 patterns, 15 hard bans and a dependency-free scanner.
writingitalianhumanizeropen-source
by ilyautov Sep 11, 2026 6/10
skill GitHub
An Apache-2.0 Agent Skill for long-form scholarly writing — monographs, textbooks, technical books and theses. Works in verifiable batches so an AI can resume the manuscript across sessions without fabricating citations or losing structure.
writingacademiclong-formskill
by newdeme Sep 11, 2026 6/10
skill GitHub
A library of 28 reusable SKILL.md files covering the full QA lifecycle plus Playwright test automation. Every skill produces a review-ready draft that a human confirms before anything ships. Portable across Claude Code, GitHub Copilot and similar assistants.
qatestingplaywrightskill-library
by Shivani26Singh Sep 11, 2026 6/10
skill GitHub
An Agent Skill that turns a complex feature request into a durable, actionable workplan on disk. Decisions and progress are preserved across sessions, so a new context window picks up where the last one stopped rather than re-deriving the plan.
planningpersistenceskillcontext
by bicccio Sep 11, 2026 7/10
skill GitHub
Claude Code skills, methods and raw materials for archival genealogical research on Ukrainian villages, developed for the Mistok project and released publicly. A concrete example of packaging domain research methodology as reusable skills.
researchgenealogyarchivesskill
by OuFinx Sep 11, 2026 5/10
skill GitHub
A small collection of Claude Code skills built around economy of context and tokens, including eco-mode for restrained working style and eco-analyze for cheaper analysis passes.
skillstokensefficiencycontext
by pooriaarab Sep 11, 2026 5/10
skill GitHub
An Agent Skill that assembles a dated working model of a person from authorized sources, keeping evidence and counterevidence side by side and producing a revisable personal operating manual. Built around explicit sourcing rather than vibes.
researchprofilingevidenceskill
by hraness Sep 11, 2026 5/10
skill Reddit
A port of Lauren Tan's pstack skills from Cursor to Claude Code, installable as a plugin marketplace. Includes unslop, which strips AI tells out of prose (em dashes, "not just X but Y", puffery), plus deslop pulled in from cursor-team-kit to do the same for code.
skillsportcursorwriting
by ivanrgazquez Sep 11, 2026 7/10
skill GitHub
Official Sugra API skills covering 1,500+ endpoints across 36 domains behind a single response envelope, available over HTTPS or MCP. Packaged for Claude, Grok, Codex, Cursor, Gemini and ChatGPT.
apiskillsmcpintegration
by Sugra-Systems Sep 11, 2026 5/10
skill GitHub
A skill that forces Claude Code and 13 other agents to open with a three-line TL;DR and fold the detail below instead of burying the answer mid-response. Cuts subagent and tool-output tokens on the principle of demote, don't delete — nothing is lost, it is just moved out of the way.
output-styletokensskillsubagents
by SurefireStudios Sep 11, 2026 6/10
skill GitHub
An Agent Skill that turns a repository you have never seen into something you can contribute to: it maps the architecture, traces real execution flows, and writes the result to docs/codebase-map/ so the work is reusable rather than trapped in one session.
onboardingdocumentationarchitectureskill
by rdilruba Sep 11, 2026 6/10
skill GitHub
A skill encoding senior-level engineering standards for AI coding agents, paired with an engineering log so decisions and their rationale accumulate across sessions instead of evaporating.
standardsengineering-logskillquality
by bikash-20 Sep 11, 2026 5/10
skill GitHub
One installable marketplace aggregating 194 Claude Code security skills from Trail of Bits, Masriyan and trilwu, organized around securing vibe-coded apps, sites and APIs.
securitymarketplaceskillsaudit
by gztes Sep 11, 2026 7/10
skill GitHub
A personal collection of skills for Claude Code and Claude Desktop covering developer workflows, automation and day-to-day productivity.
skillsproductivityautomationcollection
by mostafa-drz Sep 11, 2026 5/10
skill GitHub
Generates Spring Boot projects preconfigured for AI-assisted coding, shipping Claude Code skills, agents and hooks that enforce DDD boundaries, dependency direction and naming across domain, persistence, REST, messaging and tests.
spring-bootdddarchitecturehooks
by ice-lfernandes Sep 11, 2026 6/10
skill GitHub
A method plus self-installing Claude Code toolkit for research papers and grant proposals: argument skeleton first, citations verified, scans for retractions and uncited claims, document regression tests and submission checks. Code MIT, method CC BY 4.0.
academiccitationswritingtoolkit
by chenweichiang Sep 11, 2026 6/10
skill GitHub
Claude Code skills for SEO content: DataForSEO keyword research, one post format rendered to either WordPress or Next.js, and an on-page audit that blocks broken posts from shipping.
seocontentwordpressaudit
by christian259200 Sep 11, 2026 5/10
skill GitHub
An agent skill that plans an entire trip — flights, hotels and ground logistics — into a single total-cost itinerary, powered by the Apify Google Flights and Google Hotels scrapers.
travelskillapifyplanning
by johnisanerd Sep 11, 2026 5/10
skill GitHub
A set of professional skills aimed at the hard parts — nasty bugs, hard architectural decisions and reliable delivery — for Claude Code, Codex and other AI agents.
skillsdebuggingdecisionsdelivery
by simonasrazm Sep 11, 2026 5/10
skill GitHub
A Claude Code skill plus MCP server that convenes an advisory board of historical figures and verifies every quote word-for-word against public-domain sources, abstaining when it cannot. Fail-closed fidelity instead of plausible-sounding attribution.
mcpskillcitationsverification
by ilyautov Sep 11, 2026 6/10
skill GitHub
Compresses a journalism fact-checking handbook into a skill an agent can execute: a six-step process, a table of eight misinformation patterns, and quick-reference checks for images, video, geography and timestamps. Useful when you want an agent to verify claims methodically rather than guess. Documentation is in Chinese.
fact-checkingresearchverificationchinese
by shawn0818 Sep 11, 2026 5/10
skill GitHub
A downstream aggregation of agent skills pulled from multiple upstream repositories and kept current by automated ingestion. Useful as a single install point if you would rather not track a dozen skill repos by hand.
skillsaggregationsync
by harshsinghmp Sep 11, 2026 5/10
skill GitHub
A Claude Code skill that audits other skills for prompt injection, data exfiltration and privilege escalation before you install them. Given how much third-party skill code now runs with full tool access, this is the missing safety step in the install flow.
securityprompt-injectionskillsaudit
by ki-stuff Sep 11, 2026 8/10
skill GitHub
A skill that takes a video URL from Douyin, Bilibili, Xiaohongshu, Kuaishou and other platforms, downloads it, transcribes the audio — including Cantonese and other dialects — and strips filler words and repetition. Custom prompts then produce summaries, rewrites, pull-quotes or shot lists. Chinese-language docs.
videotranscriptioncontentchinese
by why20261 Sep 11, 2026 5/10
skill GitHub
Claude Code skills for debugging a Meta Conversions API integration after it is live — event deduplication, match quality, event taxonomy, and reconciling reported conversions against actual revenue. Narrow, but exactly the part that usually breaks.
marketinganalyticsmeta-capidebugging
by MadalaVijay Sep 11, 2026 5/10
skill GitHub
Claude skills for PxWebAPI v1 and v2, aimed primarily at Statistics Norway (SSB), with Jupyter notebooks and JavaScript examples. Useful to anyone pulling official statistics from a PxWeb-backed agency.
statisticsapinorwaydata
by janbrus Sep 11, 2026 5/10
skill GitHub
A SKILL.md pack for producing GB-standard Chinese government-style documents: docx generation, WPS PDF export, and coordinate-level verification that the rendered layout matches the standard. Claims compatibility across 70+ agents.
documentsdocxchineseformatting
by mazihua-lgtm Sep 11, 2026 5/10
skill GitHub
A large curated bundle of Claude Code skills, subagents and slash commands with sanitized configs and a Codex bridge, auto-indexed from the skills directory. Worth browsing for ideas even if you install none of it.
skillscollectionsubagentscommands
by shengdabai Sep 11, 2026 6/10
skill GitHub
Reviews an agent session for friction points, then routes each learning to where it belongs — user memory, project rules, a pull request against a skill, a checkpoint, or a harness artifact. Closes the loop between 'that went badly' and a durable fix.
retrospectivememoryself-improvementskills
by netresearch Sep 11, 2026 7/10
skill GitHub
Invokes Codex as a subagent from Claude Code with permissions declared per call — read-only analysis, or write-and-test confined to a git worktree — and returns an exit code reflecting what actually ran rather than what was requested.
codexsubagentsworktreepermissions
by Nowely Sep 11, 2026 7/10
skill GitHub
A Claude skill for producing distinctive, production-grade frontend interfaces, aimed squarely at the sameness of default agent-generated UI. Worth a look if every project you ship comes out looking like the same purple gradient.
frontenddesignuiskills
by czarnikrobert Sep 11, 2026 7/10
skill GitHub
An agent skill that assembles a one-page, ATS-parseable technical resume from your existing career notes and history files, rather than making you rewrite them into a template.
resumeatscareerdocuments
by baberarjumand Sep 11, 2026 5/10
skill GitHub
A SKILL.md for Liquid Glass and glassmorphism UI work, covering Apple's layering model, material tiers, accessible contrast ratios, and fallbacks for web, SwiftUI and mobile. The accessibility and fallback coverage is what separates it from a pile of CSS snippets.
uidesignglassmorphismaccessibility
by Armitanemati Sep 11, 2026 6/10
skill GitHub
Strips bureaucratic phrasing, filler openers and other tells of machine-written Russian text. A language-specific port of stop-slop, since the giveaways differ per language.
writinganti-sloprussianediting
by chipizubovdima Sep 11, 2026 5/10
skill GitHub
A Claude Code and Codex agent plus skills for picking an iOS app architecture, auditing an existing one, and running a refactor or migration between them. Opinionated guidance where agents usually default to whatever they saw most in training.
iosarchitecturerefactoringswift
by kbelasheuski Sep 11, 2026 6/10
skill GitHub
A full development-lifecycle skill library where a single orchestrator, dev-master, drives thirteen phases from an SRS as source of truth through design, implementation, testing, release audit and shipping. Installs on Claude Code, Codex and Cursor. Chinese-language docs.
sdlcorchestrationskillschinese
by iDWong Sep 11, 2026 6/10
skill GitHub
A bundle of skills that turns an agent into a QA partner: it plans a test pass, runs it, verifies the results, and keeps evidence logs it learns from on later runs. Project knowledge is compiled by an accompanying context tool rather than re-read from scratch each session. For teams who want repeatable, auditable QA instead of one-off 'does it work?' checks.
qatestingskillsverification
by TimothyHan Sep 11, 2026 7/10
skill GitHub
Packages ContHunt as an agent skill alongside its official CLI, letting a coding agent search and pull social content as research mid-session. The skill wraps the CLI so Claude Code calls it directly instead of you pasting links in. Useful when an agent needs to gather what people are actually saying about a topic before it writes.
researchskillclisocial
by Synthenova Sep 11, 2026 6/10
skill GitHub
One repo of shared agent configuration spanning Claude Code, Codex and Grok: portable instruction files and skills, specialist review agents, and launchers that keep multiple accounts safely separated. It also manages a fleet of WezTerm sessions and makes transcripts durable so work survives a closed pane. A useful reference if you run several agents across several accounts.
configdotfilesmulti-agentwezterm
by kauffj Sep 11, 2026 7/10
skill GitHub
A live Agent Skills provider for DeepSeek Harness that reads skills in place from wherever they already live — Claude Code, Codex, Cursor and 60+ other agents' skill directories, Claude Code plugin marketplaces, and arbitrary GitHub skill repos. No copying and no symlinks, so edits to a skill take effect immediately. Useful if you maintain one skill library across several agent tools.
skillsagent-skillsplugin-marketplaceinterop
by noteflowai Sep 11, 2026 6/10
skill GitHub
A Chinese-language skill for researching trends on Xiaohongshu (RED): spotting hot topics, summarizing trend signals, and deciding content direction. Aimed at content operators, brand researchers and creators rather than developers. Narrow in audience, but a clean example of a domain research skill.
skillxiaohongshutrendscontent-marketingchinese
by why20261 Sep 11, 2026 5/10
skill GitHub
A skill pack that turns Claude Code into a cycling coach by syncing training data from intervals.icu. It produces workout plans, post-ride reviews, recovery guidance, and race strategy. A good example of wiring a personal-data API into a domain skill set.
skillscyclingintervals-icutrainingdomain-skills
by Monikas1149 Sep 11, 2026 5/10
skill GitHub
A Claude configuration that turns the assistant into a research and underwriting teammate for institutional real-estate and multifamily teams. Installs by pasting a single setup block, MIT licensed. A clean example of packaging a vertical finance workflow as a drop-in Claude setup.
real-estateunderwritingfinanceverticalmit
by Fusion-Data-Company Sep 11, 2026 5/10
skill GitHub
A skill pack covering common Odoo development chores: reviewing addons, performing OCA version migrations, writing tests, and making OWL frontend changes. Encodes Odoo conventions so the agent doesn't have to rediscover them each session. Practical for shops maintaining many Odoo modules.
odooerpmigrationstestingskills
by Immoderate-humulin783 Sep 11, 2026 6/10
skill GitHub
Design discipline skills for Claude Code that state rules an agent can actually count and check — spacing, sizing, hierarchy — rather than vague aesthetic advice. Aimed at getting consistent, Apple-grade UI output from agents. Good complement to a component library.
designuiskillsdesign-systemfrontend
by shumatsumonobu Sep 11, 2026 6/10
skill GitHub
An agent skill for creative 3D visualization, shipping as a Claude Code and Codex plugin. It bundles 223 recipes, 440 knowledge records, 22 proven kits, and 37 runnable studies so the agent has concrete patterns rather than guessing at Three.js or Blender APIs. One of the more heavily researched skill packs around.
3dthreejsblendervisualizationpluginskills
by viettranx Sep 11, 2026 7/10
skill GitHub
An AI coding skill that applies Japanese monozukuri craftsmanship principles to software: build things that are simple, correct, verifiable, and maintainable. It gives the agent an explicit quality bar to check its own work against rather than optimizing for speed. A counterweight to output-volume-oriented prompting.
skillscode-qualitycraftsmanshipmaintainabilityreview
by kuya-egg Sep 11, 2026 6/10
skill GitHub
A Claude skill that takes HTML/CSS mockups, Figma exports, or plain UI screenshots and emits paste-ready Power Apps Canvas YAML (.pa.yaml v3.0). Removes the manual translation step between design and the Power Apps editor. Valuable if you build on the Microsoft low-code stack.
power-appslow-codefigmayamlmicrosoftskills
by YKUNAKORN Sep 11, 2026 6/10
skill GitHub
Agent skills covering Kotlin Multiplatform development end to end: clean architecture, feature scaffolding, Compose UI, MVI state management, navigation, networking, and testing. Gives the agent KMP-specific conventions instead of generic Kotlin advice. Worth comparing against other KMP skill packs before picking one.
kotlinkmpcomposemvimobileskills
by ronjunevaldoz Sep 11, 2026 6/10
skill GitHub
Installs a complete Power BI agent setup — Microsoft's official skills plus data-goblin's guardrails — into Claude Code, Copilot, Cursor, Codex, or Gemini with a single command. Works on Windows, macOS, and Linux. Saves assembling the BI toolchain by hand for each agent.
power-biinstallerskillsguardrailscross-agent
by Leonsang Sep 11, 2026 6/10
skill GitHub
A Claude skill where the model extracts invoice data and deterministic code then audits the arithmetic, so extraction errors are caught rather than trusted. Reports 0 false positives across 76 real invoices, and the audit pass found 2 mislabeled records in a public training dataset. A strong template for the extract-then-verify pattern in document work.
invoicesextractionverificationdocumentsskills
by Jessmatth Sep 11, 2026 7/10
skill GitHub
Agent skills for EU medical device regulation that are statute-pinned to specific legal text, ablation-measured, and source-verified. Notably, they define their own scope boundaries so the agent declines rather than improvising on regulatory questions it can't ground. A model for building trustworthy skills in high-stakes compliance domains.
complianceregulationmedicaleu-mdrskillsgrounding
by Ecgecer Sep 11, 2026 6/10
skill GitHub
A community skill that lets AI agents operate DeepSeek Harness — workspace and session control, task cards, and multi-model fanout review. Enables cross-harness orchestration where Claude Code drives DSH work. Not an official DeepSeek project.
dshdeepseekorchestrationcross-agentskills
by jacjackai Sep 11, 2026 5/10
skill GitHub
A Claude Code skill that records architectural and business decisions across all your projects and resurfaces them as precedent when a comparable choice comes up again. Aims to stop the agent from re-litigating settled questions differently in each repo. Effectively an ADR log the agent actually reads.
memoryarchitecturedecisionsadrcross-project
by asm0dey Sep 10, 2026 7/10
skill GitHub
A template for splitting an assistant's persona and background dossiers out of the always-loaded CLAUDE.md rules and into a skill that loads on demand. The pitch is "who we are" versus "what to do", so identity material stops eating context on every turn. Useful pattern if your rules file has grown into a grab bag.
personacontextclaude-mdtemplate
by rokokol Sep 10, 2026 5/10
skill GitHub
A copy-paste prompt that installs a skill in Claude Code or Cowork for generating images in a law firm's visual identity through Google's official Gemini API. Portuguese-language and squarely aimed at Brazilian legal practices. Narrow audience, but a clean example of packaging a branded image pipeline as an installable skill.
image-generationgeminilegalbrandingportuguese
by legalworkshop Sep 10, 2026 5/10
skill GitHub
A free MIT skill for generating and editing images with OpenAI's GPT Image 2 from inside Claude Code or Codex, with 21 style presets, per-platform sizing, carousels and photo edits. Drafts cost about $0.006 each so you iterate cheap and only pay full price for the render you approve. Requires an OpenAI API key.
image-generationopenaigpt-imagedesignskill
by dbhq-uk Sep 10, 2026 7/10
skill GitHub
A set of reusable agent skills and project baselines that install across Claude Code, Codex, and Copilot. Ships deterministic install and verify tooling so the same skill set can be reproduced on a new machine or checked for drift.
skillscross-platformcodexcopilottooling
by justinmchoi Sep 10, 2026 6/10
skill GitHub
A vendor plugin marketplace publishing Mobiscroll agent skills, covering the UI component library and the Connect calendar API. Gives the agent first-party API knowledge instead of relying on whatever it remembers about the framework.
marketplaceskillsui-componentsmobiscroll
by acidb Sep 10, 2026 5/10
skill GitHub
A full personal Claude Code configuration published as a reference setup: over 90 skills, 46 hooks, and supporting CLI tools wired together for professional development workflows. Worth reading as a worked example even if you only adopt pieces of it.
configurationskillshooksdotfiles
by tdimino Sep 10, 2026 7/10
skill GitHub
A free skill that lets Claude Code set up Flox-based development environments with pinned tool versions and local services on macOS and Linux. Built on affaan-m/ECC, aimed at making an environment reproducible rather than machine-specific.
floxdev-environmentreproducibilityskill
by agenticluke Sep 10, 2026 6/10
skill GitHub
A free collection of Claude Code and Cursor prompts aimed at experienced engineers — code review, debugging, plus CLAUDE.md and .cursorrules templates. Bundled with AIOS, an open-source markdown-based memory system for coding agents.
promptsclaude-mdmemorycode-reviewcursor
by sublimecoder Sep 10, 2026 6/10
skill GitHub
A Spanish-language skill set spanning the full lifecycle of a digital project: planning, building, critiquing the interface, governance, and pruning. Works with Claude Code, Codex, and other compatible agents.
skillslifecyclespanishgovernanceui-review
by bfernandois059 Sep 10, 2026 6/10
skill GitHub
An independent collection of agent skills covering game development, visual asset production, operations, and content workflows. A useful reference if you want skills outside the usual web and backend engineering territory.
skillsgame-developmentassetscontent
by Fable-Forge Sep 10, 2026 6/10
skill GitHub
An agent skill for working with Huawei Ascend compute servers: environment checks, troubleshooting, command generation, deployment guidance, and performance tuning. Cross-references the AscendMate manual so answers cite the vendor documentation.
ascendhuaweitroubleshootinginfrastructurechinese
by RevolutionLA Sep 10, 2026 5/10
skill GitHub
A structured three-role adversarial code review skill: a hostile blue-team pass, an independent third-party audit, then a neutral adjudication that resolves the two. Gives AI coding agents a closed review loop instead of a single self-assessing pass.
code-reviewadversarialmulti-agentquality-gatechinese
by RevolutionLA Sep 10, 2026 7/10
skill GitHub
A standard, packaged as a skill, for structuring Nix-flake-first Linux repositories so they install cleanly on distributions other than NixOS. Narrow in scope but concrete if Nix is part of your stack.
nixflakeslinuxpackagingstandard
by rokokol Sep 10, 2026 5/10
skill GitHub
A reverse-engineering project that reconstructs Claude Code's shipped bundle from its source maps into 1900+ files and roughly 510k lines, along with a runnable build. It ships a 12-chapter course walking through the architecture it found. Written in Chinese; of interest to anyone curious how the CLI is actually put together.
reverse-engineeringarchitectureinternalschinese
by Harzva Sep 10, 2026 6/10
skill GitHub
A skill whose job is converting other skills: hand it something written for Claude Code, Copilot CLI, Amp, Cursor or Cline and it rewrites it into Antigravity's format. Positioned as a universal transpiler rather than a one-way port. Handy if you maintain a skill library and a second agent host just entered the picture.
skillsantigravityportabilityconverter
by shaashiekumha Sep 10, 2026 6/10
skill GitHub
A skill that researches a curriculum for whatever you want to learn, then runs roughly 30-minute intuition-first sessions against it. It keeps a notebook of what actually clicked, so later sessions build on your real understanding rather than restarting cold. A study-habit tool rather than a coding tool.
learningtutorcurriculumnotes
by derwells Sep 10, 2026 6/10
skill GitHub
A hypothesis-driven audit skill that goes looking for exploitable business-logic flaws instead of walking a fixed vulnerability checklist. It forms guesses about how the domain could be abused and then tries to confirm them. Complements, rather than replaces, standard static analysis.
securityauditbusiness-logicadversarial
by chaoticravena Sep 10, 2026 6/10
skill GitHub
A Chinese-language skill pack covering university faculty work: teaching prep, research, student supervision, administrative tasks and assessment. It includes a custom Office output layer that produces native Word comments, courseware and grade analyses. Works with Claude Code, Codex and other Agent Skills clients.
educationofficechineseacademia
by EtherealMingo Sep 10, 2026 6/10
skill GitHub
A collection of workflow-oriented skills plus routing logic that decides which one applies to a given request. Positioned as shared infrastructure across coding agents rather than a single-purpose skill. Documentation is thin, so expect to read the repo to see what the routing actually does.
skillsroutingworkflow
by MarkBovee Sep 10, 2026 5/10
skill GitHub
Skills that pull structured data from search, e-commerce, social, finance, app stores, media and reviews through the Crawlora REST API. Installs via the skills CLI or as a Claude Code plugin marketplace. Requires a Crawlora account, so it is a paid-service wrapper rather than a standalone scraper.
web-datascrapingapimarketplace
by Crawlora-org Sep 10, 2026 6/10
skill GitHub
Detects points in a session where intellectual-property exposure is a risk and returns show/hold maps, demo hygiene guidance, AI contribution logs and a staged disclosure plan. Portable across Codex, Claude and Grok via agentskills.io. Explicitly not legal advice.
ipcompliancedisclosureportable
by Reghnam Sep 10, 2026 5/10
skill GitHub
A project-management skill covering requirements, risks, milestones, costs and daily/weekly reporting, all stored as markdown. The AI drafts and tracks, but state changes require human confirmation. Aimed at PMP-style rigor without a SaaS project tool.
project-managementmarkdownreportingpmo
by qiusuo0226 Sep 10, 2026 6/10
skill GitHub
A set of vibe-* skills, each one a structured instruction set for a specific moment in a project: plan it, build it, review it, test it, deploy it, hand it off. The value is coverage of the whole arc rather than any single skill. Read the individual skill files before adopting the whole set.
skillslifecycleplanningreviewdeploy
by aakashdhar Sep 10, 2026 6/10
skill GitHub
Takes photographs of paper surveys and forms and produces a validated Excel file, embedding the cropped image fragment next to any answer it was unsure about. That fragment-next-to-doubt design makes human verification cheap instead of forcing a full re-check. A genuinely well-shaped use of vision in a skill.
ocrformsexcelvisiondata-entry
by nadirbekpulatov-cyber Sep 10, 2026 7/10
skill GitHub
A prototyping toolkit and Agent Skill for working on actual HTML rather than mockups: build a page, annotate it, review, screenshot and iterate. Works with Claude Code, Codex and Cursor. The annotation layer is what lets you point at a region and describe the change you want.
htmlprototypinguiannotationscreenshots
by Lisuiwen Sep 10, 2026 6/10
skill GitHub
Covers Figma Plugin API gotchas, design process, design-system audits, variable repair and flow planning. Described as field-tested rather than generated, and the Plugin API notes in particular are the kind of thing that saves hours. Useful if your agent work touches Figma files.
figmadesign-systemsplugin-apiaudit
by schudarin Sep 10, 2026 6/10
skill GitHub
A zero-dependency HTML design system inspired by shadcn/ui, delivered as one file with no npm step, plus an agent skill that drives it. Ships six layout archetypes and an atomic utility set. Solves the problem of agent-generated HTML looking like unstyled markup without dragging in a build toolchain.
htmldesign-systemofflineshadcnzero-dependency
by QingYunA Sep 10, 2026 6/10
skill GitHub
A handoff skill that extracts what the next session actually needs — current state, decisions, open threads — instead of dumping the transcript. Keeps continuity across compaction and restarts without burning context on history. Simple idea, executed narrowly.
handoffcontextstatesessions
by benjaminstelzer Sep 10, 2026 6/10
skill GitHub
A curated handbook covering hooks, skills, CLAUDE.md templates, MCP servers and worked cases, written in Russian. Fills a real gap — most Claude Code documentation of this depth is English or Chinese only. Maintained rather than a one-off dump.
documentationrussianhooksskillsmcp
by sfrangulov Sep 10, 2026 6/10
skill GitHub
One developer's complete Claude Code setup: 33 skills, 16 slash commands, 13 review agents, 8 hooks and MCP wiring, organized around a TDD plus multi-tier-review workflow. Worth reading as a reference for how the pieces compose, even if you cherry-pick. The review-agent tiering is the distinctive part.
configskillshookstddreview
by louisdijkstra Sep 10, 2026 6/10
skill GitHub
A skill that inventories the whole repository first, then writes a README containing real commands and real output — and only the sections that repository actually needs. Ships a file inventory script and a README linter alongside. Directly targets the generic, half-invented README that agents usually produce.
readmedocumentationlintergithub
by rishabhrawat35 Sep 10, 2026 7/10
skill GitHub
Independently installable research skills covering scientific figures, conference and journal manuscripts, funding proposals, iterating a method toward SOTA, cold review, and code/data artifact release. Chinese and English. Broad coverage of the academic pipeline rather than a single writing helper.
researchacademiawritingfiguresreproducibility
by gxCaesar Sep 10, 2026 6/10
skill GitHub
Covers simplified-tax calculations, cash flow and counterparty verification by INN, pulling from real government registries. Numbers are computed in code rather than generated by the model, which matters for anything tax-adjacent. Narrow jurisdiction, but a good pattern for compute-not-guess skill design.
businesstaxrussiaregistries
by ilyautov Sep 10, 2026 5/10
skill GitHub
A unified skills repository including a CTO skill that turns an idea into an executable software design over one conversation, among others. Installs with a single command and targets Claude Code, Cursor, Cline and a dozen-plus other hosts. Chinese-language, actively maintained.
skillschineseinstallmulti-host
by yzfly Sep 10, 2026 6/10
skill GitHub
Three skills for unattended work: next-prompt hands a session off, night-sprint takes a feature through the night and lands it as one PR, and mywayfinder charts a map of the work. Includes a sliding 8-hour macOS caffeinate hook so the machine stays awake. Practical set for long autonomous runs.
unattendedhandoffovernightmacoshooks
by amit-mizrachi Sep 10, 2026 6/10
skill GitHub
Compares a rendered frontend against a reference image and returns an actionable per-region fix list: category, perceptual colour delta, the offending DOM element and CSS, and a fix hypothesis. Includes image strips, SSIM scoring and a convergence verdict so you know when to stop iterating. Far more rigorous than 'make it look like this screenshot'.
frontendpixel-perfectssimcssvision
by Filtar2000 Sep 10, 2026 8/10
skill GitHub
An SEO and generative-engine-optimization skill that works from Search Console data and pushes updates through IndexNow, structured for recurring rather than one-shot growth work. Runs under Codex or Claude Code. The evidence-led framing means it works from your actual search data instead of generic advice.
seogeosearch-consoleindexnow
by amanmaqsood Sep 10, 2026 5/10
skill GitHub
A Claude Code skill for auditing revenue, pricing, refund, and team billing questions with a proof-first approach — every answer is expected to cite the underlying record rather than be asserted. Built on the affaan-m/ECC skill base. Narrow in scope but a good template for making an agent show its work on financial data.
billingrevenueauditskill
by agenticluke Sep 10, 2026 5/10
skill GitHub
A community-driven repository of custom skills for Claude Code, collected in one place for browsing and installation. Open to contributions rather than curated by a single author. One of many skill marketplaces, but worth a look if you are shopping for ready-made skills.
skillsmarketplacecommunity
by RealDougEubanks Sep 10, 2026 5/10
skill GitHub
A set of Claude Code skills encoding Apple-style design discipline as rules an agent can actually check — spacing, hierarchy, and layout constraints expressed numerically rather than as taste. Aimed at stopping agents from producing generic-looking UI. Useful if your agent writes frontend code that keeps drifting off-system.
designuiskillsfrontend
by shumatsumonobu Sep 10, 2026 6/10
skill GitHub
A free Claude Code skill for creating and repairing reproducible Flox development environments on macOS and Linux. Built on the affaan-m/ECC skill base. Useful if you use Flox and want the agent to handle environment drift instead of you.
floxdev-environmentreproducibilityskill
by agenticluke Sep 10, 2026 5/10
skill GitHub
A personal ~/.claude/skills library of 123 on-demand skills built around progressive disclosure, so each skill loads detail only when needed. The author audits and prunes it with a "skill-stocktake" process rather than letting the collection sprawl. Worth browsing both for individual skills and for the maintenance approach to a large skill set.
skillsprogressive-disclosurecollectiondotfiles
by gesh75 Sep 10, 2026 6/10
skill GitHub
Indexes code and docs into a navigable encyclopedia — a repo map, per-module entries, and a typed link graph — so an agent can work in a huge codebase without loading it all into context. Ships as a single auto-routing skill with grounded, citation-checked analysis. Optional local semantic search runs through Ollama.
context-managementcodebase-indexskillollamasemantic-search
by maxgfr Sep 10, 2026 8/10
skill GitHub
A Claude Code skill that wraps fal.ai so you can produce images, video, speech, music, and sound effects from a session. Built on affaan-m/ECC and extended with additional models and options. Handy for adding media generation to a project without wiring up the API yourself.
skillfal-aimedia-generationimagesaudio
by agenticluke Sep 10, 2026 6/10
skill GitHub
A Claude Code skill that translates literary EPUBs into bilingual zh-TW editions, keeping the original text alongside the translation. It is aimed at literary prose rather than technical docs, so it preserves structure and voice across the book. A clear worked example of a skill handling a long, multi-chapter document pipeline.
skilltranslationepubchinesedocuments
by fredchu Sep 10, 2026 6/10
skill Reddit
A shared CLAUDE.md block aimed at three habits coding agents fall into unprompted: writing a duplicate of a function that already exists, solving problems outside the ticket, and narrating every diff line in comments. Covers DRY, single source of truth, YAGNI, KISS and comment policy, with a few Python/Pydantic-specific bullets. The thread collects other people's equivalent paragraphs.
claude-mdprompt-engineeringcode-qualitypython
by EvalRaccoonDev Sep 9, 2026 6/10
skill GitHub
Skill collection installable in Claude Code, Codex and Cursor covering an RPA BDD workflow, a Logika formal-logic skill based on Chelpanov, token-cost accounting, and a MikroTik router config generator. Niche mix, but the RPA and network-config skills are hard to find packaged elsewhere.
skillsrpanetworkingmarketplace
by EvilFreelancer Sep 9, 2026 5/10
skill GitHub
One SKILL.md per game, giving an AI agent the protocol for finding a table, joining, and actually playing against other participants. Starts with live Texas Hold'em poker. An unusual demonstration of skills as a way to teach an agent an external interactive system rather than a dev task.
skillsgamespokeragents
by appleweed Sep 9, 2026 6/10
skill GitHub
Chinese-language skill pack for social/new-media operators covering content production and data analysis, installable into Claude Code, OpenClaw, Cursor or any skills-capable agent. Useful example of skills applied to marketing operations rather than software.
skillsmarketinganalyticschinese
by Kaorixsol Sep 9, 2026 5/10
skill GitHub
One repo of a developer's harness configuration kept portable across three agents. Contains slash commands, hooks and skills meant to be cherry-picked rather than installed wholesale. Handy reference if you are assembling your own cross-agent setup.
skillshookscommandsdotfiles
by cboone Sep 9, 2026 5/10
skill GitHub
Two reusable Claude Code skills — one for producing matplotlib charts with consistent conventions, one for automating Google Sheets. Small and focused, useful as a template for writing your own data-oriented skills.
skillsmatplotlibgoogle-sheetsautomation
by Pirat83 Sep 9, 2026 5/10
skill GitHub
Chinese-language product-management skill library organized as 52 skills and 9 plugins mapped onto a single 13-stage process, from discovery through launch. Installs into Claude Code, Codex or Cursor. One of the more structured non-engineering skill sets published so far.
skillsproduct-managementpluginschinese
by iDWong Sep 9, 2026 6/10
skill GitHub
Skill that stops the classic on-chain scaling bug by reading and caching each ERC-20 token's decimals before converting values on EVM chains. Narrow, but the failure it prevents is expensive.
skillsweb3erc-20evm
by agenticluke Sep 9, 2026 5/10
skill GitHub
Skill collection organized around four jobs — evaluating models and outputs, building, scaling, and compressing context. Targets agents being run in production rather than casual local use.
skillsevaluationproductioncontext
by okyashgajjar Sep 9, 2026 5/10
skill GitHub
Agent skill that walks a web app through WebMCP adoption end to end: inventory what the app exposes, integrate the interface, verify it by driving a real browser, then heal what fails. Runs under Claude Code, Codex, Cursor, opencode and Copilot.
webmcpskillsbrowserverification
by TueJon Sep 9, 2026 7/10
skill Reddit
A user moved a working CLAUDE.md to AGENTS.md with a symlink back and reports Claude Code began ignoring rules it had previously followed, with a concrete formatting rule as the example. Relevant to anyone consolidating instruction files across agents; the comments weigh whether the symlink or the filename is the cause.
claude-mdagents-mdinstructionsdiscussion
by AllTalkie Sep 9, 2026 6/10
skill GitHub
One developer's full harness — skills, subagents, hooks and rules — for data work in Microsoft Fabric and Power BI on Windows, published to cherry-pick from. Rare example of an agent configuration tuned to the Microsoft data stack.
skillshookspower-biwindows
by wardawgmalvicious Sep 9, 2026 5/10
skill GitHub
Agent skill that pulls transcripts and playlist contents from YouTube locally without requiring an API key, so an agent can summarize or mine video content directly. Works with Claude Code, OpenClaw/ClawdBot, Hermes Agent, Cursor and Codex.
skillsyoutubetranscriptslocal-first
by mehmetresitgul Sep 9, 2026 6/10
skill GitHub
Agent skill for Chinese English-exam prep (Gaokao, CET-4/6, Kaoyan) that maps question types, classifies distractors into ten categories, and draws on a 125-card methodology library to output fully annotated, explained passages. A detailed example of encoding domain pedagogy as a skill.
skillseducationexamschinese
by shenquan520 Sep 9, 2026 5/10
skill GitHub
A Claude Code skill aimed at agents that run for a long time rather than one-off sessions, focused on safe updates, strict access boundaries, readable logs and fast recovery after failure. Built on top of affaan-m/ECC. Relevant if you run unattended or scheduled agent sessions.
skilllong-runningopsloggingrecovery
by agenticluke Sep 9, 2026 6/10
skill GitHub
A collection of skills, slash commands, subagents and plugins packaged as a "creator operating system" for content and AI-native workflows. Targets several harnesses at once — Claude Code, Codex, Cursor, Grok and Antigravity Gemini — so the assets are written to be portable rather than Claude-specific.
skillscommandspluginsmulti-harness
by frankxai Sep 9, 2026 5/10
skill GitHub
A large Claude Code bundle of 45 skills and 3 agents covering research, planning, shipping and verification across 13 different stacks. The sensor harness gives the agent feedback signals so it can check its own work rather than declaring done. Aimed at solo developers who want a full pipeline instead of assembling skills one at a time.
skillsagentsharnesssolo-dev
by fortunto2 Sep 9, 2026 7/10
skill GitHub
A zero-dependency Python CLI exposed as agent skills for media production: image generation, text-to-speech, voice cloning, subtitles, video, digital humans and Remotion rendering. Lets an agent handle a whole media pipeline without pulling in a heavy toolchain. Documentation is bilingual Chinese/English.
mediattsvideoremotion
by vecai-dev Sep 9, 2026 6/10
skill GitHub
A grab-bag toolkit meant to be dropped into any project: agent skills, coding rules, MCP servers, Git workflows, frontend utilities and TinyPNG image tooling. Useful as a starting kit if you keep re-creating the same conventions across repos.
toolkitmcprulesgit
by JUST-Limbo Sep 9, 2026 5/10
skill GitHub
An accessibility auditing skill built for big sites, using template-aware sampling so it checks representative pages instead of crawling everything. Accepted baselines let CI fail only on new regressions rather than the whole existing backlog. Produces evidence you can hand to a reviewer.
accessibilitya11yciaudit
by snapsynapse Sep 9, 2026 6/10
skill GitHub
A planning skill that first builds project context, then routes each request through the relevant checks before writing an implementation prompt with scope, risks, tests and rollback notes. Everything lives in Markdown so the plan is reviewable and diffable. Works with any coding agent.
planningspecmarkdownprompts
by emanoeI Sep 9, 2026 6/10
skill GitHub
Nine official skills that let Claude Code, Codex, Cursor or OpenClaw post and schedule to LinkedIn, X, Instagram, Threads, TikTok, YouTube, Facebook, Bluesky, Mastodon and Telegram through the Publora MCP server. Install with a single npx command. MIT licensed.
socialpublishingmcpscheduling
by publora Sep 9, 2026 6/10
skill GitHub
A plugin marketplace bundling Astro and general code tooling, a design system, and product development workflows. Installs as a Claude Code marketplace so you pick the pieces you want rather than cloning a monorepo. Handy if you work in the Astro ecosystem.
marketplaceastrodesign-systemplugins
by clownware Sep 9, 2026 5/10
skill GitHub
Pairs security guidance for coding agents with a Python scanner that looks for secrets, misconfiguration, injection flaws, dependency issues and AI-agent-specific risks. The guidance shapes what the agent writes; the scanner catches what slips through. Runs locally.
securityscannersecretsstatic-analysis
by PsylinksSecurityWeb Sep 9, 2026 6/10
skill GitHub
A Claude Code skill that applies SOLID principles to game code without the usual dogma, staying data-driven and aware of Unity, Unreal and Godot idioms. Recognizes that game code has different performance and architecture constraints than typical business software. Useful guardrail when an agent is refactoring gameplay systems.
gamessolidunityunrealgodot
by Jeffery-Liu Sep 9, 2026 6/10
skill GitHub
Converts teaching videos into documents complete enough to follow without watching the video, using a local engine built on whisper transcription, OCR and indexing. Blind-test and verification gates check that the doc actually reproduces the result. The output can be distilled further into a callable agent skill.
videowhisperocrdocumentation
by vinsunfeng Sep 9, 2026 6/10
skill GitHub
An agent skill that pulls content out of public share URLs — AI chat transcripts, social posts, media and open web pages — using a protocol-first approach rather than brittle scraping. Handy when you want an agent to read something someone linked you. Bilingual documentation.
extractionscrapingshare-linkscontent
by wuaishare Sep 9, 2026 5/10
skill GitHub
An agent skill that assesses the health of a company's knowledge assets entirely locally, with no LLM call in the analysis path. Suits environments where internal documentation cannot be sent to a model. Chinese-language documentation.
knowledge-baseauditlocalenterprise
by s2dongman Sep 9, 2026 5/10
skill GitHub
A skill pack that walks the whole lesson-prep chain for university teachers: timetable screenshot to teaching spreadsheet to lesson plan to lecture notes to slides with speaker notes, delivering xlsx, docx and pptx. Built for Claude Code and ZCode with deep adaptation to Chinese teaching conventions. MIT licensed.
educationdocumentspptxchinese
by ch1209498273 Sep 9, 2026 5/10
skill GitHub
Two skill families extracted from production use: agent operations and SEO operations. Installable as Claude Code plugins and usable from Codex or any Agent Skills runtime. Worth a look if you run SEO work through an agent.
seooperationspluginsskills
by scalably-io Sep 9, 2026 5/10
skill GitHub
Covers motion, colour, type, layout, sheets, haptics, sound, buttons, icons, copy, states, onboarding, paywalls, widgets and accessibility, split into a SwiftUI skill and a React/TypeScript/CSS one. Designed to raise an app's finish without imposing one house style. Works across Claude Code, Cursor, Codex, Windsurf, Aider, Continue and Zed.
designuiswiftuireactpolish
by heyimjames Sep 9, 2026 7/10
skill GitHub
Fetches schedules and documents from TenderNed and Mercell, sharpens clarification questions, and converts tender documents to Markdown so an agent can work with them. A concrete example of packaging a domain-specific bureaucratic workflow as skills. Dutch-language.
tendersprocurementdutchdocuments
by martinwolve Sep 9, 2026 5/10
skill GitHub
A Claude Code plugin that walks through deploying OpenClaw to Azure Container Apps with Telegram and LiteLLM, including a persistence wizard. Bakes in the Azure Files, BuildKit and IPv6 gotchas that usually cost you an afternoon. Narrow but saves real time if that is your stack.
azuredeploymentopenclawcontainers
by suresh-deccansoft Sep 9, 2026 5/10
skill GitHub
A Claude Code plugin that produces a kill shot, three ranked attacks, a probability that you are making a mistake, and a forced verdict on a decision. Deliberately simpler and harsher than multi-model council setups. Meant to be run before you commit to an approach, not after.
decision-makingadversarialreviewplanning
by hadicancatak-coder Sep 9, 2026 6/10
skill GitHub
A Claude Code plugin with stock analysis and portfolio management skills aimed at retail investors. Packages the research and tracking steps rather than making recommendations. Niche relative to coding work but a clean example of a domain skill pack.
financestocksportfolioanalysis
by from68 Sep 9, 2026 5/10
skill GitHub
Generates candidate names for a startup, product or side project and then verifies each one against the domain registry, trademark databases, GitHub, npm, app stores and search results. The verification step is what separates it from asking a model for name ideas. Works with Claude Code, Cursor, Codex and around 75 other agents.
namingdomainstrademarkvalidation
by me-shaon Sep 9, 2026 6/10
skill GitHub
An agent skill that enforces an ordering for complex work: research before asking questions, ask before planning, plan before building, verify before delivering, and get an independent review before calling it done. Plain text with no runtime to install. A discipline layer rather than a tool.
planningverificationreviewprocess
by Da7-Tech Sep 9, 2026 6/10
skill GitHub
A free Claude Code skill for email triage: sorting incoming mail, writing drafts, sending with guardrails, and checking Sent afterwards to confirm what actually went out. Built on the ECC tool suite. The verification step is a sensible touch for anything that sends on your behalf.
emailautomationdraftsecc
by agenticluke Sep 9, 2026 5/10
skill GitHub
A Claude skill that summarizes public Telegram channels with no API token and no login required. Removes the usual bot-registration step for read-only monitoring. Available in both English and Russian.
telegramdigestmonitoringno-auth
by tatianahub Sep 9, 2026 6/10
skill GitHub
A personal collection of Claude Code plugins covering planning, brainstorming, reviewing, git workflow and Go tooling. Small and opinionated rather than comprehensive. Worth browsing for ideas if you are assembling your own plugin set.
pluginsplanninggitgolang
by parMaster Sep 9, 2026 5/10
skill GitHub
An open library of pentest, bug bounty and defensive security skills spanning web, API, cloud, AI/LLM, Active Directory, mobile and more, loaded on trigger so they do not all sit in context. Loads into Claude Code, Codex, Gemini or a local model. One of the larger security skill collections available.
securitypentestbug-bountyskills
by NoorQureshi Sep 9, 2026 7/10
skill GitHub
Skills that help a project adopt spec-driven development, backed by product memory documents that persist across sessions. Aims at teams whose specs otherwise live only in a chat log. Agent-agnostic.
spec-drivenmemorydocumentationprocess
by itsjavi Sep 9, 2026 5/10
skill GitHub
Skills for small-business document work: building fillable PDF forms, sending contracts for electronic signature, verifying signers with BankID or an ID scan, and tracking status after sending. Reachable over MCP from Claude, ChatGPT, Codex, Cursor and around 25 other agents. Identity verification is a notable inclusion.
e-signaturepdfdocumentsmcpbankid
by formify-e-sign Sep 9, 2026 5/10
skill GitHub
Three routed skills for games and consumer interactive apps covering in-session reward moments, lifecycle retention cohorts, and the link between the two. Packaged as a Claude Code plugin with routing so the right skill loads for the question asked. Product rather than engineering focused.
gamesretentionengagementproduct
by ajitta Sep 9, 2026 5/10
skill GitHub
A Claude skill pack that takes a stated goal to a deployed ElevenLabs voice agent, with base configuration derived from roughly 30,000 production calls. The call volume behind the defaults is what makes it more than a template. Covers the build method, not just the config.
voiceelevenlabsagentsdeployment
by callflows Sep 9, 2026 6/10
skill GitHub
An 80/20 launch audit skill that probes your app the way a senior developer would and produces evidence for each failure rather than a generic checklist. The audit logic is open source under MIT, with paid hosted audits offered separately. Aimed at the pre-launch pass over a shipped app.
skillauditlaunchqa
by Fusion-Data-Company Sep 9, 2026 5/10
skill GitHub
A lightweight skill that picks which model to route a task to, suggests a reasoning effort level, and verifies review output across Claude, Codex, and Astra. It targets the common problem of spending a heavy model on work a cheaper one handles fine. Deliberately minimal compared to full orchestration harnesses.
skillmodel-routingeffortcost
by nyldn Sep 9, 2026 6/10
skill GitHub
A free collection of 48 Claude marketing skills spanning Google Ads, Meta Ads, SEO, and AI visibility work. It also ships a hosted Ryze MCP connector over HTTP so the skills can pull live data instead of working from pasted numbers. The MCP dependency is vendor-hosted, so check that before adopting.
skillmarketingseoadsmcp
by irinabuht12-oss Sep 9, 2026 6/10
skill GitHub
A proposed standard directory layout for .claude/, covering where skills, commands, agents, and config should live. The value is consistency across repos and teams so agents and humans can find things in the same place every time. Small in scope but addresses real drift as .claude directories grow.
skillconventionproject-structureclaude-md
by nhhthong Sep 9, 2026 6/10
skill GitHub
A Claude Code skill for writing image and animation prompts on the premise that piling on adjectives creates slop rather than fixing it. It enforces a structure: name the subject, fix the lighting, restrict the medium, and state what the image is not. Practical for anyone driving image models from inside their editor.
skillpromptingimage-generationanimation
by Pr1m4lc0d3 Sep 9, 2026 6/10
skill GitHub
A literature research skill that runs the full chain from a research question to a ranked table: keyword extraction, Google Scholar search driven over Chrome DevTools Protocol, automatic annotation, then xlsx export. The CDP approach means it drives a real browser rather than depending on an API key. Handy for lit reviews that end in a spreadsheet.
skillresearchgoogle-scholarcdpexport
by CookieMoonPie Sep 9, 2026 7/10
skill GitHub
A Claude Code skill that acts as a front end to the Everything Claude Code (ECC) collection, letting you search the catalog, pick parts, install them, and reset back to a clean state. It removes the manual step of browsing the ECC repo and copying files by hand. Credits the original affaan-m/ECC project as the upstream source.
skillinstallereverything-claude-codecatalog
by agenticluke Sep 9, 2026 6/10
skill GitHub
An Operator Pass API skill that exposes the JMC go-to-market tool suite to Claude Code, including a cold-email linter, EVP generator, pipeline calculator, GEO visibility audit, and competitive teardown. It is designed for cross-runtime agent use rather than a single client. Requires your own Operator Pass API key.
skillapigo-to-marketsales
by JMC-Go-to-market Sep 9, 2026 5/10
skill GitHub
A Claude Code skill that treats pricing as the highest-leverage B2B lever and walks through a fixed sequence: diagnose willingness-to-pay, choose the value metric, set a reference frame, build a three-tier contrast set, and close discount leaks. Useful if you want structured pricing analysis rather than ad-hoc prompting. Niche outside of founders and product marketers.
skillpricingb2bstrategy
by cmj-hub Sep 9, 2026 5/10
skill GitHub
A writing skill that generates founder-brand content on a Pillar, Proof, Process, Person rotation in the founder own voice. It explicitly refuses thought-leader cadence, engagement bait, and AI-detection filler, which is the main differentiator from generic content prompts. Aimed at solo founders maintaining a posting habit.
skillcontentbrandingwriting
by cmj-hub Sep 9, 2026 5/10
skill GitHub
A cold email skill that enforces four jobs in under 90 words: a verbatim public signal, the pain that signal implies, a 22-word early value proposition, and a binary ask. It rejects demographic targeting as a substitute for a real signal. The tight word budget makes output easy to review.
skillcold-emailoutboundcopywriting
by cmj-hub Sep 9, 2026 5/10
skill GitHub
A skill that writes Early Value Propositions capped at 22 words and matched to a Schwartz awareness tier, producing five different lines for the same product. The premise is that an unaware buyer and a vendor-comparing buyer need different framing. Pairs naturally with the same author cold email skill.
skillpositioningcopywritingmarketing
by cmj-hub Sep 9, 2026 5/10
skill GitHub
A PT-BR marketplace bundling six Claude Code plugins: hefesto (a plugin forge), odin (double-diamond product design), hermes (marketing), bragir (brand voice), mimyr (course building), and hestia (finances). Everything is written in Brazilian Portuguese. Useful if you want ready-made business-oriented plugins or a template for shipping your own marketplace.
pluginsmarketplacept-brskills
by sallzzbr Sep 9, 2026 5/10
skill GitHub
A skill collection that queries Taiwanese government open data for everyday questions — no login and no API keys required. Covers common daily-life lookups against official public datasets. A good reference for building region-specific skills on top of free public APIs.
skillsopen-datataiwanapi
by tahodev Sep 9, 2026 5/10
skill GitHub
A curated set of agent skills aimed at backend and platform work, installable either as a Claude Code plugin or via `npx skills@latest add joshfng/skills`. Covers the kind of infrastructure and service-side tasks most general skill packs skip. Handy if your day job is closer to ops than to frontend.
skillsbackendplatformplugin
by joshfng Sep 9, 2026 6/10
skill GitHub
An agent skill that translates manga, manhwa, manhua, and Western comics into Persian with pixel-accurate speech-balloon detection and real right-to-left Persian typesetting. It also produces evidence that the original artwork was left untouched during the process. A strong example of a vision-heavy skill with verifiable output guarantees.
skillstranslationpersiancomicsrtl
by KiaroSama Sep 9, 2026 6/10
skill GitHub
An open collection of agent skills covering marketing, advertising, and creative production, installable with `npx skills add popjam-io/skills`. Aimed at non-engineering workflows that still run through a coding agent. Reasonable starting point if you want marketing tasks handled without writing the prompts yourself.
skillsmarketingadscreative
by popjam-io Sep 9, 2026 5/10
skill GitHub
Free Claude Code skill for safe C# and .NET apps with DI, async, EF Core, APIs, and tests. Built on affaan-m/ECC by @affaan-m.
skillapi
by agenticluke Sep 8, 2026 8/10
skill GitHub
Estándar de calidad para Claude Code, en español y medido: núcleo de reglas + 9 skills + estándar de estructura de proyectos (specs por feature) + council de evaluadores independientes + contrato d...
skill
by chemaw8 Sep 8, 2026 8/10
skill GitHub
Ten Agent Skills from fifteen years of performance marketing and the systems built around it: CPA profit maths, affiliate tracking, lead reconciliation, competitor ad scoring, incrementality testin...
skilltesting
by Hiberius Sep 8, 2026 6/10
skill GitHub
Portable Agent Skills for Codex, Claude Code, and other LLM runtimes.
skill
by andyconley Sep 8, 2026 9/10
skill GitHub
😅💵⚠️ AI "赛博功德"结算 skill:把今天烧掉的 token 俏皮换算成"功德"让你尴尬一笑、释然收尾——数据接 tokens.ci(三级降级),句尾永远是 NEVERMIND。不是账单工具,是对钱苦笑一下再放下。
skill
by Barinfo Sep 8, 2026 5/10
skill GitHub
Agent skill suite for continuous refactoring a code base
skill
by Art4 Sep 8, 2026 6/10
skill GitHub
Revayat Novel — an agent skill that translates a whole book into publication-quality Persian and builds a professional Word file: OCR for scanned and mixed PDFs, illustrations at original size, Wor...
skill
by KiaroSama Sep 8, 2026 6/10
skill GitHub
This is a set of documentation both for the user and the agent; an information corpus, a skill library, and agent relay protocol for working with multiple agents.
skill
by AN0099 Sep 8, 2026 6/10
skill GitHub
A Claude Code / agent authoring skill for Carve markup
skill
by markup-carve Sep 8, 2026 9/10
skill GitHub
Agent skill for the checks that pass while the thing is broken. Seven false-green signals with fixes, plus three dependency-free tools: an occlusion-aware screenshot guard, a live-system enumerator...
skill
by toharyona2002 Sep 8, 2026 6/10
skill GitHub
Agent skill that strips AI tells from prose and puts a human voice back, pitched at the reader it is for. British English by default. Works in Claude Code, Codex and any agent the Skills CLI reache...
skill
by dbhq-uk Sep 8, 2026 9/10
skill GitHub
Claude/agent skill: build a marketing agency database from any Clutch.co directory as JSON, powered by the Clutch.co Agency API on Apify.
skillapi
by johnisanerd Sep 8, 2026 7/10
skill GitHub
Claude/agent skill: pull structured B2B company data from Clutch.co as JSON, powered by the Clutch.co Agency API on Apify.
skillapi
by johnisanerd Sep 8, 2026 7/10
skill GitHub
Personal Claude Code toolkit: portable coding conventions, gate-based code review, CLAUDE.md audits, and verification skills
skillclaude.mdreview
by kcsujeet Sep 8, 2026 10/10
skill GitHub
Free Claude Code skill to build design systems with tokens, themes, Figma, Storybook, and access checks. Built on affaan-m/ECC.
skill
by agenticluke Sep 8, 2026 8/10
skill GitHub
Open source Agent Skills for Claude Code and Cowork — writing, web, social, and chief-of-staff bundles (12 skills).
skill
by mrhinkle Sep 8, 2026 9/10
skill GitHub
Exchange-grade crypto marketing playbooks from NorthPoint. Install with npx skills add jukkablomberg/northpoint.
skill
by jukkablomberg Sep 8, 2026 5/10
skill GitHub
18 methods and local tools for Codex and Claude Code, with runnable examples, reversible installation and inspectable comparisons.
skill
by Christian-Katzmann Sep 8, 2026 8/10
skill GitHub
Source-verified knowledge base of the Python quantitative-finance ecosystem, packaged as Agent Skills. Every claim dated and marked verified/secondhand/unverified.
skillpython
by howard-lynn-ye Sep 8, 2026 6/10
skill GitHub
Claude agent skill: pull live SAP SuccessFactors job postings to a structured feed via the Apify SuccessFactors Jobs API.
skillapi
by johnisanerd Sep 8, 2026 7/10
skill GitHub
Evidence-backed engineering backlog discovery skill for Claude Code, Codex CLI and Grok Build — find real work in any repo, not busywork. 裝忙 Skills
skill
by ImL1s Sep 8, 2026 8/10
skill GitHub
🧑🚀 The role layer for aerospace engineering agents — 38 roles binding 597 Aero Agent Skills across 12 domains, verified by 1519 offline tests, gated on 27 standards. Every role ends at the human s...
skill
by ashfordeOU Sep 8, 2026 6/10
skill GitHub
A 19-point security audit skill for Claude Code to scan repositories for secrets, OWASP risks, and vulnerabilities.
skill
by alimansoor2003 Sep 8, 2026 8/10
skill GitHub
Skills para Claude (Claude Code e claude.ai): leitura acadêmica, científica e literária — fichamento (Severino), três passadas (Keshav), letramento literário (Cosson).
skill
by vaniago Sep 8, 2026 8/10
skill GitHub
User-shaped agent skills. Unvarnished humanizes prose by register and voice with a bounded feedback learning loop. Peer Production License.
skill
by pnmcguire480 Sep 8, 2026 6/10
skill GitHub
AI-agent operating system for Blender 5.2: skills, verified bpy knowledge base, AGENT_OK/AGENT_FAIL execution contract, production gate for 3D-printable parts, robot-arm demo
skill
by jangtrinh Sep 8, 2026 6/10
skill GitHub
Working Claude Code skills for CPG operators — vendor diligence, deductions, ops math. By ShelfKit.
skill
by BorisGearKit Sep 8, 2026 8/10
skill GitHub
Profissional de Tráfego Pago desde 2015. Aqui compartilho skills de Claude Code que uso no meu dia a dia pra ajudar não programadores como eu. Testadas só no Windows e na minha realidade de uso: av...
skill
by tiagomouraferraz Sep 8, 2026 8/10
skill GitHub
Claude Code and Codex SKILLs for PDF, Excel, Word, and PowerPoint manipulation — extraction, forms, formulas, tracked changes, adapted from Anthropic skills.
skill
by appautomaton Sep 8, 2026 9/10
skill GitHub
Hermes Skills: 视频转文字 / AI文案去味 / 文档OCR / 电商素材工坊 (Video-to-text, AI text de-humanizer, OCR, E-commerce Material Studio)
skill
by jiawood2006 Sep 8, 2026 5/10
skill GitHub
Claude Code skill: independent peer review of your specs and plans by Codex, Gemini, and open-weight models (DeepSeek, Kimi) via Fireworks
skillreview
by craigstoller Sep 8, 2026 8/10
skill GitHub
Personal agent skills for software development, concurrent Git workflows, fleet CI, web interfaces, and Linux homelab operations. Maintained forks with recorded provenance.
skillworkflowgit
by bolens Sep 8, 2026 6/10
skill GitHub
A skill that turns a written recipe into an execution-order cooking timeline.
skill
by tiny-glitch Sep 8, 2026 5/10
skill GitHub
Typed memory, search, and gates for AI-agent workspaces. Scaffold plain-Markdown project memory, state, skills, and review gates in one command.
skillcommandreview
by vivary-dev Sep 8, 2026 6/10
skill GitHub
Spec-driven backlog for Claude Code where the backlog is git data: tickets as YAML frontmatter in spec files, per-ticket model/effort/review dosing, lifecycle hooks on the git flow, fresh-context r...
hookgitreview
by giboulz Sep 8, 2026 8/10
skill GitHub
台灣公務國外出差旅費自動計算 — Claude Code skill for Taiwan government overseas travel per diem (國外出差旅費報支要點, 2026 rules)
skill
by chichiihc2 Sep 8, 2026 8/10
skill GitHub
Claude Code skill (+ cgc CLI) that turns your logged-in ChatGPT Pro tab into a background coprocessor: planning, hard reasoning, and file-cited code review. Drives the web app you already pay for —...
skillapireview
by fitz-s Sep 8, 2026 8/10
skill GitHub
南京邮电大学行政事务 AI 助手 · SKILL.md 通用格式 · 查政策、问流程、盯待办 · 适配 Kimi / Claude / Cursor
skill
by Ian508 Sep 8, 2026 6/10
skill Reddit
My claude website are looking so much vibe coded(cause they are) recently. But I have seen some people make mesmerizing websites through it. And ig its because of the skills they're using. I want m...
skill
by Able_Elderberry_3786 Sep 8, 2026 6/10
skill GitHub
General-purpose Claude Code skills: a design-to-build workflow (grill-me, design-brief, information-architecture, design-tokens, brief-to-tasks, frontend-design, design-review) plus token-saver and...
skillworkflowreview
by DanielNoamTuby Sep 8, 2026 8/10
skill GitHub
CLI and shared catalog for initializing repos with skills, rules, and instructions across multiple agentic coding platforms.
skill
by pedromvgomes Sep 8, 2026 6/10
skill GitHub
skill-autodl-auto-sync
skill
by 1zqqx Sep 8, 2026 5/10
skill GitHub
微信公众号 AI 运营助手 | 选题、写稿、审稿、排版、配图、发布全流程 Skill,支持 OpenClaw / Claude Code / Cursor / Codex
skill
by aiworkskills Sep 8, 2026 8/10
skill GitHub
Markdown to WeChat CLI | 一键排版发布到微信公众号:支持 40+ 排版样式和专业主题 、AI 配图 、批量发布 、多账号管理
skill
by geekjourneyx Sep 8, 2026 5/10
skill GitHub
ACS (Agnostic Config Suites) — AI coding agent skill system. 25+ auto-activating skills for Claude Code, Hermes, Kiro, Codex. Spec-driven dev, TDD, security review, architecture blueprints. One ins...
skillconfigreview
by andyvandaric Sep 8, 2026 10/10
skill GitHub
Host-neutral multi-agent orchestrator protocol, zero-slug role templates, and playbooks for autonomous developer agents.
skill
by poorvith-mp Sep 8, 2026 6/10
skill GitHub
Index of 277 verified AI agent skills across 12 focused categories for Claude Code, Cursor, Codex, and Gemini CLI.
skill
by poorvith-mp Sep 8, 2026 9/10
skill GitHub
A Claude Code skill that reviews Linux kernel patches using Sashiko's review protocol, run in-session. Companion to sashiko-dev/sashiko, not a replacement.
skillreview
by shardulsdk-mpiric Sep 8, 2026 8/10
skill GitHub
PRD, design, and PLAN/RUN graph orchestration for any coding agent (Codex, Claude Code, Pi, or generic), with runtime re-orchestration, project-level skill bindings, and a preview/production deploy...
skillreview
by Phlegonlabs Sep 8, 2026 9/10
skill GitHub
TestDino Playwright Skill: AI-powered guides for Playwright best practices, made by testdino.com.
skill
by testdino-hq Sep 8, 2026 5/10
skill GitHub
Self-contained Claude Code skill toolkit for daily code maintenance: refactor, dedup, DB tune, doc organize, Vue review, tool bootstrap, self-evolve.
skillreview
by ebziw Sep 8, 2026 8/10
skill GitHub
Claude Code / Codex skill for local-first meeting transcription. Runs Whisper on your own machine across macOS, Windows and Linux, filters the segments Whisper invents over silence, and writes the ...
skillapi
by kevin-burns Sep 8, 2026 8/10
skill GitHub
Agent skills for makers and design engineers
skill
by planetabhi Sep 8, 2026 6/10
skill GitHub
🎿 A package manager for agent skills, with a lockfile and a security scan.
skill
by osrim Sep 8, 2026 6/10
skill GitHub
Curated list of 150+ tools, skills, subagents & plugins for OpenAI Codex CLI
skill
by RoggeOhta Sep 8, 2026 6/10
skill GitHub
Self-hosted control plane that makes AI coding agents disposable by making their context durable — one source of truth for instructions, memory, and skills, served to any harness on any machine.
skill
by agentic-substrate Sep 8, 2026 6/10
skill GitHub
1,119 design fundamentals, each checked against a named primary source and labelled core, adjacent or cut. Offline site plus a skill for Claude Code, Codex and Cursor.
skill
by GoodLadTom Sep 8, 2026 8/10
skill GitHub
A Claude Code skill that distills Claude's last reply into plain English and answers every decision it's waiting on, with each suggestion verified by a fresh-context Sonnet critic.
skill
by damsavage Sep 8, 2026 10/10
skill GitHub
中文生产力 Agent 技能包:小红书/公众号/抖音口播/简历/周报/会议纪要
skill
by LLL-178 Sep 8, 2026 6/10
skill GitHub
A curated list of Agent Skills for SEO. Technical audits, keyword research, content briefs, schema, GEO and AI visibility, for Claude Code, Codex, Cursor and OpenClaw.
skill
by RankSpotAI Sep 8, 2026 9/10
skill GitHub
Claude skill that picks the right chart for the story (nine-family framework) + a 62-chart matplotlib example gallery
skill
by eforus-overseer Sep 8, 2026 6/10
skill GitHub
Claude Code plugin: 5 agentes de revisión de código (seguridad, calidad, convenciones frontend, esquema BD, testing) + skill de arquitectura multi-tenant para SaaS, derivada de una auditoría real q...
skilltesting
by fernando-delrio Sep 8, 2026 9/10
skill GitHub
An open, signed report format for whether an agent plugin, hook, skill, or AGENTS.md actually works.
skillhook
by open-coder-ai Sep 8, 2026 8/10
skill GitHub
SKILL FOR MAKE GAMES WEB BASED
skill
by bufatechno Sep 8, 2026 5/10
skill GitHub
A Claude Code skill that pulls a YouTube video down into structured Markdown, including full metadata, chapter breakdown, and transcript. Output is formatted for an Obsidian vault, so research and talk notes land straight in your knowledge base. Useful for anyone who takes notes from conference talks or tutorials.
skillyoutubeobsidianmarkdowntranscripts
by JimmySadek Sep 5, 2026 7/10
skill GitHub
A skill pack covering the review side of the loop: scope, grade, structurize, simplify, harden, clean up, and audit, plus a skill that leaves concerns flagged inline for teammates. Each is a distinct pass rather than one catch-all "review my code" prompt. Good fit if your agent ships fast and your review discipline needs to keep up.
skillscode-qualitycode-reviewrefactoringaudit
by LinardsLiepenieks Sep 5, 2026 8/10
skill GitHub
A Claude Code plugin marketplace bundling disciplined Python and data-engineering practice as reusable skills, alongside workflows for capturing knowledge from a session. The framing is craft rules rather than one-off prompts. Relevant if your data pipelines need the agent to follow house standards.
marketplacepluginsskillspythondata-engineering
by grimaldost Sep 5, 2026 7/10
skill GitHub
A skill set that reframes agent work around customer impact instead of diffs, plus a zero-dependency check that enforces a "For-the-customer" block in commit messages and PR descriptions. The check is the interesting part — it makes the product rationale a required artifact. Good for teams where agent PRs arrive without any stated why.
skillsproductcommitspull-requestsprocess
by Bubblegunn Sep 5, 2026 6/10
skill GitHub
A skill bundle aimed outside the editor: studying, building presentations, customer service replies, handing work off to a browser, and privacy hygiene. Written to be portable across assistants rather than tied to one harness. Modest in scope, but a decent starting point for non-engineering skill authoring.
skillsproductivityprivacypresentationsnon-coding
by Williamunpalatable7706 Sep 5, 2026 5/10
skill GitHub
A pair of review skills for coding agents that check changes against explicit written policy rather than generic taste. Works on uncommitted local changes and on GitHub pull requests, so the same rules apply before and after you push.
code-reviewskillgithubpolicy
by amirbena Sep 5, 2026 6/10
skill Reddit
A CLAUDE.md rule that fixes Opus 5 verbosity by shaping it instead of shortening it: every issue, fix or plan step is explained as root cause (file:line), what changes and why, then the before/after from the user's side. Predictable structure makes long output skimmable, and the user-experience section surfaces invisible wins like crashes that no longer happen.
claude-mdverbositypromptingopus-5
by BullfrogRoyal7422 Sep 5, 2026 6/10
skill GitHub
A collection of ready-to-use Agent Skills written as SKILL.md files, portable across Claude Code, Codex, Cursor, OpenCode and Devin. Coverage includes building MCP servers, code review, draw.io architecture diagrams, Composio, NotebookLM and SonarQube.
skillscollectionportableskill-md
by afonsoft Sep 5, 2026 7/10
skill Reddit
Two skills built out of a specific annoyance: agents writing piles of pointless tests. One checks test quality on the premise that a solid test beats ten flaky ones, the other refactors an existing test mess. The author benchmarked the checker against known good and bad tests and tightened it until it stopped being forgiving.
testingskillrefactoringbenchmark
by haukebr Sep 5, 2026 7/10
skill GitHub
A reviewer persona that grounds every objection in the repository's actual past — each complaint cites the commit hash where that mistake was made before. Ships as a plugin for 14 coding agents plus a write gate, a GitHub Action and a benchmark, so you can check the persona actually catches things.
code-reviewpersonagit-historyplugingithub-action
by lazy-senior-dev Sep 5, 2026 7/10
skill GitHub
A review persona focused on the operational surface a code reviewer usually skips: resource limits, liveness and readiness probes, rollout strategy, rollback path and alerting. Distributed as a plugin for 14 coding agents with a write gate, a GitHub Action and a benchmark.
sredeploymentpersonareviewkubernetes
by lazy-senior-dev Sep 5, 2026 7/10
skill GitHub
A skill for using Claude as a study partner over time rather than a single sitting. It builds a knowledge map for a stated goal, requires evidence for claimed understanding, and writes exact checkpoints so the next session resumes where the last one actually left off.
learningskillmemorycheckpoints
by Ch1nYu Sep 5, 2026 6/10
skill GitHub
A caveman-mode skill that strips Claude's output down to terse phrasing so you burn fewer output tokens and get further before hitting usage limits. One of several independent takes on the Caveman idea, whose measured savings have been contested — JetBrains put it nearer 8.5% than the claimed 65%.
skillstoken-efficiencycavemanusage-limits
by asauntung Sep 5, 2026 6/10
skill Reddit
ReqProof turns a prompt into numbered requirements, tracks 'don't touch X' constraints, and demands evidence before any requirement can be marked PASS. It reports PASS / FAIL / PARTIAL / UNKNOWN instead of a blanket 'done', and flags skipped tests, placeholders, and fake completion. Free, open source, no server or account.
skillsverificationrequirementsopen-source
by Admirable-Put7423 Sep 5, 2026 8/10
skill Reddit
A set of three Claude Code skills that read a repository and generate a complete course on its stack at zero, amateur, or advanced level. Output is a textbook, a workbook, an optional 14-day crash-course schedule, and exams with at least 25 shuffled questions per module. Everything runs from disk with quizzes, drag-and-drop matching, and spot-the-bug exercises.
skillslearningdocumentationonboarding
by IanPlaysThePiano Sep 5, 2026 8/10
skill Reddit
Auto-Mode's bash-first instructions were overriding nested CLAUDE.md files and path-scoped rules. Setting CLAUDE_CODE_THRIFTY_SONIC to "false" in the env block of your settings file disables those instructions and makes scoped rules take effect again. Tracked upstream as claude-code issue #90450.
claude-mdsettingsconfigurationauto-mode
by Isyckle Sep 5, 2026 7/10
skill GitHub
An externalized 'AI brain' kept entirely in plain markdown: it records what you do, then reconfigures the same skeleton into whatever role you need — chief of staff, lawyer, PM, or investigator. No database or service, just files Claude Code reads.
memorymarkdownrolespersonal-assistant
by assafkip Sep 5, 2026 6/10
skill GitHub
A bundle of Claude Code plugins covering AI harness engineering with a spec-driven-development pipeline, an API debugger, a content analyzer, and a submodule manager. Useful as a starting point if you want several workflow plugins from one install rather than assembling them piecemeal.
pluginssdddebuggingsubmodules
by 1989v Sep 5, 2026 5/10
skill GitHub
Two skills — mirror and librarian — copied unedited from the author's daily ~/.claude/skills rather than packaged for release. MIT licensed, no installer and no dependencies, so you can read them in a minute and copy what you want.
skillsaccessibilityadhdproductivity
by Citability Sep 5, 2026 6/10
skill GitHub
A skill pack for Modbus industrial protocol work, deliberately read-only so an agent can inspect and reason about devices without issuing writes. Compatible with Claude Code, Codex, Cursor, and other Agent Plugins clients.
skillsmodbusindustrialread-only
by studioxvii Sep 5, 2026 5/10
skill GitHub
A workflow aimed at keeping you in the driver's seat while the agent does the grunt work: skills for refining an idea, expressing it rigorously, and implementing it properly, in that order. Targeted at staff-researcher-level output and usable from both Claude Code and Codex.
skillsresearchrigorworkflow
by shubham0704 Sep 5, 2026 6/10
skill GitHub
A writing and revision skill that keeps claims bounded to supplied evidence and actively strips the tells of machine-generated prose. Covers English, Korean, Italian, and Chinese.
writingmultilingualai-detectionskills
by gigio1023 Sep 5, 2026 6/10
skill GitHub
A manager session reads GitHub issues as its task board, opens one builder tab per issue, then self-reviews and auto-merges the results. Turns multi-issue work into a single supervisory session rather than a stack of terminals you drive by hand.
orchestrationgithub-issuesparallel-agentsauto-merge
by orrgal1 Sep 5, 2026 7/10
skill GitHub
A deliberately small directory of Agent Skills in SKILL.md format, where entries are verified and reviewed with security in mind rather than accumulated by volume. A useful counterweight to the large unvetted skill lists.
skillsdirectorysecuritycuration
by royalpinto007 Sep 5, 2026 6/10
skill GitHub
A general-purpose design workflow modeled as five chained layers — scenario, perceptual material, formal organization, information narrative, subjective output — with twelve specialized sub-skills hanging off them. Chinese-language.
designskillsworkflowchinese
by yang20040317-svg Sep 5, 2026 5/10
skill GitHub
Ask what's next and get the task, the reasoning behind it, and a ready-to-run prompt that has been checked against the files actually in your repository. Keeps project planning inside the codebase rather than in a separate tracker the agent never reads.
pluginplanningpromptsproject-management
by V-Songbird Sep 5, 2026 6/10
skill GitHub
One check runs before every new package, file, or abstraction, forcing a justification instead of letting the agent expand scope silently. The pitch is the same job in half the lines.
pluginsimplicitycode-qualityscope-control
by V-Songbird Sep 5, 2026 7/10
skill GitHub
Screens whether you are actually eligible for a posting before writing anything, archives the posting for later reference, and checks your drafts for the machine-written register that gets applications binned.
skillsjob-searchwritingproductivity
by geumjin99 Sep 5, 2026 5/10
skill GitHub
A skill collection aimed at one-person operations: Korean business messaging, B2B quoting, Gmail/Todoist/Calendar briefings, and Obsidian journaling. Works with Claude and GPT.
skillskoreanbusinessproductivity
by Rneayan Sep 5, 2026 5/10
skill GitHub
Produces strategy, value streams, capabilities, and process architecture behind deterministic gates, so each artifact has to satisfy explicit checks before the next one is generated rather than being free-form output.
skillsbusiness-architecturegatesenterprise
by yslicn Sep 5, 2026 5/10
skill GitHub
Searches in order — installed skills, a verified vendor catalog, community indexes, then live GitHub — on a strict three-search budget, so the lookup itself does not eat your context. Aimed at the common failure of rebuilding a skill someone already published.
skillsdiscoverysearchtoken-efficiency
by nohseongmin Sep 5, 2026 7/10
skill GitHub
An agent skill plus standalone CLIs that compute per-test coverage metrics, greedily minimize redundant tests, detect AI-slop tests, and verify what remains with mutation scoring. Aimed squarely at suites that ballooned from agent-generated tests.
testingvitestjestmutation-testingai-slop
by JoseAntonioNuevo Sep 5, 2026 8/10
skill GitHub
The official OOMOL catalog of app-skills, letting AI assistants operate third-party services through the oo CLI. Worth a look if you want service integrations as skills rather than as another MCP server to run.
skillsintegrationsclicatalog
by oomol-lab Sep 5, 2026 5/10
skill GitHub
An agent harness for Taiwan's 108 curriculum, organizing teaching skills into a three-tier Skill / Bundle / Preset architecture so a teacher can pull a preset rather than assemble skills manually.
educationskillstaiwancurriculum
by FW1201 Sep 5, 2026 5/10
skill GitHub
Audits Bulgarian payroll statements against the Labour Code, social insurance code, income tax act, and national wage classification. A concrete example of encoding jurisdiction-specific compliance rules as an agent skill.
skillspayrollcompliancebulgarian
by svedbg Sep 5, 2026 5/10
skill GitHub
A connected graph of design engineering skills covering animation, transitions, taste, typography, color, components, and anti-patterns — structured as a graph so the agent pulls the relevant node rather than one monolithic style guide.
designskillstypographyanimationfrontend
by AgentsORG Sep 5, 2026 6/10
skill GitHub
Skills covering Obsidian plugin syntax (queries, tasks, charts, interactive UI), graph view tuning, vault auditing, and heatmap visualizations. Compatible with Claude Code, Codex CLI, OpenCode, and any agent-skills runtime.
skillsobsidiannotesvisualization
by lexbritvin Sep 5, 2026 6/10
skill GitHub
A Claude Code plugin that calibrates review behavior against the feedback humans actually leave on pull requests, tracks where the pipeline missed something, and promotes lessons up a confidence ladder rather than treating every one-off note as a permanent rule.
pluginfeedback-loopscode-reviewlearning
by kirilklein Sep 5, 2026 7/10
skill GitHub
A set of utility skills that push a code assistant to write from a defensive security perspective, rather than reviewing for vulnerabilities after the fact.
securityskillsdefensivesecure-coding
by righettod Sep 5, 2026 6/10
skill GitHub
One orchestrator skill plus specialists that drive the JGS Archi Bridge MCP to build ArchiMate models in Archi. Works with Claude Code, Cursor, Gemini CLI, Codex, Copilot, and ZCode.
skillsarchimatemodellingenterprise-architecture
by jgsystemsconsulting Sep 5, 2026 5/10
skill GitHub
Reads public Telegram channels with no account at all, and groups using your own account. Useful for research and monitoring workflows where Telegram is where the discussion actually happens.
skillstelegramresearchmonitoring
by warodan Sep 5, 2026 6/10
skill GitHub
Turns staged git changes or a specific commit into a Jira user story, and only creates the issue after you approve the draft — the approval gate being the part most ticket-generation tools skip.
skillsjiragitapproval-gate
by DiegoLibonati Sep 5, 2026 6/10
skill GitHub
A skill encoding what a continuous integration pipeline should actually prove, aimed at suites that pass because checks are weak rather than because the code is correct.
ciskillstestingstandards
by rokokol Sep 5, 2026 5/10
skill GitHub
A Claude Code plugin with two loops: a gate-verified pipeline for migrating legacy .NET applications via RoselineMCP, and a hands-off GitHub issue to pull request lifecycle (create-issue, implement-issue, merge-pr, auto-dev) that runs on any repository from one committed profile.
plugindotnetmigrationgithubautomation
by phmatray Sep 5, 2026 6/10
skill GitHub
Removes the machine-written register from Japanese prose — the equivalent of the English de-slop skills, but tuned to Japanese phrasing patterns rather than translated heuristics.
skillsjapanesewritingai-detection
by kitepon Sep 5, 2026 5/10
skill GitHub
A set of three Claude Code skills targeting production WordPress: safe deployment, dead-code removal with proof, and Core Web Vitals tuning. Each check is calibrated against a known-bad case first, so you can tell whether the detection actually works before trusting it on a live site. Useful if you maintain client WordPress installs and want agent help without breaking things.
wordpressskillsperformancecore-web-vitalsdead-code
by mediagyancy Sep 5, 2026 7/10
skill GitHub
An open-source skill pack covering go-to-market engineering and AI operations — data plane work, agent building, evals, and martech plumbing. Aimed at the systems underneath revenue playbooks rather than the playbooks themselves. Worth a look if you are wiring Claude Code into ops tooling rather than pure app code.
skillsgtmai-opsevalsmartech
by guerrilla2799 Sep 5, 2026 6/10
skill GitHub
A single marketplace shipping three independent Claude Code plugins: foreman holds the plan steady, hush cuts output chatter down to one answer at the end, and razor pushes back on over-building. Install any one of them without the others.
pluginsmarketplacescope-controlplanning
by V-Songbird Sep 5, 2026 6/10
skill GitHub
A collection of agent skills and review agents written to work across Claude Code, Gemini CLI and other AI coding tools rather than being locked to one. The review agents are the main draw for anyone who wants a second opinion pass without wiring one up themselves.
skillscode-reviewgemini-cliportable
by Sassy-Dog Sep 5, 2026 5/10
skill GitHub
A Claude Code plugin encoding an execution doctrine: run agents in phases and waves, red-team the output adversarially, loop until confident, and cut back to the simplest thing that works. It is opinionated process packaged as a plugin rather than a single tool.
pluginorchestrationred-teamparallel-agents
by scottcrosby-securebine Sep 5, 2026 6/10
skill GitHub
A skills collection covering autonomous orchestration, code quality passes, local LLM use through Harbor, and writing pipelines, written to run under Claude Code, Codex, OpenCode and Cursor. The local-LLM angle is unusual for a skills repo and useful if you want some steps off the hosted models.
skillsorchestrationlocal-llmcross-tool
by av Sep 5, 2026 6/10
skill GitHub
Six skills aimed at founders and creators: profile audit, company page audit, content strategy, lead generation, authority building and metrics. Explicitly not built for job seekers. Straightforward marketing automation, useful if that is your use case and noise otherwise.
skillslinkedinmarketinggrowth
by 9heaven Sep 5, 2026 5/10
skill GitHub
Agentic skills for academic writing that simulate peer review, drive revision passes and tighten prose. Aimed at researchers who want structured criticism of a draft rather than generic copy editing.
skillsacademic-writingpeer-reviewediting
by borgr Sep 5, 2026 6/10
skill GitHub
An audit that checks writing on two levels: surface tells like word choice and punctuation habits, plus discourse tells in how an argument is structured. Layered by text type, so the standard for an email differs from an essay. Useful as a final pass on anything an agent drafted.
writingauditai-detectionediting
by thebgtagency Sep 5, 2026 5/10
skill GitHub
Two Claude Code skills documented in Portuguese: one builds websites with art direction applied, the other audits SEO, GEO, analytics instrumentation and code. Notable as one of the few non-English skill packages in circulation.
skillsseoweb-designportuguese
by guiloureiromkt Sep 5, 2026 5/10
skill GitHub
Skills that convert papers and conversations into an Obsidian knowledge base, producing ten-section notes with inline figures and filing them under topic hubs so the vault stays navigable. Aimed at researchers who accumulate PDFs faster than they can read them.
skillsobsidianresearchknowledge-base
by alfredzhang98 Sep 5, 2026 6/10
skill GitHub
A skill that searches a large index of public agent skills and adapts trusted ones into WorkBuddy workflows. The search-and-adapt idea is the reusable part: rather than writing a skill from scratch, find one that already works and port it.
skillssearchdiscoveryworkbuddy
by sandbaseai Sep 5, 2026 5/10
skill GitHub
A Claude Code skill that reviews an entire codebase with a second model by cutting it into slices ordered by blast radius, with a cost ledger and a watchdog so the model never wanders the repo unsupervised. Directly addresses the two failure modes of whole-repo review: unbounded cost and unfocused attention.
skillcode-reviewcost-controlsecond-model
by Mariomarquezt Sep 5, 2026 7/10
skill GitHub
Measures how you actually write, builds a voice profile from it, then enforces the profile with code rather than instructions: em dashes, filler, hedges and AI tells are caught by a deterministic checker instead of asking the model to be careful. Supports multiple named voices and ships an eval harness with golden tests, no dependencies.
skillwritingstyledeterministic
by Hiro-Inagawa Sep 5, 2026 7/10
skill GitHub
A curated collection of agent skills aimed at product management. The repository ships no description, so the actual scope and quality have to be judged from the source once cloned.
skillsproduct-managementawesome-list
by karozi Sep 5, 2026 5/10
skill GitHub
A /graphify skill that ingests a codebase along with its docs, SQL schemas, configs and PDFs and builds a queryable knowledge graph. Parsing is local, deterministic and AST-based with every edge explained, and there is no vector store involved. Runs under Claude Code, Cursor, Codex and Gemini CLI.
skillknowledge-graphastcodebase-analysis
by Graphify-Labs Sep 5, 2026 7/10
skill GitHub
A bundled set of AI coding capabilities meant to cover common development workflows in one pluggable framework instead of a pile of separate skills. The description stays high level, so check the source before adopting.
skillsbundleworkflows
by maythyai Sep 5, 2026 5/10
skill GitHub
A Claude Code skill that searches for MCP servers, then actually reads the source and flags inflated star counts before anything is added to your setup. Addresses a real supply-chain gap, since installing an MCP server means running someone else's code with your agent's permissions.
skillmcpsecurityvetting
by Furkiozknn Sep 5, 2026 7/10
skill GitHub
Two agent skills for presentations: one rebuilds an existing Canva design with new content, the other builds a talk sized to the time slot it has to fill. The timing constraint is the more interesting half, since that is where most generated decks fail.
skillspresentationscanvapublic-speaking
by aminehaddad-git Sep 5, 2026 5/10
skill GitHub
Skills focused on measuring decisions in a calibrated way, so an agent's confidence can be scored against outcomes rather than asserted. Small and abstract, but relevant to anyone trying to make agent judgement auditable.
skillscalibrationdecision-makingevaluation
by ThatGuySam Sep 5, 2026 5/10
skill GitHub
A starting point for building Claude Skills that deliberately avoids baking in someone else's conventions. A setup wizard asks how you name, version, and lay out skills, then generates a skill-creator preloaded with your answers. Useful if existing skill templates keep fighting your repo's structure.
skillsboilerplatescaffoldingconventions
by colomet Sep 4, 2026 7/10
skill GitHub
An open-source skill collection that replaces clicking through vendor dashboards with agent commands. Covers Stripe, Cloudflare DNS, ElevenLabs, GitHub and more, published by InsyncTech.
skillsstripecloudflaredevopssaas
by iansteitz1-eng Sep 4, 2026 7/10
skill GitHub
A Claude skill that surfaces high-ranking pages Google's AI Overviews never cite, grades them, and tracks the grade over time. Feeds an Apify actor that queues those pages for rewriting.
skillseoai-overviewcontent
by johnisanerd Sep 4, 2026 5/10
skill GitHub
Joins Google Search Console data with live AI Overview citations to build a prioritized page-rewrite queue. Companion skill to the AI Overview tracking skill from the same author.
skillseosearch-consolecontent
by johnisanerd Sep 4, 2026 5/10
skill GitHub
A SKILL.md that runs each piece of work at the cheapest model that can still pass verification, escalating only when the cheap pass fails. MIT licensed.
skillroutingcostverification
by undercutsh Sep 4, 2026 7/10
skill GitHub
A free, open-source QA skill that reads PDF, DOCX or XLSX requirements and produces TestRail-importable test cases in one conversation. Works in Claude Code, claude.ai and Claude Desktop.
skillqatestingtestrail
by JohnWayneeee Sep 4, 2026 6/10
skill GitHub
A handoff skill that lets Claude and Codex pick up each other's work without replaying the whole context. Ships as both a CLI and an app; derived from francisN21/baton-pass under MIT.
skillhandoffcodexcontext
by netheremp Sep 4, 2026 5/10
skill GitHub
Imports Agent Skills from GitHub repositories while resolving their dependencies, so a skill that references other skills arrives complete.
skillsinstallergithub
by woobin-the-creator Sep 4, 2026 6/10
skill GitHub
Public Claude Code skills that route your code, plans and decisions to other frontier models for an independent read. Useful as a cheap check against a single model's blind spots.
skillsreviewmulti-model
by itgenius-au Sep 4, 2026 6/10
skill GitHub
An Agent Skill that pushes an app to App Store Connect and Google Play from a single metadata file: localized texts, screenshots, pricing, builds and review submission. Uses only curl, python3 and openssl — no fastlane.
skillmobileapp-storerelease
by LeeHueeng Sep 4, 2026 7/10
skill GitHub
Institutional equity-research skills covering SEC filings, XBRL financials, earnings calendars, DCF/comps/LBO models and PowerPoint generation. Backed by the agentii.ai data plane; works across Claude Code, Codex, Goose and others.
skillsfinanceresearchsec
by agentii-ai Sep 4, 2026 6/10
skill GitHub
A Turkish humanizer skill that rewrites machine-sounding text with native sentence architecture and register-aware tone, while keeping technical terms intact. Works in both Claude and Claude Code.
skillwritingturkishhumanizer
by durmazoguzhan Sep 4, 2026 5/10
skill GitHub
A bundle of standards, skills, subagents, hooks, MCP servers and macOS tools that install themselves into Claude Code. The pitch is nothing to remember and nothing to type after setup.
skillshookssubagentsmacossetup
by calebnewtonusc Sep 4, 2026 6/10
skill GitHub
A Claude Skill that gives algorithm explanations, code review and coursework help a consistent, predictable structure instead of freeform answers.
skilleducationalgorithms
by ayiii-a Sep 4, 2026 5/10
skill GitHub
An Agent Skill that profiles a macOS app headlessly with xctrace, applies targeted code fixes, then re-tests differentially to confirm the fix helped. Works with Claude Code, Codex, Cursor and Antigravity.
skillperformancemacosprofiling
by kmgcc Sep 4, 2026 7/10
skill GitHub
The iOS and iPadOS counterpart: headless xctrace profiling on physical devices and simulators, targeted code fixes, and differential A/B re-testing. Harness-agnostic Agent Skill.
skillperformanceiosprofiling
by kmgcc Sep 4, 2026 7/10
skill GitHub
A Claude Code skill that measures the design rules of a reference deck and produces an editable native PowerPoint file — real PPT objects, not images.
skillpowerpointdesignkorean
by merryAI-dev Sep 4, 2026 6/10
skill GitHub
Agent Skills for building Holochain applications on 0.7, following the Agent Skills Open Standard. Installs with bunx and works in Claude Code, opencode, Copilot, Cursor and Gemini CLI.
skillholochainweb3
by Soushi888 Sep 4, 2026 5/10
skill GitHub
Scores every action an agent can take, caps autonomy at the hottest dimension, and emits the mandate, exceptions and owner's manual behind that decision. A governance skill, free under CC BY 4.0.
skillgovernancesafetyautonomy
by auxfirst Sep 4, 2026 6/10
skill GitHub
A Claude Code skill for product quality work: issue discovery, dependency analysis, checklists, and an iterative review-fix-commit cycle.
skillqualityreview
by Kruppmagnetichead257 Sep 4, 2026 5/10
skill GitHub
A collection of 17 Claude Code plugins comprising 19 skills, aimed at real content workflows: video, publishing, Obsidian and generative engine optimization.
skillspluginscontentobsidian
by chenyuxiaojin Sep 4, 2026 6/10
skill GitHub
Analyzes course catalogs, recommends courses and builds conflict-free weekly timetables, exporting to Excel and ICS. Handles US, AU, UK, ECTS and CN credit systems.
skilleducationscheduling
by ez-hq Sep 4, 2026 5/10
skill GitHub
Agent skills organized as lab it, plan it, ship it — covering architecture, GitHub planning and delivery, with stack-specific companion skills.
skillsarchitecturegithubdelivery
by elieandraos Sep 4, 2026 6/10
skill GitHub
An Agent Skill running a single-pass launch pipeline — engineering baseline, publish, directory listings, promotion. Distilled from the author's own shipped tools.
skillreleaselaunchpublishing
by skyzhao1223 Sep 4, 2026 5/10
skill GitHub
A Claude Code skill that runs a continuous implementation loop against a PRD. Pairs with the author's dream-skill for the requirements side.
skillprdimplementationloop
by j0yen Sep 4, 2026 5/10
skill GitHub
The free edition of an Amazon PPC audit packaged as an installable Claude Skill, producing the kind of review a senior practitioner would run.
skillamazonppcmarketing
by Ahmad-G1 Sep 4, 2026 5/10
skill GitHub
The Knowledge Islands agentic harness — a canonical repository holding Agent Skills, agents, MCP servers and evals for the whole ecosystem.
harnessskillsmcpevals
by knowledgeislands Sep 4, 2026 5/10
skill GitHub
Skills for scoping a change before writing it: impact, tradeoffs, decision points, and a first-principles pass on your own reading of the problem. Delegates the mechanical work to cheap subagents, and works in your language.
skillsplanningscopingsubagents
by Jsnnmsc Sep 4, 2026 6/10
skill GitHub
Production-grade agent skills for Claude Code and any SKILL.md-compatible agent, each derived from real corpora, official documentation and books. Install as a plugin or drop into any agent.
skillscollectionplugin
by fralapo Sep 4, 2026 7/10
skill GitHub
Covers the sales workday from lead research to follow-up on Indian companies and the people behind them, with every record figure cited to its source. Published as a generated mirror.
skillsalesresearchindia
by Celorus Sep 4, 2026 5/10
skill GitHub
A reusable scaffold for AGENTS.md, CLAUDE.md and a .agents/ directory, offered in three additive sizes. Works with Claude Code, Codex Desktop, Cursor and Windsurf.
scaffoldclaude-mdagents-mdtemplate
by GuiomeB Sep 4, 2026 6/10
skill GitHub
An agent knowledge pack for the Qapla' public REST API v1.3 covering shipments, raw orders, carrier labels, tracking, real-time quotes, PUDO and webhooks. Usable as a Claude skill, an AGENTS.md or a Cursor rule.
skillapilogisticsshipping
by Qapla Sep 4, 2026 5/10
skill GitHub
A Claude Code skill that summarizes a video into an English HTML page with transcript-driven chapters, embedding selected frames — slides, screens, demos — next to the text they illustrate.
skillvideosummarizationtranscript
by yosishe Sep 4, 2026 7/10
skill GitHub
Parses PDF and EPUB books, indexes the whole text, and extracts a chapter-to-key-point four-level outline importable into XMind, MindMaster, Mubu or Notion.
skillpdfepubmindmapnotes
by open-source-on-ai Sep 4, 2026 5/10
skill GitHub
Academic agent skills spanning bioinformatics, data science, clinical work, social-science methods and Turkish academia, each with an executable eval. Includes a deterministic citation verifier and a research-write-review-publish pipeline.
skillsacademicresearchcitationsevals
by AlterLab-IEU Sep 4, 2026 7/10
skill GitHub
A gate for Claude Code that searches for an existing solution before a single line of code is written, on the premise that the wheel usually already exists.
skillresearchgateplanning
by kalpakprod Sep 4, 2026 6/10
skill GitHub
Skills that challenge ideas, surface blind spots, use the real design system, preserve evidence and decisions, and carry UX intent into engineering handoff.
skillsuxdesignhandoff
by Tranz007 Sep 4, 2026 6/10
skill GitHub
Seven review skills — bugs, security, tests, docs and structure — that make any coding agent file evidence-backed, severity-graded audits instead of prose opinions.
skillsreviewsecuritytestingaudit
by specialone0007 Sep 4, 2026 7/10
skill GitHub
Makes AI speak Taiwanese Traditional Chinese naturally and strips the AI flavor out of text already written. Works in Claude Code, claude.ai, Codex and ordinary chat.
skillwritingchinesehumanizer
by chang416 Sep 4, 2026 5/10
skill GitHub
Gated templates, PM canon cards and AI skills covering the full product lifecycle. Designed so the templates still work without any AI in the loop.
skillsproduct-managementtemplates
by RizwanZafaris Sep 4, 2026 6/10
skill GitHub
Turns natural-language requests into Groovy scripts or FlexibleSearch queries and runs them live against a SAP Commerce Cloud (Hybris/CCv2) instance through the HAC. Picks the right tool from your intent without manual query writing.
skillsaphybrisgroovy
by eljoujat Sep 4, 2026 6/10
skill GitHub
Agent skills for Lean Thinking and TPS methods, starting with Toyota Business Practices problem-solving coaching. Published by Art Smalley.
skillsleancoachingprocess
by artsmalley Sep 4, 2026 6/10
skill GitHub
Authors OpenMAIC DSL courses inside Claude Code — outline, scene generation, TTS voiceover, translation, editing and a gated review pipeline — compiling git-friendly sources into importable .maic.zip bundles.
skillcoursewarettsdsl
by weinaike Sep 4, 2026 5/10
skill GitHub
Thai-language Claude Skills for academic work, official government correspondence, research projects and Word document formatting.
skillthaidocumentsacademic
by sriwitsumo Sep 4, 2026 5/10
skill GitHub
The official agent skill set for the Runtype platform, maintained by Runtype Labs.
skillsplatformofficial
by runtypelabs Sep 4, 2026 5/10
skill GitHub
A Claude Code plugin bundling codebase readiness scoring, Six Thinking Hats deliberation, AI-slop removal and skill hardening as slash commands.
pluginskillscommandscode-quality
by bjcoombs Sep 4, 2026 7/10
skill GitHub
A Claude Code skill that applies brand rules to every deliverable by default, plus a gate that rejects any file which comes out off-brand.
skillbrandinggatedesign
by jbisaccia-9 Sep 4, 2026 6/10
skill GitHub
Agent Skills for biomedical research built on the biomcp-ts MCP server: deep research, weekly PubMed updates and uv setup. Follows the agentskills.io SKILL.md standard.
skillsbiomedicalresearchpubmedmcp
by yeyuan98 Sep 4, 2026 6/10
skill GitHub
A curated technical knowledge base spanning 26 domains in an agent-first format with wiki-links, gotchas and runnable code. Verified references rather than tutorials.
knowledge-basereferencedocumentation
by AnastasiyaW Sep 4, 2026 6/10
skill GitHub
Blends several PowerPoint design styles and outputs an actual PPT file rather than an HTML approximation.
skillpowerpointdesignchinese
by billLiao Sep 4, 2026 5/10
skill Reddit
A verbatim CLAUDE.md rule that stops Claude from padding frontend work with explanatory paragraphs and lets the UI explain itself. The author reports never having to ask for terser copy again after adding it.
claude-mdfrontendpromptingverbosity
by RepliesAsOtherPeople Sep 4, 2026 7/10
skill Reddit
Two sessions on the same repo with Opus 5 at medium effort: the baseline had Claude discover and run commands itself, while the second used a Skill that turned repeatable repo procedures into deterministic higher-level commands. The second session issued 55% fewer commands.
skillexperimentcommandsefficiency
by adi1405 Sep 4, 2026 7/10
skill Reddit
A free in-browser generator that produces a CLAUDE.md from checkbox rules and a chosen stack, with no signup. Currently only Next.js has a framework preset; the author is asking which rules are missing.
claude-mdgeneratorweb-tool
by Ice-Medium Sep 4, 2026 5/10
skill GitHub
A Claude Code skill that adds Assisted-by / Generated-by trailers to commits, recording how much of the work an agent did. Useful for teams that want an auditable record of AI involvement without hand-writing trailers.
gitcommitsskillprovenance
by rokokol Sep 4, 2026 6/10
skill GitHub
A free Claude Code skill that polls live URLs after a deploy and reports regressions it finds. Built on affaan-m/ECC, it turns post-deploy smoke checking into something the agent does on its own.
monitoringdeployskillcanary
by agenticluke Sep 4, 2026 6/10
skill GitHub
A plugin that pushes Claude to commit to one design stance, build on semantic tokens, use real content instead of lorem ipsum, and hold an accessibility and taste floor. Ships an Essentialist persona distilled from Rams, Bauhaus, and Ive.
ui-designpluginaccessibilitydesign-tokens
by SSFSKIM Sep 4, 2026 7/10
skill GitHub
A Claude skill that writes E-E-A-T-compliant long-form articles and posts tailored per platform (LinkedIn, X, Reddit, Product Hunt). Includes anti-AI-slop style enforcement and handling for YMYL compliance topics.
writingcontentseoskill
by thevrus Sep 4, 2026 6/10
skill GitHub
A starter set of engineering rules covering security, quality, testing, and documentation, written for Claude, ChatGPT, Claude Code, and Codex. Includes an extension for the Sankhya ecosystem.
standardsportuguesequalitysecurity
by isaacoolibama Sep 4, 2026 5/10
skill GitHub
An "anarchist" reviewer for Claude Code that treats fixed constraints as asymmetric leverage, attacks the plan you just wrote, and runs an anti-sycophancy check. For when the agent agrees with you far too readily.
reviewred-teamplanninganti-sycophancy
by LearnDataLive Sep 4, 2026 6/10
skill GitHub
Two Claude Code skills written in Portuguese: one generates images through Codex, the other asks the same question of three AIs from different companies and compares the answers.
portugueseimage-generationmulti-modelskill
by Guiair21 Sep 4, 2026 5/10
skill GitHub
Generates a SKILL.md, AGENTS.md, or Cursor rule directly from your live Postgres schema, so the agent works from real column names instead of plausible-looking hallucinations. Supabase-aware.
postgresschemasupabaseskill-generation
by SamRome1 Sep 4, 2026 7/10
skill GitHub
Two skills built around measurable self-checks: SVG logo and icon design gated on a quality threshold, and a per-project todo board. The output has to pass the gate before the skill calls itself done.
svgdesigntodoself-verification
by nkrrish Sep 4, 2026 6/10
skill GitHub
A Spanish-first Claude Code skill that feeds video into the session as extracted frames plus a transcription, with caching and markdown notes. Derived from bradautomates/claude-video under MIT.
videotranscriptionspanishskill
by akiotanaka847 Sep 4, 2026 5/10
skill GitHub
An aerospace knowledge layer of 416 skills in 85 installable packs across 12 engineering families, mapped to 30 standards including ECSS, DO-178C, and NASA. Validated by an 846-task deterministic gate battery; AgentSkills.io format, Apache-2.0.
aerospaceskillsstandardsdo-178cdomain-knowledge
by ashfordeOU Sep 4, 2026 7/10
skill GitHub
A marketplace of agentic workflows whose centerpiece, devteam, carries a project from a client brief to a working product under a signed charter — traceable requirements, independent verification of every report, and escalations classified by how reversible they are.
marketplacepipelinerequirementsverification
by alternative-intelligence-cp Sep 4, 2026 6/10
skill GitHub
Agent skills auditing security, UX, SEO, repo readiness, and documentation, with every finding citing a file and line rather than offering general advice.
auditsecurityseouxdocumentation
by naieum Sep 4, 2026 7/10
skill GitHub
A Claude Code skill pulling Ads, GA4 and agent data into a local SQLite warehouse with normalized metric views, a two-window comparison dashboard and a three.js 3D data city view. Published as a sanitized public template with entirely fictional demo data. Chinese-language docs.
skillanalyticssqlitemarketing
by Haili321 Sep 3, 2026 6/10
skill GitHub
A skill aimed specifically at formal registers — business and academic text — rather than casual prose, and works in both Chinese and English.
skillwritingbilingualacademic
by jiutianxvanyin Sep 3, 2026 5/10
skill Reddit
A SKILL.md agent skill that pulls every paper from 28 AI labs over a date range and splits each lab's count into papers they led versus papers where they were only a co-author. Affiliation matching goes through ROR IDs and email domains rather than fuzzy string matching, so it doesn't hallucinate. Useful for anyone tracking publication output across Google, Meta, OpenAI, Anthropic and the major Chinese labs.
skillresearcharxivai-labs
by navune Sep 3, 2026 7/10
skill GitHub
An aggregation repo of 26 production-grade agent skills written as SKILL.md, built to work across tools and compatible with the DeepSeek Harness. A drop-in starting library if you want skills without writing them from scratch.
skillscollectioncross-toolskill-md
by xingtu1996 Sep 3, 2026 6/10
skill GitHub
A health workspace that connects lab results, training data, sleep and family history so each conversation with Claude builds on the last instead of starting from scratch. Aimed at long-horizon health tracking rather than one-off questions.
skillhealthlongevitypersonal-data
by googlarz Sep 3, 2026 6/10
skill GitHub
A set of agent skills targeted at Roblox development. Narrow, but there's very little published skill material for the Roblox toolchain, so it fills a gap for anyone building there with an AI agent.
skillsrobloxgame-devcollection
by HungryKelvin123 Sep 3, 2026 5/10
skill GitHub
Turns the Claude Fable 5.1 prompting guidance into installable Claude Code skills, with Korean, English and Chinese versions. The author reports the same skills lift output quality on Opus 5 and Sonnet 5 as well.
skillspromptingfablemultilingual
by Junhan2 Sep 3, 2026 7/10
skill GitHub
Researches how many distinct schools of thought exist on a topic and which angles nobody has claimed yet — topic reconnaissance for content creators. Retrieval-driven and designed to stay neutral rather than pick a side. Chinese-language docs.
skillresearchcontentretrieval
by ianx52 Sep 3, 2026 5/10
skill GitHub
A solo entrepreneur automated 49 parts of their business without employees and published the 26 agent skills that were directly reusable, with the supporting execution scripts. Korean-language docs.
skillsautomationsolobusiness
by bam-bam-2 Sep 3, 2026 5/10
skill GitHub
Reusable agent skills bundled with deterministic activation rules, safety hooks and installers for both Claude Code and OpenAI Codex. The deterministic activation is the interesting part — skills fire on defined conditions instead of the model deciding.
skillshooksactivationcodex
by alex-macra Sep 3, 2026 6/10
skill GitHub
A library of agent recipes for actual software and knowledge-work tasks, designed to be pulled in and read rather than run as a black box. The emphasis is on inspectability — you can see what the recipe will do before it does it.
skillsrecipescollectionworkflow
by Software-Sausage Sep 3, 2026 5/10
skill GitHub
A skill pack for frontend and full-stack engineers covering Vue 3, React, Next.js, TypeScript, accessibility and performance, compatible with Claude Code, Cursor and Codex. The author's motivation: science and security already had skill packs and frontend engineering didn't.
skillsfrontendreactaccessibility
by LeonxLJX Sep 3, 2026 7/10
skill GitHub
A personal skills repo whose current entry, teach-me, explains any technical topic from first principles and can output either as chat or as a printable PDF. Useful for onboarding notes or study material you want to keep.
skilllearningdocumentationpdf
by sahanaramesh09 Sep 3, 2026 5/10
skill Reddit
A Remotion-based skill that produces demo videos nearly identical to a real Claude Code terminal, with a template included so you can script your own. A companion skill handles realistic typing animation, with natural pauses after commas and per-character jitter that stays stable across renders.
skillremotionvideodemo
by HMHAMz Sep 3, 2026 7/10
skill GitHub
Reusable agent skills for mobile reverse engineering and Android native fuzzing, including on-device AFL++ and a stub-JNIEnv harness. Installable via skillfish. A rare example of security research tooling packaged as agent skills.
skillsreverse-engineeringandroidfuzzing
by alvinhayy Sep 3, 2026 6/10
skill GitHub
A full instruction architecture for coding agents — rules, skills and subagents — paired with a routing and behaviour test suite and an evidence-grade session evaluation pipeline. Notable because it treats agent instructions as something you can actually test rather than tune by vibes.
dotfilesinstructionstestingevaluation
by saranyoopkp Sep 3, 2026 6/10
skill GitHub
A static bilingual (FR/EN) generator that produces a Claude skill fitted to the context you describe. No backend and no API key — it runs entirely in the page.
skillgeneratorbilingualstatic
by romain-nicod Sep 3, 2026 6/10
skill GitHub
A dictionary of over 1,000 industrial-grade image generation prompts alongside open-source agent skill ideas, including a physical-journal 3D sketchbook mode. Chinese-language docs.
skillspromptsimage-generationcollection
by Vieeeeeee Sep 3, 2026 5/10
skill GitHub
A project/product manager skill where Claude runs the delivery cycle — discover, plan, get sign-off, then build, review and ship through subagents. Puts an explicit human sign-off gate between planning and building.
skillproject-managementsubagentsdelivery
by bendusz Sep 3, 2026 6/10
skill GitHub
Packages AI skills so they install and version through Composer, PHP's dependency manager. Skills become a normal dependency in your project rather than files you copy around by hand.
skillscomposerphpdistribution
by roxblnfk Sep 3, 2026 6/10
skill GitHub
An encyclopedia-style curation of over 500 open-source agent skills, cross-referenced into a network and installable in one step as a Claude Code plugin marketplace. Chinese-localized with English coverage.
skillscollectionmarketplacecuration
by findscripter Sep 3, 2026 7/10
skill GitHub
An agent skill that converts LaTeX Beamer slide decks to the ltx-talk class, producing accessible tagged PDFs. Narrow, but accessible academic slides are otherwise a manual slog.
skilllatexaccessibilitypdf
by meneguzzi Sep 3, 2026 5/10
skill GitHub
Lessons pulled from actual agent sessions that went wrong — Rust FFI/JNI crashes, silent Android UI failures, multi-agent git coordination — each written as scar, fix and check. Tool-agnostic across Claude Code, Cursor and Copilot.
lessonsdebuggingrustandroid
by AkashPriyadarshii Sep 3, 2026 6/10
skill GitHub
Sixteen bundled agent skills covering design, copy, SEO and AI-search visibility to produce a professional landing page from Claude Code, with a live URL and no accounts required.
skillslanding-pageseodesign
by kraayenjon Sep 3, 2026 6/10
skill GitHub
A /session-report skill that reads a session's own transcript and produces token, timing and conversation-shape analytics with a visual timeline. Installable as a plugin — useful for working out where a session actually spent its budget.
skillanalyticssessionplugin
by konradcinkusz Sep 3, 2026 7/10
skill GitHub
A collection of prompts, agent roles and configurations for Claude and Codex that the author runs in production, kept private by default and published once they've proven out.
promptsconfigsrolescodex
by abraira85 Sep 3, 2026 5/10
skill GitHub
A Claude Code skill that decomposes a single stated goal into a sequenced multi-PR build plan, so work lands in reviewable increments instead of one enormous diff. Built on affaan-m/ECC.
skillplanningpull-requestdecomposition
by agenticluke Sep 3, 2026 6/10
skill GitHub
Takes a CV and produces a bilingual Excel shortlist of top-fit companies with salary data, fit scores and suggested next steps. Research output rather than a mass-application script.
skilljob-searchresearchexcel
by alicekane437 Sep 3, 2026 5/10
skill GitHub
A Codex skill generating personalized weekly training and daily meal plans from body data, goals, diet preferences and available equipment, driven by a deterministic calorie and macro engine that adjusts as progress comes in.
skillfitnessnutritioncodex
by Kyo-zmol Sep 3, 2026 5/10
skill GitHub
A writing skill for LLMs targeting voice matching, sentence rhythm, genre fidelity and general naturalness. Aimed at the recognizable flatness of default model prose.
skillwritingprosestyle
by lmkn-dev Sep 3, 2026 6/10
skill GitHub
A discipline layer for frontier coding agents built around durable responsibility, adversarial verification, continuity across sessions and autonomous completion. Squarely aimed at agents that declare victory early.
skillsreliabilityverificationdiscipline
by LetA-Tech Sep 3, 2026 5/10
skill Reddit
BOY1 is a turn-based stealth puzzle for iOS — a discarded humanoid climbing the 30-floor tower that built him, on an 8x8 deterministic grid. The author doesn't code; Claude Code wrote all ~30,000 lines of GDScript over three months, and they credit an 11,000-word Korean CLAUDE.md as the reason it held together. Shipped to the App Store on Sep 1.
claude-mdgodotcase-studygame-dev
by OkSun790 Sep 3, 2026 8/10
skill GitHub
A system design skill for coding agents covering mapping, designing, reviewing and evolving architectures, with capacity math, failure stress-tests and right-sizing gates. The right-sizing gates are the useful part — a check against agents over-engineering by default.
skillsystem-designarchitecturecapacity
by DAAS2 Sep 3, 2026 6/10
skill GitHub
Deterministic design contracts, component recipes and WCAG AA evaluation gates for Cursor, Claude Code, Windsurf and Antigravity. Makes accessibility a gate the agent has to pass rather than a review comment afterwards.
skillsdesign-systemaccessibilityui
by omid-io Sep 3, 2026 6/10
skill GitHub
A Claude Code skill that runs browser QA after a deploy — testing pages, user flows, speed, mobile views and accessibility. Built on affaan-m/ECC.
skillqabrowsertesting
by agenticluke Sep 3, 2026 6/10
skill GitHub
A full development lifecycle skill taking a ticket through to shipped code. Written for .NET and Angular but structured to be adapted to other stacks.
skilllifecycledotnetangular
by muneebrbaig Sep 3, 2026 5/10
skill GitHub
A job search methodology written for an agent to read rather than a human — not an application-blasting script, but the judgment discipline to apply at each decision point. Chinese-language docs.
skilljob-searchmethodologyagents
by gilgameshcc Sep 3, 2026 5/10
skill GitHub
An implementation of the SKILL.state paper (arXiv:2608.26263) for Claude Code and opencode. It keeps a skill’s prompt footprint constant no matter how long the task runs, by holding progress in external state instead of an ever-growing context. Useful if your long-running skills keep blowing up the context window.
skillscontext-managementruntimeresearch
by vitkuz573 Sep 3, 2026 7/10
skill GitHub
An Agent Skill that reviews a codebase looking for things to delete rather than add — redundant tests, "verification theater", and speculative fallback branches that never fire. It aims to preserve behavior while cutting the volume of code AI agents tend to pile up. A counterweight to agents that only ever write more.
skillscode-qualityrefactoringcleanup
by MrZoyo Sep 3, 2026 7/10
skill GitHub
An open SKILL.md package that drives the Robinhood Trading MCP connector: market research, stock screening, portfolio and P&L monitoring, and pre-trade order review. Portable across Claude Code, Claude Desktop, ChatGPT, Cursor and other SKILL.md-aware agents. The pre-trade review step is a sensible guardrail for an agent touching a brokerage account.
skillsmcptradingfinance
by yashpatel-py Sep 3, 2026 6/10
skill GitHub
An Agent Skill that turns source material into structured courses inside Google NotebookLM, with each claim traced back to a citation and verified rather than generated freely. Useful for anyone assembling training material who needs the output to be checkable.
skillsnotebooklmeducationcitations
by hmj1026 Sep 3, 2026 5/10
skill GitHub
An agent skill for deep research that fans work out to parallel subagents, keeps structured evidence, and emits rich output artifacts. Written for Cursor agents but the skill format carries over. Worth a look if your research prompts keep collapsing into one long unstructured answer.
skillresearchsubagentscursor
by TheAdamLabs Sep 3, 2026 6/10
skill GitHub
An agent skill that runs sustained back-and-forth to help you form and examine your own thinking instead of handing you a conclusion. Deliberately withholds the model's opinion so the reasoning stays yours. A different use of an agent than the usual do-this-for-me pattern.
skillthinkingdialoguereflection
by ivanoid Sep 3, 2026 6/10
skill GitHub
A Claude Code skill that explores a solution space for original candidates and scores them without pruning away the odd ones too early. Every scoring mechanism traces to a measured result from the creativity-assessment literature. Useful for brainstorming where a normal model pass converges too fast.
skillideationcreativitysearch
by rwshiraishi Sep 3, 2026 6/10
skill GitHub
A set of ffmpeg-based skills that let coding agents encode, stitch, and verify video, including the verification step most ffmpeg wrappers skip. Encodes the practical knowledge of what actually ships rather than exposing raw flags. Useful for agents producing demo clips or media pipelines.
skillffmpegvideomedia
by ALCHEMINT-INC Sep 3, 2026 7/10
skill GitHub
A set of agent skills for bootstrapping new repositories with common workflows, security guardrails, and baseline best practices already wired in. Covers the setup work usually repeated by hand at the start of every project. Worth adapting if your team has a house standard for new repos.
skillscaffoldingsecuritybootstrap
by iadknet Sep 3, 2026 6/10
skill Reddit
A practical fix for Claude drifting back to technical prose mid-session: put style rules in a file under ~/.claude/output-styles/ rather than CLAUDE.md, since output styles land in the system prompt and are reinforced every turn. Keep keep-coding-instructions: true in the frontmatter so the style layers on top of the coding instructions instead of replacing them.
output-stylesclaude-mdconfigurationprompting
by Just-Arugula6710 Sep 3, 2026 7/10
skill GitHub
A cross-host web-design skill for Claude Code and Codex that derives art direction from the project itself instead of applying a fixed style pack. A decision router picks choices per context, and a verification harness measures the rendered output rather than trusting the generated CSS.
designfrontendverificationcodex
by mjcreations123 Sep 2, 2026 7/10
skill GitHub
An open-source skill pack that turns product leadership principles from the Mission Built book into operational agent skills. For PMs and leads who want their judgment encoded as repeatable prompts rather than tribal knowledge.
productleadershipskills
by missionbuilt Sep 2, 2026 5/10
skill GitHub
A Claude Code skill that extracts chemical names from messy input, queries 14 property fields across 12 sources, and writes an Excel workbook with per-cell provenance annotations. Handles dirty lists, clean lists, and partially filled sheets.
chemistryexceldataresearch
by jonathanwong0086 Sep 2, 2026 5/10
skill GitHub
A collection of focused Claude Code plugins rather than one large framework. Includes adjudant for Obsidian vault operations and a TUI toolbox, with more added over time.
pluginsobsidiantuicollection
by TomVDH Sep 2, 2026 5/10
skill GitHub
A personal but curated marketplace of Claude Code plugins covering common development workflows. Worth browsing if you are assembling a plugin set rather than writing your own.
pluginsmarketplacecollection
by HirogaKatageri Sep 2, 2026 5/10
skill GitHub
Agent skills for capturing anything without deciding where it goes, then retrieving the right item when a task actually starts. Positions saving and finding as two separate problems rather than one filing system.
knowledgesearchnotesskills
by qbyx-studio Sep 2, 2026 5/10
skill GitHub
A domain-agnostic methodology packaged as a Claude Code plugin for constructing and maintaining ontologies, domain models, taxonomies, and knowledge-graph schemas. Includes review and refactor paths, not just greenfield modeling.
ontologymodelingknowledge-graphskills
by mgillett43 Sep 2, 2026 6/10
skill GitHub
Treats a design system as something to compile against your brand rather than adopt wholesale. Aimed at teams that want a consistent house style without hand-rewriting every component library they pull in.
design-systembrandingfrontend
by humanbird Sep 2, 2026 5/10
skill GitHub
A support agent constrained to answer only from public documentation, with fail-closed guards against leaking internal material and escalation to founders when it is unsure. A concrete pattern for grounding a customer-facing agent.
supportdiscordgroundingguardrails
by DaizeDong Sep 2, 2026 5/10
skill GitHub
A plugin of agent skills aimed at decision work rather than code: strategy, research, planning, risk management, negotiation, and execution. Useful if you use Claude Code as a thinking harness outside the editor.
strategyplanningresearchskills
by skyf0xx Sep 2, 2026 5/10
skill GitHub
A published personal Claude Code configuration covering skills, subagents, commands, rules, and hooks. Worth reading as a worked example of how one developer's whole setup fits together.
dotfilesconfighooksexample
by Fqih Sep 2, 2026 5/10
skill GitHub
A skill that pulls your Thingiverse designs, downloads, and makes onto your own site as static HTML with locally cached thumbnails. Renders at build time on a schedule, so no API token ever reaches the browser.
3d-printingstatic-siteapiskills
by BlinkingSun Sep 2, 2026 5/10
skill GitHub
Compiles a CLAUDE.md or AGENTS.md from behaviors you want eliminated, testing each rule by trying to falsify it and keeping a receipt of the evidence. An unusually rigorous take on why most rule files quietly stop working.
claude-mdrulesverificationagents-md
by brnyxx Sep 2, 2026 7/10
skill GitHub
A research harness built around refusing to take claims on authority — every assertion has to be traced back to a source the agent actually checked. For literature work and analysis where a confident summary is the failure mode.
researchverificationharness
by tanyelai Sep 2, 2026 6/10
skill GitHub
A Russian-language agent development kit combining skills, hooks, and gate templates with a shared journal of mistakes the team has already hit. The bump log is the interesting part: institutional memory of agent failure modes.
russianhooksgatesskills
by arsen-ask-lx Sep 2, 2026 5/10
skill Reddit
A clear technical explainer of how harnesses actually implement Agent Skills and MCP, aimed at people who have used both passively and want the mechanics. Good grounding before you write your own skill or server.
explainermcpskillsinternals
by shared_ptr Sep 2, 2026 8/10
skill GitHub
A skill that reads Google Search Console exports and produces ranked actions using fitted CTR curves, statistically tested anomalies, and SERP absorption detection. Statistical rather than vibes-based SEO analysis.
seoanalyticsstatisticsskills
by aurelien-dio Sep 2, 2026 6/10
skill GitHub
A Chinese-language collection of six skills covering founder IP strategy, content prediction calibration, customer acquisition, deep reading, skill engineering, and video production. Built and iterated in public around a real solo-operator workflow.
chinesecontentsoloskills
by Huanyu-Hibiki Sep 2, 2026 5/10
skill GitHub
A rewriting skill with separate rule sets for Traditional Chinese and English that converts convoluted AI and technical prose into something readable at a glance. Two tracks rather than a translated single ruleset.
writingchineseeditingskills
by olivervvvv Sep 2, 2026 6/10
skill GitHub
One developer's marketplace of the skills they actually use day to day, kept public as it evolves. Valuable as a filtered set rather than an exhaustive index.
marketplaceskillscollection
by mattwang44 Sep 2, 2026 5/10
skill GitHub
A Chinese-language agent skill covering the full penetration testing and vulnerability research workflow. Relevant for authorized security assessment work where the agent needs a structured methodology rather than ad hoc prompting.
securitypentestchineseskills
by enilmalus Sep 2, 2026 5/10
skill GitHub
A German-language writing skill listing 74 tells, each paired with a plain rewrite and the cases where the original is actually correct. Ships a check script so the rules run rather than being advisory.
germanwritingeditingskills
by lord-helicon Sep 2, 2026 5/10
skill GitHub
A skill plus output style that stops Claude inventing words and pushes it toward plain English or Chinese. Zero dependencies, no judge model, no API key — it changes how the primary model writes rather than post-processing.
writingoutput-styleplain-languageskills
by maxxiedddd Sep 2, 2026 6/10
skill GitHub
A ready-to-use Chinese and English skill collection covering thematic illustration and software logo prompt design, story generation, podcast outlines, industry research, and CSDN publishing.
creativepromptschineseskills
by amlei Sep 2, 2026 5/10
skill GitHub
A Claude Code plugin of migration skills for Dockerized, Makefile-driven web projects: Drupal 10 to 11, PHP and Docker version bumps, Gulp to Vite, Sass, jQuery 4, and PHP_CodeSniffer. Concrete upgrade paths rather than generic refactoring advice.
migrationdrupalphpvite
by JMAILLY Sep 2, 2026 6/10
skill GitHub
Aggregates Agent Skills from GitHub, skills.sh, skillregistry, npm and Hacker News, dedupes and ranks them, and sinks the result into an Obsidian knowledge base. Surfaces capability comparisons at the start of a task rather than requiring a manual search.
discoveryskillsobsidianaggregation
by tomtdhzz Sep 2, 2026 7/10
skill GitHub
Generates a single self-contained skill file from a description and a couple of examples, with portability as the design goal so it does not break when someone else installs it. Meta-tooling for people who write a lot of skills.
metaauthoringskillsportability
by baron-3dl Sep 2, 2026 7/10
skill GitHub
A skill for designing buildable no-weld hardware robots against a deduplicated 225-part catalog, with assembly reconstruction rules and bill-of-materials validation. Constrains the agent to parts that actually exist.
roboticshardwarebomskills
by jevkny Sep 2, 2026 5/10
skill GitHub
An agent skill that runs GIS work end to end — authoritative data discovery through interactive maps — on OSM, Overture, STAC, DuckDB, PostGIS, QGIS and MapLibre. Emphasizes reproducibility and validation over one-off map generation.
gisgeospatialduckdbskills
by jaakla Sep 2, 2026 6/10
skill GitHub
Agent skills that extract transcripts, comments, metadata and structured JSON from video and social media URLs, with a yt-dlp troubleshooting guide included for when extraction breaks.
transcriptsvideoscrapingskills
by franciscobmacedo Sep 2, 2026 6/10
skill GitHub
Walks you through a structured interview and produces a harness tailored to the project, then validates and maintains it as the project changes. Addresses the gap between generic templates and a config that fits your repo.
harnessconfiginterviewskills
by tjdwls101010 Sep 2, 2026 6/10
skill GitHub
A full audit-firm lifecycle as an agent skill for Solana programs: a Rust pre-scanner, cross-audit memory, 1,346 checks across 20 checklists, 131 catalogued attack vectors, and delivery of executable proof-of-concepts plus fix patches.
securitysolanaauditrust
by solanabr Sep 2, 2026 7/10
skill GitHub
A writing skill that strips the recognizable assistant register from marketing and product copy. Small and focused rather than a general style framework.
writingcopyeditingskills
by stevenAthompson Sep 2, 2026 5/10
skill GitHub
A harness-agnostic skill that gets a second opinion from GLM, Kimi, Grok, Codex or Opus, with each reviewer agent running your test suite inside a repo snapshot rather than reasoning about the diff alone.
code-reviewmulti-modeltestingskills
by genhoi Sep 2, 2026 7/10
skill GitHub
A Chinese-language research engine for corporate intelligence paired with evidence-driven writing skills and a cross-agent search adaptation layer. MIT licensed.
researchchineseintelligencewriting
by noir-gif308 Sep 2, 2026 5/10
skill GitHub
A free Claude Code skill for generating native API connectors that come with authentication handling, tests and documentation rather than just a request wrapper. Built on affaan-m's ECC.
apiconnectorscodegenskills
by agenticluke Sep 2, 2026 5/10
skill GitHub
A French-language plugin shipping six subagents — quality, error handling, security, user guide, API reference, and project memory. On first run in a project Claude asks which to enable, installs them, and adapts their context to the repository, then reminds you to invoke them after code changes.
subagentsfrenchpluginquality
by blaisebarrette Sep 2, 2026 6/10
skill GitHub
A growing library of product management skills and frameworks aimed at turning judgment calls into repeatable, shareable playbooks an agent can follow.
productpmplaybooksskills
by saurabhships Sep 2, 2026 5/10
skill GitHub
Reviews Claude Code agent definitions and grades the review's own detection power with an oracle. A Japanese-language project useful if you maintain many subagent specs and cannot tell which are actually well-written.
subagentsreviewjapaneseevaluation
by hatohato-lab Sep 2, 2026 5/10
skill GitHub
Vendor-published skills that teach an agent the Terra wearable-data API. A good example of an API provider shipping skills instead of expecting the model to guess from docs.
apivendorwearablesskills
by tryterra Sep 2, 2026 5/10
skill GitHub
An agent skill for test suite cleanup that identifies and removes tests no longer earning their keep, then assembles a fast gate from what remains. Works in Claude Code and Codex CLI.
testingcleanupciskills
by NeuraCerebra-AI Sep 2, 2026 6/10
skill GitHub
Portuguese-language Claude Code skills for managing up: reviewing messages before you send them to a boss or senior stakeholder, and coaching on the underlying situation, grounded in Wes Kao's principles.
communicationcareerportugueseskills
by HelioFernandes404 Sep 2, 2026 5/10
skill GitHub
A collection of rule files that encode standards for TypeScript, architecture, React, Angular and accessibility, portable across Claude Code, Cursor, Windsurf and MCP clients. Standards as installable context rather than a wiki page nobody reads.
standardstypescriptreactaccessibility
by danielteles Sep 2, 2026 6/10
skill GitHub
An agent harness for data center site selection covering power, water, climate, land, connectivity, regulation, community and supply chain, where every number carries the tier of evidence behind it. Domain-specific, but the evidence-tier pattern generalizes.
researchinfrastructureevidenceharness
by not-vibhu Sep 2, 2026 5/10
skill GitHub
Agent skills for solid-js 2.x that suppress the React and Solid 1.x patterns models default to, covering writing new code, migrating old code, and reviewing. Useful template for any framework whose training data lags its current version.
solidjsfrontendmigrationskills
by khmm12 Sep 2, 2026 6/10
skill GitHub
A skill that coaches rather than silently rewrites, aimed at non-native speakers who want to understand why a phrasing reads oddly. Teaching-oriented rather than a one-shot polish pass.
writingenglishcoachingskills
by denys-petryniak Sep 2, 2026 5/10
skill GitHub
One skill checks Russian text for the tells of AI generation; the other writes from scratch while avoiding them. Split into detection and composition rather than a single rewrite pass.
russianwritingeditingskills
by IlyaChv Sep 2, 2026 5/10
skill GitHub
A Ukrainian counterpart to SimpleEnglish: a rule set for plain-language Ukrainian usable by both LLM agents and human writers. Fills a real gap in non-English writing guidance for agents.
ukrainianwritingplain-languageskills
by OpenMindUA Sep 2, 2026 5/10
skill Reddit
A skill that researches a company's actual screen from recent candidate reports, writes an original question in that shape, and opens a full interview repo with problem statement, solution stub, sample tests and a running clock. Hidden tests grade submissions without revealing which failed, and a Python engine owns every number the agent could hallucinate.
interviewpracticetestingskills
by Complex-Age1704 Sep 2, 2026 6/10
skill GitHub
A Claude Code plugin that walks machine setup, builds a recipe base verified on the actual engraver, and generates LightBurn files. Physical-world skill where the verification loop runs on hardware.
hardwarelaserlightburnskills
by robustagile Sep 2, 2026 5/10
skill GitHub
Skills that produce SVG interior scenes and hand-inked sketchnotes, scored by deterministic physics evals and metric arithmetic in a self-improving agent loop. The eval design is more interesting than the output.
svggenerativeevalsskills
by surendranb Sep 2, 2026 5/10
skill GitHub
Claude Code skills that adapt an existing LaTeX resume to a specific posting with fidelity as the constraint — reweighting and rephrasing what is there rather than inventing experience.
resumelatexjob-searchskills
by DhruvPrajapati4 Sep 2, 2026 6/10
skill GitHub
A free Claude Code skill covering the design decisions that make a REST API coherent, from route shape and status codes through pagination, error format, auth and rate limiting. Built on affaan-m's ECC.
apirestdesignskills
by agenticluke Sep 2, 2026 5/10
skill GitHub
Explicitly not a generator: a constraint set covering canon layering and prose tells for writing alternate-universe fiction with an LLM, in Chinese and English. Constrains an agent's editorial choices rather than producing text on demand.
writingfictionchineseconstraints
by sylviachangdou-prayer Sep 2, 2026 5/10
skill GitHub
A vendor-published skill collection and Claude plugin for the ColdBox platform. Narrow audience, but a useful reference for how a framework can ship agent context alongside its docs.
coldboxcfmlvendorskills
by ColdBox Sep 2, 2026 5/10
skill GitHub
A curated library of Claude Code subagents and skills installed idempotently by symlinking into ~/.claude. Frontmatter-driven and spec-compliant with both the Anthropic and Gemini schemas.
subagentsskillsinstallerlibrary
by jamestexas Sep 2, 2026 6/10
skill GitHub
A portable session-handoff skill that passes not just state but operating parameters: which model tier to use, solo or swarm mode, review depth, and whether to fan out subagents. Framework-agnostic, derived from metaswarm.
handoffsessionscontextskills
by shanemhamilton Sep 2, 2026 6/10
skill GitHub
Five self-contained Claude skills covering requirements interviews, turning brain dumps into structure, coaching beginners, authoring new skills, and auditing an existing skill library. Install docs for Claude Code, the Claude apps, Codex and ChatGPT.
skillsauthoringauditrequirements
by innovationengines Sep 2, 2026 5/10
skill GitHub
Two Claude Code skills that convert delegated UI work into a reviewable artifact — an interaction video, annotated stills, and a machine-checked verdict. Evidence you can review in seconds instead of pulling the branch.
uiverificationreviewvideo
by leonbeckert Sep 2, 2026 7/10
skill GitHub
A kit of security skills, slash command workflows, governed remediation, and runtime validation against authorized targets. Remediation is gated rather than applied autonomously.
securitywebremediationskills
by githubmofo Sep 2, 2026 6/10
skill Reddit
A component library built explicitly as agent context: 600+ structured components an agent can draw from when building UI, with an early prototype of agentic search over them. Author is asking for feedback on direction.
componentsuicontextlibrary
by BuffaloConscious7919 Sep 2, 2026 5/10
skill GitHub
Audits a live server's host, proxy, containers, datastore roles, DNS, CI pipeline and public HTTP surface without changing anything, then produces an evidence-backed report, an ordered fix plan, and guided remediation.
securityauditinfrastructureskills
by manuacl Sep 2, 2026 7/10
skill GitHub
A skill set covering debugging, CI failure triage, PR review and safe releases, built around requiring evidence at each step rather than accepting the agent's account of what it found.
debuggingcireleasesskills
by HumSaw Sep 2, 2026 6/10
skill GitHub
A curated set of Claude Code plugins maintained by Knitli. Small and opinionated rather than an exhaustive marketplace.
pluginscollectionmarketplace
by knitli Sep 2, 2026 5/10
skill GitHub
A reasoning framework plugin that gives Claude Code the failure-mode checklist for distributed systems — partial failure, ordering, idempotency, clock skew — so it reviews for the bugs models routinely miss.
distributed-systemsreviewarchitectureplugin
by Langerrr Sep 2, 2026 6/10
skill GitHub
An Agent Skill that scaffolds a complete help center from markdown files with no CMS. It generates static landing, category, tag and article pages in the Next.js App Router, plus ranked client-side search, locale fallback with hreflang, JSON-LD and a sitemap. A CI content validator keeps the frontmatter and slugs honest, so docs sites stay buildable as they grow.
skillnextjsdocumentationmarkdownstatic-siteseo
by timerise-ai Sep 2, 2026 6/10
skill GitHub
A portable review skill that runs several adversarial reviewer lanes over the same diff instead of a single pass. It ships as an Agent Skill, so the same package works in Claude Code, Codex, and Cursor. Useful if you want structured, opinionated review rather than one generic summary.
code-reviewskilladversarialportable
by ianpcook Sep 2, 2026 7/10
skill GitHub
A Python toolkit that turns arbitrary pixel-art images into clean game sprites, then generates new poses and animation frames from them. It comes with a Claude Code skill that encodes the full playbook, so the agent knows the pipeline rather than improvising it. Aimed at solo game devs who need sprite sheets without an artist.
gamedevpixel-artpythonskill
by isabellagreco1997 Sep 2, 2026 6/10
skill GitHub
Three general-purpose Claude Code skills in one repo: llm-council for multi-model deliberation, cc-changelog for generating changelogs from session history, and fal-image-generator for image generation via fal. Each is self-contained, so you can install only the one you need. A good sampler if you are starting a personal skills collection.
skillchangelogimage-generationmulti-model
by josefheld Sep 2, 2026 6/10
skill GitHub
A bundle of Claude Code skills organized around running models cost-effectively: secret scanning and commit gates, an eval harness, token-squeeze and compact-io for context control, and review skills like audit, skill-vet, and research-brief. Also includes a read-only advisor that proposes repo reorganizations without touching files. Broad enough to cherry-pick from.
skillsecurityevalcost-control
by Evan-Daruwalla Sep 2, 2026 7/10
skill GitHub
A skill that drives regression tests around AI features, API routes, and bug fixes, with both sandbox and live check modes. Built on affaan-m/ECC. Useful when nondeterministic model output makes ordinary test suites insufficient.
skilltestingregressionapi
by agenticluke Sep 2, 2026 6/10
skill Reddit
A recurring community argument laid out plainly: project description belongs in README, style constraints belong in rules, and build or deploy procedures belong in a skill, so CLAUDE.md may be duplicated context with no unique job. The thread is a useful frame for auditing your own CLAUDE.md. Relevant to anyone trimming context to save tokens.
claude-mdreadmediscussionconventions
by blender-bender Sep 2, 2026 5/10
skill Reddit
A free Claude Code plugin that sharpens raw ideas and decision drafts by running six subagents that each attack the text from a different angle. Aimed at thinking work rather than code, and deliberately unflattering.
pluginsubagentscritiquedecision-making
by danmakesthings Sep 1, 2026 7/10
skill Reddit
Claude Code can't hold both the Anthropic API and a local API in one process, so this pair of skills fits a local model on your machine, configures opencode to serve it, and teaches Claude Code to hand work off to a headless opencode worker. Written around Qwen3.8-27B to stretch a subscription further.
skilllocal-modelsopencodedelegationcost-saving
by SailingToFenway Sep 1, 2026 7/10
skill GitHub
Extends OpenSpec's spec-driven development with skills covering discovery, requirements, design decisions, execution planning, and execution itself. Harness-neutral — works with Claude Code, OpenCode, GitHub Copilot, and other coding agents.
skillspec-drivenopenspecplanning
by sudokar Sep 1, 2026 7/10
skill GitHub
Nine Claude Skills for evaluating AI systems, including the skills you install to do that evaluating. Each one carries an explicit refusal condition, so the skill declines rather than guessing when it is out of its depth.
skillevaluationrefusalshonesty
by ityaadiii Sep 1, 2026 7/10
skill GitHub
Agent skills for machine learning in algorithmic trading, focused on avoiding lookahead leakage, plus backtesting, validation, and autonomous research workflows. Aimed at people applying ML to markets rather than general coding.
skillquanttradingbacktestingml
by ml4t Sep 1, 2026 6/10
skill GitHub
A Claude Code skill that files loose incoming schedule information into a single one-page HTML timetable that renders correctly inside email clients. Documented in Chinese.
skillschedulinghtmlemail
by Zaosusu Sep 1, 2026 5/10
skill GitHub
A skill that hunts a specific bug class — the thing that should happen once happening twice, and the thing that was already over happening again. Double submits, re-entrant handlers, and races triggered by users who don't wait.
skilltestingrace-conditionsqa
by Nova-47 Sep 1, 2026 7/10
skill GitHub
A design-and-review skill for building command-line tools that work equally well for people typing them, AI agents calling them, and orchestration systems wiring them together. Covers the design pass and the review pass.
skillcli-designagent-nativereview
by Agents365-ai Sep 1, 2026 7/10
skill GitHub
Renders MIDI into polished piano-roll images in either vertical Synthesia style or horizontal DAW style, with chord labels and automatic key detection. Useful when an agent needs to show musical structure visually.
midimusicvisualizationrendering
by flobo3 Sep 1, 2026 5/10
skill GitHub
Catalogues the ways touch gestures fight each other — drag versus scroll, tap versus long-press, and the rest — as a matrix an agent can check a UI against. Aimed at mobile and touch interfaces where these conflicts are easy to ship by accident.
skilluxtouchmobilegestures
by saramjh Sep 1, 2026 6/10
skill GitHub
Prototype on a local canvas made of plain HTML artboards — drop a file in a folder and it renders, with no design tool and no build step. Every color and metric in the output traces back to an actual measurement of the source UI.
skillprototypingui-designhtml
by ReScienceLab Sep 1, 2026 6/10
skill GitHub
Explains embedded C/C++ modules, RTOS behaviour, drivers, interrupts, DMA, and low-power flows, generating Markdown or HTML docs with call graphs. Written for junior engineers who can read code line by line but lack hardware intuition. Supports Claude Code with optional Codex hooks.
skillembeddedcrtosdocumentation
by gc9768 Sep 1, 2026 6/10
skill GitHub
A cross-tool command layer that lets any Agent Skills host — Claude Code, Codex, OpenCode, Trae, DSH — command the XiaoyaoClaw/OpenClaw multi-agent gateway. Bilingual Chinese/English.
skillmulti-agentgatewaycross-tool
by dtsola Sep 1, 2026 5/10
skill GitHub
Claude skills that take script-based Reels and TikToks from idea through to a rendered video, including automatic editing via Remotion. Covers the whole pipeline rather than just the writing.
skillvideoremotioncontent-creationsocial-media
by bendemartin97 Sep 1, 2026 6/10
skill GitHub
Targets the failure where a session degrades and crashes around the seventh exchange. Applies context engineering to Claude Code so long sessions keep going and tasks actually get finished.
skillcontext-engineeringlong-sessionsreliability
by alekspetrov Sep 1, 2026 7/10
skill GitHub
A personal set of portable Agent Skills following the .agents/skills spec — ui-review, codegraph-project-setup, and agent-config — kept in one central repo and registered globally through OpenCode's skills array rather than copied into each project. Documented in German.
skillportableopencodeagent-skills-spec
by reisi007 Sep 1, 2026 5/10
skill GitHub
A Chinese-language guide to 37 Matt Pocock skills for newcomers to AI-assisted development, with an anonymized UI client example plus Excalidraw and hand-drawn diagrams.
skillguidechineselearningmatt-pocock
by TeFuirnever Sep 1, 2026 6/10
skill GitHub
A plugin for searching, analyzing, and tech-matching projects on the Korean freelance platform Wishket, running across Claude Code, Codex, Antigravity, and Hermes.
pluginfreelancekoreanmulti-host
by epicsagas Sep 1, 2026 5/10
skill GitHub
Drop in videos, client calls, PDFs, and emails, and it writes a sourced business context file for your agent locally, without you typing it out. Documented in French.
skillcontexttranscriptionlocal-firstfrench
by junudah Sep 1, 2026 5/10
skill GitHub
A knowledge base covering the Yingdao xbot coding-edition API, RPA automation, browser control, and Excel/WPS work, packaged for Claude Code and Codex. Documented in Chinese.
knowledge-baserpaautomationchinese
by apexcheng Sep 1, 2026 5/10
skill GitHub
An interactive learning system built on Bloom's 2 sigma problem — adaptive one-on-one tutoring delivered as a Claude Code skill. Documented in Chinese.
skilleducationtutoringadaptive-learningchinese
by CyanDR21 Sep 1, 2026 6/10
skill GitHub
Screenshot audits, photo strategy, prompt writing, and settings advice for Hinge profiles, grounded in published research. Runs under ChatGPT, Codex, or Claude Code.
skilldatingprofileaudit
by b1rdmania Sep 1, 2026 5/10
skill GitHub
A general-purpose collection of agent skills spanning research, coding, writing, analysis, automation, and routine workflows.
skillcollectiongeneral-purpose
by leomajewski Sep 1, 2026 5/10
skill GitHub
Diagnoses code decay risk with citations back to twelve classic software engineering books, applying severity labels across six analysis modes including a full-sweep auto-fix. Arguments come with a source rather than a vibe.
skillcode-reviewcitationstechnical-debt
by hyhmrright Sep 1, 2026 7/10
skill GitHub
Searches papers, GitHub, teams, and community channels, cross-verifies candidates, and writes them to Excel with a persistent candidate library and a weekly talent radar. Works with Claude Code, WorkBuddy, and any SKILL.md host.
skillrecruitingsourcingresearchexcel
by cw20051219-commits Sep 1, 2026 6/10
skill GitHub
Strips padding and filler from generated prose. Small, single-purpose, and aimed at the verbosity that creeps into agent output.
skillwritingconcisionediting
by 0xyph3r Sep 1, 2026 5/10
skill GitHub
Explains a diff in plain human language, in either a "for dummies" narrative or a per-file walkthrough. For handing changes to people who need to approve them but don't read code.
skillexplanationcode-reviewcommunication
by MotleyWildside Sep 1, 2026 6/10
skill GitHub
Skills for agentic coding CLIs aimed at two things at once — work that was worth doing, and output finished enough that reviewing it doesn't cost more than writing it would have.
skillqualityreviewagentic-cli
by doodledood Sep 1, 2026 6/10
skill GitHub
A toolkit for the Open Knowledge Format — authoring, maintaining, validating, and visualizing OKF bundles — shipped as a Claude Code plugin, a set of agent skills, and a GitHub Action.
skillokfknowledge-formatgithub-actionplugin
by scaccogatto Sep 1, 2026 6/10
skill GitHub
Turns your saved Google Maps places into a personal dining knowledge base and gives eating-out recommendations matched to the taste that history implies.
skillgoogle-mapsrecommendationspersonal-data
by ddalgrande Sep 1, 2026 5/10
skill GitHub
Cheapest-date search, fare watching, trip planning, hotel search, and rate-parity monitoring against live pricing. Works over MCP or plain REST, so it isn't tied to one harness.
skilltravelflightshotelspricing
by mtnrabi Sep 1, 2026 6/10
skill GitHub
A Claude skill for surveying real compensation in a market before you apply to it, shipped alongside a stipend survey of nine Indian job boards that found 89% of advertised embedded internships unpaid.
skilljob-searchresearchcompensation
by Shiviansh Sep 1, 2026 5/10
skill GitHub
SEO and AI-visibility skills for coding agents that bundle the underlying data, billed per check in USDC on Solana via x402 rather than requiring an API key or subscription.
skillseox402micropaymentssolana
by zaialamm Sep 1, 2026 5/10
skill GitHub
A design system for agents producing HTML presentations, styled like a book rather than a slide deck, and portable across projects.
skillpresentationshtmldesign-system
by pherehouse Sep 1, 2026 6/10
skill GitHub
Writes, updates, and checks Swedish accessibility statements against Digg's templates and the relevant law — DOS-lagen, MDFFS 2019:2, and EN 301 549/WCAG.
skillaccessibilitycomplianceswedishwcag
by pattespatte Sep 1, 2026 5/10
skill GitHub
Nine Claude Code skills covering Lovable, Supabase, Stripe, accessibility under Israeli and EU law, and a Hebrew writing standard — the stack for shipping a real product rather than a demo.
skillsupabasestripeaccessibilityhebrew
by gidila91 Sep 1, 2026 6/10
skill GitHub
An agent skill over the Zinc API for searching, buying, tracking, and returning items across Amazon, Walmart, Target, and more than 50 other US retailers. Anything with a product URL is purchasable.
skillcommerceshoppingzinc-apiautomation
by zincio Sep 1, 2026 6/10
skill GitHub
A skill built from a corpus study of Claude's own writing tics. Its thesis is to name the referent rather than ban the words, which fixes the vagueness that word-level style rules leave behind.
skillwritingreportscommunicationstyle
by YuanpingSong Sep 1, 2026 7/10
skill GitHub
An illustration skill with fourteen style families and a deep variant library, seven-dimension prompt optimization, meta-prompt authoring, and local memory of your creative preferences. Documented in Chinese.
skillillustrationimage-generationpromptingchinese
by taxueseek Sep 1, 2026 5/10
skill GitHub
Writes and revises Italian state legislative texts under the drafting conventions actually in force. A narrow, high-stakes domain skill. Documented in Italian.
skilllegallegislationitaliandrafting
by gmessori Sep 1, 2026 5/10
skill GitHub
An AI-agnostic project template: a single AGENTS.md every coding agent reads, one `npm run gate` that works regardless of language, and a 70-entry framework registry (Laravel, Next.js, NestJS, Tauri, Electron, Flutter, Spring Boot and more) that detects your stack and writes the commands for you.
templateagents-mdframework-detectionpolyglot
by ahnafudin Sep 1, 2026 7/10
skill GitHub
Summarizes videos, audio files, and podcasts using local transcription with a cache, so repeat runs over the same media don't re-transcribe or leave the machine.
skilltranscriptionsummarizationlocal-firstpodcasts
by AugustusW Sep 1, 2026 6/10
skill GitHub
Moves an in-progress conversation between Claude Code, Codex, and Claude mobile without writing handoff notes — you just say to pick up where you left off. Documented in Japanese and English.
skillhandoffcross-harnesssession-continuity
by shoujiki-panman Sep 1, 2026 7/10
skill GitHub
Lets an agent diagnose, clean up, and migrate Windows storage safely, built on WizTree for the scanning. Guards the destructive half of disk work rather than trusting the agent with rm.
skillwindowsstoragecleanupsafety
by tzzs Sep 1, 2026 5/10
skill GitHub
Twenty-two instructional skills that teach market and competitive intelligence as collection disciplines rather than one-off research, aimed at product managers, product marketers, and business analysts.
skillmarket-researchcompetitive-intelligenceproduct-management
by Productside Sep 1, 2026 5/10
skill GitHub
Turns a brainstorm into an interactive mind map of inverted assumptions. Deliberately offers no answers and no ranking — only provocations to push against.
skillbrainstormingmind-mapideation
by ara-mkr Sep 1, 2026 6/10
skill GitHub
An editing skill that strips the giveaways of machine-written prose while preserving the writer's own voice. Runs under Claude Code, claude.ai, or any capable model.
skillwritingeditinghumanizingstyle
by erikkurtu Sep 1, 2026 6/10
skill GitHub
Written for getting rate-limited mid-task or locked into one harness by the context it holds. Keeps task state in plain markdown recorded ahead of the work rather than at exit, so any agent can resume cold. Works with Claude Code, Codex, and Cursor.
skillstatehandoffrate-limitscross-harness
by johnwangwyx Sep 1, 2026 7/10
skill GitHub
Skills aimed at the executive layer rather than the engineering one, structured around thinking clearly about AI decisions instead of producing artifacts.
skillexecutivestrategydecision-making
by iceberg-tribe Sep 1, 2026 5/10
skill GitHub
A safety-oriented coding skill built around evals first — small task decomposition, explicit risk checks, and routing work to an appropriate model. Built on affaan-m/ECC.
skillevalstestingriskmodel-routing
by agenticluke Sep 1, 2026 6/10
skill GitHub
A capability-routed, evidence-first skill covering ideation, literature review, statistics, figures, writing, peer review, rebuttals, theses, and paper-to-slide conversion — most of the academic pipeline in one place.
skillacademicwritingresearchpeer-review
by xcl2005 Sep 1, 2026 6/10
skill GitHub
A Claude Code skill for Ecko, a language that treats ai as a first-class keyword. Every code sample in the skill is executed before it ships, so the examples are known to run.
skillprogramming-languageeckoverified-examples
by ecko-lang Sep 1, 2026 5/10
skill GitHub
A plugin of agent skills that wires AgentHog analytics into your app, sets up A/B tests, and writes live reports on the results, all from inside Claude Code.
skillanalyticsab-testinginstrumentationplugin
by AnniesAI Sep 1, 2026 6/10
skill GitHub
Audits and reorganizes the shared project folders that several AI agents write into, which drift into a mess quickly when nobody owns the layout.
skillhousekeepingmulti-agentfile-organization
by JesseRaber Sep 1, 2026 6/10
skill GitHub
An assistant persona that asks when a request is ambiguous, distinguishes its own conclusions from yours, and objects on substance rather than agreeing. Ships in two builds: Claude Code/Cowork and Codex/ChatGPT Work. Documented in Russian.
skillassistantpersonapushbackrussian
by Coman-os Sep 1, 2026 5/10
skill GitHub
Takes apart an existing web interface, mirrors it visually, and rebrands it — a cloning engine for when you want to start from a known-good layout rather than a blank page.
skilluicloningrebrandingweb-design
by khan-masud Sep 1, 2026 6/10
skill GitHub
A Claude Code toolchain and skill that emits Hello Elementor child themes with pages built for Elementor Free, so WordPress output lands in the ecosystem the site already uses.
skillwordpresselementorthemes
by md786-dotcom Sep 1, 2026 6/10
skill GitHub
Performance-first AGENTS.md and CLAUDE.md profiles matched to MacBooks from 8 GB to 128 GB, so the agent's parallelism and tooling assumptions fit the machine it's actually on.
claude-mdagents-mdmacosperformanceconfiguration
by saitakarcesme Sep 1, 2026 6/10
skill GitHub
Generates interactive HTML pages for product, website, and brand decisions, with multi-select pills, notes, autosave, export, and a live design lab. Deliberately not a back-and-forth chat questionnaire.
skillbrainstorminghtmldecisionsinteractive
by lareesahu Sep 1, 2026 6/10
skill GitHub
A Claude skill that runs credit card workflows through Koko — searching, comparing, and analyzing cards against a real dataset rather than model recall.
skillfinancecredit-cardscomparison
by KokoFinance Sep 1, 2026 5/10
skill GitHub
A Claude Code skill for a persistent multi-agent setup backed by file-based memory and local task tracking, so the system survives past a single session. Built on affaan-m/ECC.
skillmulti-agentmemorytaskspersistence
by agenticluke Sep 1, 2026 6/10
skill GitHub
Routes implementation work orders to the Kimi Code CLI while Claude keeps the thinking and verification. A port of steipete's codex-first to Kimi.
skilldelegationkimicost-savingverification
by boringmarketer Sep 1, 2026 7/10
skill GitHub
An agent skill plus a deterministic runner that spends quota you're about to lose on your actual backlog, hard-stopping before the reset. Burns down work rather than tokens.
skillquotabacklogautomationrate-limits
by steven-pku Sep 1, 2026 7/10
skill GitHub
Interviews you about the business, mines public buyer language, and returns evidence-labeled findings with a ranked action plan. Free, no signup, and works with Claude, Codex, or any assistant.
skillmarket-researchevidencefree
by rogueduda Sep 1, 2026 6/10
skill GitHub
A guide for getting past the fear of working alongside Claude Code, focused on developing with control and good practices rather than hoping the output is right. Documented in Spanish.
guidebest-practicesspanishonboarding
by OrcaCl Sep 1, 2026 5/10
skill GitHub
An agent skill that turns raw data, a written description, or a table you pasted into a polished interactive chart rendered directly in the conversation.
skillchartsvisualizationdata
by sses79 Sep 1, 2026 6/10
skill GitHub
Agent skills over MillionSend covering sending email, managing contacts, and running broadcasts, with a self-hosting path if you don't want the service holding your list.
skillemailcontactsbroadcastsself-host
by MillionSend Sep 1, 2026 5/10
skill GitHub
A skill pack aimed at Chinese-language workflows: translating docs to Chinese, downloaders for WeChat, Xiaohongshu, and X, repo hygiene checks, and GPT-image prompt helpers. Installs with a single `npx skills add` command and works across Claude Code and Codex.
skillschinesei18ntranslationcontent-tools
by hanzhangzzz Sep 1, 2026 6/10
skill GitHub
A Claude Code skill encoding a security-audit process for Streamlit Community Cloud apps backed by Supabase or Postgres. It ships threat modeling, ten stack-specific traps the author actually hit in production, and four verification approaches. Documentation is bilingual (Chinese and English).
skillsecuritystreamlitsupabaseauditpostgres
by lml679939-cmyk Sep 1, 2026 6/10
skill GitHub
A portable agent skill that audits a web app on two axes — a 39-point security checklist and launch readiness covering legal, auth, polish, and retention — then reports each gap with its fix and implements them. Coverage is deepest on the Supabase, Vercel, and Stripe stack.
skillsecurityauditlaunch-checklistsupabasevercelstripe
by cryptozachla Sep 1, 2026 7/10
skill GitHub
Gives a project the roles and ceremonies of a senior software team — planning, review, and delivery discipline — without needing other people. Aimed at solo developers who want structure and checkpoints instead of an unbroken stream of ad hoc prompts.
skillagileplanningprocesssolo-devsubagents
by thecoderbuddy Sep 1, 2026 6/10
skill GitHub
A drop-in .claude/ directory bundling 16 skills, 5 subagents, 4 slash commands, and MCP server config. Its distinguishing idea is a multi-agent review policy where no agent reviews its own work, so critique always comes from a fresh context. A quick way to bootstrap a structured Claude Code setup instead of assembling one piece by piece.
skillssubagentscommandscode-reviewstarter-kit
by mateusands Sep 1, 2026 7/10
skill GitHub
A set of Claude Code skills covering intermediate-to-advanced Rust: ownership, concurrency, unsafe code, FFI, and API design. The material is adapted from Google's Comprehensive Rust course, so the guidance follows an established curriculum rather than ad-hoc notes. Gives the agent concrete reference material when working in Rust codebases.
rustskillsownershipconcurrencyffi
by takurot Sep 1, 2026 7/10
skill Reddit
A set of local CLI wrappers (mvn-lite, npm-lite, go-lite) that run the real build and test tools but collapse successful runs into a compact result, with full diagnostics preserved on failure. The author measured 98-99.99% output reduction on green runs, including one test that dropped from 1,476 lines to a single line. A companion lite-tools skill teaches Claude Code when to reach for the wrappers.
context-windowbuild-toolstestingcliskills
by fykup Sep 1, 2026 8/10
skill GitHub
Indexes your coding agent's memory directory into a local Mnemosyne OS vault and makes it searchable by meaning rather than filename. Because recall goes through search, the memory store can grow past what fits in a context window. Aimed at agents whose memory files have outgrown being loaded wholesale each session.
memorysemantic-searchvaultlocal-firstskills
by Mnemosyne-OS Sep 1, 2026 7/10
skill GitHub
An agent skill for feature specs spread across several documents, keeping a single facts registry so the docs cannot contradict each other. Mechanical audits catch drift, and a verify mode refuses to mark something shipped until there is evidence behind the claim. Built for teams where agent-written specs outpace anyone's ability to read them all.
specsdocumentationverificationauditskills
by CesarRivasP Sep 1, 2026 7/10
skill Reddit
A slash-command skill that constrains Opus 5 toward Sonnet-like behavior: fewer status messages, less overengineering, less overthinking. The author reports roughly 37% fewer messages in a controlled test and says it stacks with their /hush skill. Worth a look if you find Opus chatty on routine tasks.
skillsopusverbositypromptingslash-commands
by Jonathanproductions Sep 1, 2026 6/10
skill GitHub
A command-line SEO audit tool packaged as a Claude Code skill, applying 108 rules across 12 categories to any site. Covers SEO best practices, Core Web Vitals, security headers, structured data and accessibility. Gives an agent a concrete rubric instead of vague 'improve the SEO' instructions.
seoauditcliweb
by seo-skills Aug 31, 2026 6/10
skill GitHub
Surfaces Claude Code usage limits to the model rather than only to you, so every reply is planned around what actually fits in the remaining budget. The idea is to avoid starting work the session cannot finish before the quota resets.
usage-limitsquotacontextplanning
by ridelink0 Aug 31, 2026 6/10
skill GitHub
A skill that maps out essential cybersecurity and reverse engineering topics as a structured learning path. Aimed at using an agent as a study guide through a large, poorly-ordered field rather than as an exploit tool.
securityreverse-engineeringlearningskill
by Saprophytic-seattle561 Aug 31, 2026 5/10
skill GitHub
A Claude Code skill that reframes the session as a quota-conscious orchestrator: it plans at a high level and hands implementation work to cheaper AI CLIs (Codex, Grok) invoked directly as subagents. Aimed at users who hit Claude limits on long builds but want to keep the planning quality.
orchestrationsubagentsquotamulti-model
by Taleef7 Aug 31, 2026 6/10
skill GitHub
A small set of reusable SKILL.md agent skills covering application planning, adversarial review of work, and adjudication between conflicting outputs. The adversarial review and adjudication pair is useful if you run multiple agents and need a tie-breaker.
skillsreviewplanningadversarial
by JacobStephens2 Aug 31, 2026 5/10
skill GitHub
A skill that does a curl-first source capture of a target site, reads the code deeply, verifies findings against the live page, and emits a spec detailed enough to rebuild the site pixel-for-pixel. Useful for competitive analysis or reconstructing a design you only have in production.
webanalysisspecreverse-engineering
by vb-tyagi Aug 31, 2026 7/10
skill GitHub
A Portuguese-language Claude Code starter kit installable with a single command: global rules, settings, skills, slash commands, teaching docs, and CI/Playwright templates. Built for mentees being onboarded onto Claude Code, so it doubles as a curriculum.
starter-kitportugueseonboardingtemplates
by VAMOO-AI Aug 31, 2026 5/10
skill GitHub
A plugin bundling a curated set of AI skills oriented toward research and implementation work. Packaged as one install rather than assembling skills individually.
pluginskillsresearchbundle
by proyecto26 Aug 31, 2026 5/10
skill GitHub
A Chinese-language productivity pack that turns Claude Code or Codex into a 'digital employee' for office work: six skills, protective hooks, and workflow SOPs. Aimed at non-engineering knowledge work rather than coding.
chineseskillshooksproductivity
by Hahaknight Aug 31, 2026 5/10
skill GitHub
A Claude Code plugin marketplace aimed at research and clinical work: grant review, critical-care consults, citation verification, fabrication auditing and prompt optimization. The citation-verification and fabrication-audit plugins are broadly useful outside that niche.
pluginsresearchcitationsmarketplace
by neelshah4 Aug 31, 2026 6/10
skill GitHub
A Claude Skill that takes a rough idea to a finished claymation-style video ad: brief, plan, style lock, keyframe stills, video clips and audio. Each phase ends at a review checkpoint, so the pipeline cannot run away with your budget.
videocreativegated-workflowads
by likeitdigital Aug 31, 2026 6/10
skill GitHub
A DAX reference written for AI agents rather than humans: every function with its signature and semantics, plus the gotchas the official documentation leaves out. Drop-in context for agents working on Power BI models.
daxpower-bireferencecontext
by CSalcedoDataBI Aug 31, 2026 5/10
skill GitHub
A Claude Code skill marketplace centered on agent and prompt-engineering skills, headlined by agent-prompt-author. Installable via /plugin or npx skills.
marketplaceskillsprompt-engineeringplugin
by amylyra Aug 31, 2026 5/10
skill GitHub
Bootstrap and session scripts for Claude Code cloud environments: a setup-script body plus a SessionStart hook. A working starting point if you are standing up cloud sessions and need the environment prepared consistently.
cloudbootstrapsessionstarthooks
by LukeEvansTech Aug 31, 2026 6/10
skill Reddit
A short global CLAUDE.md response-style section instructing brief, request-specific answers with no excess explanation, leaving follow-up detail to the user to request. The author reports responses became markedly tighter afterwards. A minimal config tweak worth trying before reaching for heavier prompt engineering.
claude-mdverbosityconfigurationprompting
by Anxious-Turnover-631 Aug 31, 2026 6/10
skill Reddit
Turns the vague prompt "make this production ready" into an explicit checklist skill covering security, auth, dead code, tests, deployment, backups, privacy policy, rate limits, dependency vulnerabilities and half-finished features. Replaces the giant ad-hoc prompt chains people write after Claude finishes building. Open source.
production-readinesschecklistsecurityshipping
by jacobpowaza Aug 31, 2026 7/10
skill Reddit
Meta's targeting IDs are 13-16 digit numbers that can't be guessed from an interest name, and no Meta Ads MCP tool returns them — so agents get 90% of a campaign built and stall on the audience. The author wrote two skills to close that gap, then found two bugs only by actually executing them. Worth reading for the testing lesson as much as the skills.
meta-adsmarketingskill-authoringtesting
by PerformanceTimely356 Aug 31, 2026 6/10
skill Reddit
One skill renders a repository into a single-file HTML slide deck; the other reports later which slides no longer match the code. Every claim records its source file, exact line range and a hash of those lines, so checking is plain standard-library Python — no model, no network, no tokens. It distinguishes MOVED from genuinely changed content, making it cheap enough to run on every pull request.
documentationdrift-detectionslidesci
by stack_underfl0w Aug 31, 2026 7/10
skill GitHub
A Spec Kit-inspired skill pack that keeps project governance in a local .pm directory so coding agents can see priorities instead of guessing. Turns a backlog into something an agent can act on within a session. Works across AI coding agents rather than being Claude-only.
project-managementgovernancespec-drivenskills
by wei63w Aug 31, 2026 5/10
skill GitHub
A collection of product design-focused agent skills usable from Claude Code and the Antigravity IDE. Targets the design side of the workflow rather than pure implementation. Useful if you want design reasoning inside the same agent session as the code.
product-designskillsantigravity
by Uwayxt Aug 31, 2026 5/10
skill GitHub
An Agent Skill for Claude Code that surfaces the code that actually matters for a task, matching semantically rather than on identifier names. Reduces the amount of repo the agent has to read before it can act. Drops in as a skill with no separate service.
semantic-searchcontextcode-navigationskills
by choiHkk Aug 31, 2026 6/10
skill GitHub
Claude Code skills built for IWE that treat a markdown knowledge base as a graph rather than a pile of files. Supports navigating and refactoring across note links safely. Aimed at people whose notes are a real structure, not just a folder.
knowledge-basemarkdownrefactoringskills
by iwe-org Aug 31, 2026 5/10
skill GitHub
An agent skill that translates prototypes produced in Claude Code into proper WordPress Gutenberg full-site-editing themes. Bridges the usual gap between an agent-built mockup and something WordPress can actually ship. Narrow but well-scoped.
wordpressgutenbergthemesskills
by vicunav Aug 31, 2026 5/10
skill GitHub
Audits a codebase for production readiness and requires evidence for each finding rather than asserting problems. Installs in one command via the skills CLI and works globally across projects. A counterweight to agents declaring work done without proof.
auditproduction-readinessevidenceskills
by pedroknigge Aug 31, 2026 6/10
skill GitHub
Routes multi-device health data for Claude Code so overlapping Oura and Garmin metrics aren't double-counted, naively averaged or overclaimed. Handles the reconciliation logic that trips up naive health-data agents. Narrow domain, careful design.
healthdata-reconciliationouragarmin
by drleahzou Aug 31, 2026 5/10
skill GitHub
A Claude Skill that does real web research from a CV and produces a structured bilingual Excel file of companies to target. Scores fit against your actual skills rather than generic "hires fresh grads" heuristics, and estimates per-company salary. Ends with an actionable shortlist.
job-searchresearchexcelskills
by omar-abo-el-maaty Aug 31, 2026 5/10
skill GitHub
Connects opportunity discovery, application progress, experience mining, CV tailoring, interview prep and retrospectives through seven Agent Skills backed by a Feishu workspace. Supports Codex, Claude Code, Hermes Agent and WorkBuddy. Documentation is primarily in Chinese.
job-searchskillsfeishuopen-source
by riwonswain-ovo Aug 31, 2026 5/10
skill GitHub
A Claude Code skill with 52 block forms, an enforced word budget, and guards that fail the build when the output drifts from spec. The constraints are the point — they stop the model producing wall-of-text "infographics". Output is a designed explainer rather than a slide dump.
infographicdesignvisualizationskills
by remybroun Aug 31, 2026 6/10
skill GitHub
A Claude Code skill for closing out and handing over multi-workstream sessions, keeping an additive log of live handoffs. Because entries are appended rather than replaced, parallel sessions don't clobber each other's context. Documentation is in Spanish.
handoffmulti-sessioncontextskills
by PieroJF Aug 31, 2026 5/10
skill GitHub
An agent skill running an R0-R3 review loop — review, fix, re-review — until the code genuinely converges, backed by four layers of anti-overfit protection. Designed against the failure mode where an LLM declares convergence it hasn't reached. Bilingual English/Chinese docs.
code-reviewverificationconvergenceskills
by 1273984347 Aug 31, 2026 6/10
skill GitHub
Runs a memory audit, a doc-sync spot check and a six-facet status matrix at the end of a session. Its "verification iron law" is never to trust an "it's done" claim without evidence. Pairs naturally with handoff and retro skills.
session-managementmemoryverificationskills
by 1273984347 Aug 31, 2026 6/10
skill GitHub
An agent skill offering a three-question quick check or an eleven-dimension full retrospective, promoting findings from experience to pattern to heuristic to policy. The goal is that a mistake made once becomes a rule that prevents it recurring. Bilingual docs.
retrospectivelearningheuristicsskills
by 1273984347 Aug 31, 2026 5/10
skill GitHub
/start-session snapshots the working tree, agrees a scope, and picks between main, a branch or a git worktree. /end-session works out which dirty files are actually yours, closes loose ends, and writes the handoff before you archive. Solves a real problem for anyone running several agents against one repository.
parallel-sessionsworktreehandoffskills
by edwardyen724-g Aug 31, 2026 7/10
skill GitHub
Lifecycle skills, a per-project adapter contract and a cross-platform installer, distilled from a real Next.js boilerplate. The adapter contract is the interesting part: it lets one skill library work across differently shaped projects. Versioned so upgrades are tractable.
skill-librarylifecycleinstallerportable
by jrittelmeyer Aug 31, 2026 5/10
skill GitHub
Acts as a resident engineer for a repository, surfacing the pitfalls you already documented before the agent starts editing. It also warns when the file you're editing isn't the one that's actually running — a classic source of wasted sessions. Works with any AI assistant.
guardrailsrepo-contextonboarding
by chester0 Aug 31, 2026 6/10
skill GitHub
Nine signals that three AI judges independently named after blind-scoring 50 samples, then measured again in a second blind test. Two files, portable to Claude Code, Codex, Gemini or any chat. The methodology is more rigorous than most writing skills.
creative-writingevaluationblind-testskills
by Ptlimited Aug 31, 2026 6/10
skill GitHub
A curated collection of skills connecting AI agents to more than 340 SaaS APIs. Saves writing the same integration boilerplate repeatedly. Breadth is the selling point; depth will vary by platform.
saasapi-integrationskillscollection
by Simplex-june29108 Aug 31, 2026 6/10
skill GitHub
Wraps the Resemble detection platform as an agent skill so a pipeline can check whether media is synthetic. Useful in moderation, journalism or verification workflows. Requires a Resemble account.
deepfake-detectionmediaverificationskills
by Hampto7114 Aug 31, 2026 5/10
skill GitHub
Covers development, DevOps, QA, data, security and business operations with subagent definitions intended for real use rather than demos. The governance framing means each subagent has defined scope. A large drop-in library.
subagentscollectiondevopsgovernance
by jaydubya818 Aug 31, 2026 6/10
skill GitHub
Covers guarded autonomy, visible sessions, spec-driven development, decision records, root-cause analysis, evaluation and knowledge retention. Portable across harnesses rather than tied to one. A broad but coherent methodology pack.
skillssddrcaknowledge
by nobrainer-tech Aug 31, 2026 5/10
skill GitHub
Covers research, product ops, QA, release gates and decisions across Claude Code, Cursor and Codex. The routing evals are unusual — they test whether the right skill actually gets picked, not just whether each skill works. Testing rigor well above the norm for skill collections.
skillstestingroutingevals
by MaciejZet Aug 31, 2026 6/10
skill GitHub
Creates and evaluates sticky content using the frameworks from Contagious and Made to Stick rather than generic "write a viral post" prompting. Works with both Claude and ChatGPT. The evaluation half is the more useful part.
contentmarketingframeworksskills
by trananhtung Aug 31, 2026 5/10
skill GitHub
Analyzes an unstaged mess and proposes atomic commits with real messages, showing the plan before anything moves. Available as both a Claude Code skill and a standalone CLI. Directly addresses the sprawling single commit that agent sessions tend to produce.
gitcommitsrefactoringcli
by dcadolph Aug 31, 2026 7/10
skill GitHub
Checks whether a Dependabot vulnerability is actually reachable in your code before a fix PR exists, rather than ranking by CVSS score alone. Cuts the noise that makes teams ignore alert queues entirely. A focused, high-value security skill.
securitydependabotvulnerabilitiestriage
by iamravenous Aug 31, 2026 7/10
skill GitHub
Keyword research, rank tracking, site audits, backlinks, competitor gaps and AI visibility, running against your actual Search Console, GA4 and ads data via MCP with DataForSEO built in. Working from real data rather than scraped estimates is the differentiator. Free and MIT licensed.
seogeomcpanalytics
by Ryze-AI-Adgent Aug 31, 2026 6/10
skill GitHub
Produces PNGs, a LinkedIn-ready PDF, captions, alt text and a review page from a single blog post. The review page means you check before publishing rather than after. Covers the whole handoff to posting.
social-mediacarousellinkedinskills
by moihars Aug 31, 2026 5/10
skill GitHub
Gates for AI-assisted development covering traceability from spec to test, fixes guarded against regression, quality metrics and a commit gate. Ships as agent skills for both Claude Code and GitHub Copilot. Focused on making "done" mean something measurable.
gatestraceabilitytestingcopilot
by jam7 Aug 31, 2026 6/10
skill GitHub
Gives agents the structured access needed to investigate container and infrastructure issues rather than guessing from error strings. Covers diagnosis through to applying fixes. Useful when the failure is in the environment, not the code.
dockerdiagnosticsinfrastructureskills
by PunGrumpy Aug 31, 2026 6/10
skill GitHub
Combines superpowers methodology, YAGNI minimalism, searchable cross-chat memory and adversarial trap-suite evals. Hermes-compatible skills work in OMP, Claude Code, Gemini CLI, Hermes, Antigravity and ZCode. The trap suites test whether the agent resists bad instructions.
memorysqliteevalsportable
by oleg494 Aug 31, 2026 6/10
skill GitHub
Covers open-source release, adversarial debate, documentation hygiene, WeChat public-account automation, Feishu notes and email readiness checks. These are the author's own daily-use skills rather than a curated demo set. Documentation is in Chinese.
skillscollectionwechatfeishu
by kuangketongxue Aug 31, 2026 5/10
skill GitHub
Turns all nine 2026 lectures of MIT's The Missing Semester into reusable agent skills, installable in one step to Claude Code, dsh, OpenCode or Codex. Covers the practical tooling knowledge formal CS courses skip. Bilingual English/Chinese.
educationskillsmittooling
by AntheaLaffy Aug 31, 2026 6/10
skill GitHub
Applies a specific, published body of design thinking to UI/UX review rather than generic "make it prettier" feedback. Portable to any AI harness. Unofficial and clearly labelled as such.
designui-uxreviewskills
by nerdstalker Aug 31, 2026 6/10
skill GitHub
Combines a production-grade skill collection with an MCP server directory and a command-palette-driven store for installing them. Works with OpenCode, Claude Code, Codex and Gemini CLI. Discovery UX is the differentiator over a plain repo of skills.
skillsmcp-directorymarketplacecollection
by marktantongco Aug 31, 2026 6/10
skill GitHub
Rewrites model output to read less like model output across four languages. Multilingual coverage is rare in this category — most humanizers are English-only. Useful where CJK tone conventions differ sharply from English.
writinghumanizermultilingualcjk
by devswha Aug 31, 2026 5/10
skill GitHub
A reusable set covering teach-while-building, factual rigor, an automation system-map generator, and Anthropic's own best practices distilled into skill form. The teaching skill is aimed at learning from a session rather than just shipping from it. Companion repo to claude-code-recipes.
skillsteachingbest-practicesrigor
by naticorrea-03 Aug 31, 2026 5/10
skill GitHub
Short, copyable recipes for Claude Code, including a birthday-text auto-sender and a FITFO decision-forcing skill. Aimed at people who want a working example to adapt rather than a framework to learn. Companion to the author's skills repo.
recipesskillsautomationexamples
by naticorrea-03 Aug 31, 2026 5/10
skill GitHub
Provides a task splitter, output reconciler, adversarial debate, shared memory and an acceptance gate as composable skills. Designed to work alongside codex-delegate and gemini-delegate for cross-model collaboration. The reconciler and acceptance gate are the pieces most collections omit.
multi-agentcollaborationmarketplaceskills
by WenyuChiou Aug 31, 2026 6/10
skill GitHub
Teaches from your actual level and then checks whether you learned it by asking you to restate the idea, rather than assuming the explanation landed. Adapted from Matt Pocock's teach skill under MIT. Works across AI coding agents.
teachinglearningverificationskills
by Aisland-SJL Aug 31, 2026 5/10
skill GitHub
Two portable Agent Skills: one enforcing evidence before a fix is proposed, the other researching whether an existing GitHub project already solves the problem. The reuse-research skill counteracts agents reflexively writing new code. Portable across harnesses.
bugfixingevidencereuseskills
by kaluli123123 Aug 31, 2026 5/10
skill GitHub
Skills that turn a coding agent's output into honest reports, straight verdicts and steps you can actually follow. Targets the hedged, jargon-heavy summaries agents default to. MIT licensed.
reportingplain-languageverdictsskills
by kharmanskyi Aug 31, 2026 5/10
skill GitHub
Ships a progress board, ADRs, an archive, a doc linter and a safety gate for hardware projects. Includes a committed snapshot so the repository stays self-contained rather than depending on an external install. Methodology and enforcement in one package.
documentationadrlinterplugin
by mongdang Aug 31, 2026 6/10
skill GitHub
Rebuilds a WinForms dialog 1:1 from its Designer.cs into an interactive HTML page with numbered annotations, click-to-explain and a guided walkthrough. Solves documenting legacy desktop UIs that have no screenshots. Works in Claude Code and Codex.
winformsdocumentationlegacyskills
by mingfeng6684 Aug 31, 2026 5/10
skill GitHub
Covers AI search (GEO/AEO/LLMO), technical SEO, ecommerce, hreflang, images, backlinks, local, Search Console, CRO and a full blog pipeline. Explicitly one skill per purpose with no overlaps, which keeps routing sane at that scale. Large but organized.
seogeocontentcollection
by gaznilmuzammil12-prog Aug 31, 2026 5/10
skill GitHub
Audits, implements and measures generative-engine optimization across ChatGPT, Gemini, Claude, Perplexity and Naver, keeping each engine in its own lane rather than averaging them. Per-engine separation matters because their retrieval behaviours differ sharply. Naver coverage is unusual.
geoseoai-searchskills
by kindsusu Aug 31, 2026 5/10
skill GitHub
One SKILL.md per language, written for someone who already knows how to program and just needs the new language's idioms. Symlinks into Claude Code, Cursor, Copilot and Codex from a single source. Avoids the beginner-tutorial framing most language docs default to.
learninglanguagesskillssymlinks
by kadirosmanust Aug 31, 2026 6/10
skill GitHub
Chains established JavaScript reconnaissance tools into one agent pipeline for authorized security testing, letting the tools handle breadth while the model handles depth. Intended for bug bounty and pentest work on targets you're permitted to test. Requires the underlying tools installed.
securityreconjavascriptbug-bounty
by ZeroTu1 Aug 31, 2026 6/10
skill GitHub
Curated agent skills maintained by the Microsoft Docs team, giving coding assistants structured, current expertise drawn from Microsoft Learn documentation. First-party maintenance means it tracks Azure changes rather than going stale. A notable vendor entry into the skills ecosystem.
microsoftazureofficialdocumentation
by MicrosoftDocs Aug 31, 2026 8/10
skill GitHub
Learns your Facebook writing voice and auto-posts to FB, IG, Threads and X on a two-week calendar. The author documents both a validated viral first post and a Day 2 flop postmortem, which is more useful than the success story alone. Documentation in Traditional Chinese.
social-mediacontentautomationskills
by Hao0321 Aug 31, 2026 5/10
skill GitHub
Converts official Claude and Codex training material into daily workflows, keeping each recommendation traceable to its source. Source-backing matters in a space full of confidently wrong folk advice. Practical rather than theoretical.
best-practicesskillstrainingsourced
by alessiomarcone Aug 31, 2026 6/10
skill GitHub
Covers code review, testing, debugging, security and zero-downtime migrations. Five of the fifteen are free under MIT so you can evaluate the approach before paying. The migration skill is the least commonly covered.
skillscode-reviewmigrationsfreemium
by Hahaknight Aug 31, 2026 5/10
skill GitHub
Handles research, deck, landing page, reminders, creatives and going live as a single staged skill. Covers the full production chain rather than one piece of it. Documentation is in Hebrew.
webinarmarketingcontentskills
by Brain-ai-biz Aug 31, 2026 5/10
skill GitHub
Curated Agent Skills bundled by scenario: content publishing across 18 Chinese platforms, AI video/image/music generation, office productivity, dev basics and short-form memes. Scene packs are easier to adopt than a flat list of skills. Apache-2.0.
skillspublishingmediacollection
by Morningstar202604 Aug 31, 2026 5/10
skill GitHub
Runs against an export you already have and checks consistency across system boundaries, where most marketing data errors hide. No dependencies and no API access needed. Practical for anyone reconciling CRM and ad platform data.
martechrevopsverificationskills
by m7mdwb Aug 31, 2026 5/10
skill GitHub
Takes a role or task description and emits a production-ready XML-structured prompt. Saves hand-writing the scaffolding for every new agent or subagent. Small and immediately useful.
promptingxmlgenerationskills
by Anmoll-W Aug 31, 2026 6/10
skill GitHub
Drop a link or describe a situation and it researches live, explains using character analogies, then closes with one sharp question. The closing question is what makes it useful in a PM context rather than just a glossary. Works in any Claude Code session.
product-managementexplanationresearchskills
by Anmoll-W Aug 31, 2026 5/10
skill GitHub
Every installed skill accumulates evidence from real sessions and evolves when a gate opens, with the change governed, user-authorized and reversible. The authorization gate and reversibility are what make self-modification safe here. Bilingual documentation.
self-evolvingskillsgovernancereversible
by newdee Aug 31, 2026 6/10
skill GitHub
Outcome-focused skills covering document verification, citation checking, tender discovery and adverse media screening. Has a free tier and works across Claude Code, Codex, Cursor and Gemini CLI. Aimed at due-diligence style work.
verificationdue-diligencecitationsskills
by Sketchjar Aug 31, 2026 5/10
skill GitHub
Records what an AI coding session actually did in plain markdown, with an automated checker validating the entries against reality. The checker is the point — an unverified log drifts into fiction quickly. Human-readable output.
loggingsessionsverificationmarkdown
by AlexLiu190625 Aug 31, 2026 6/10
skill GitHub
A personal skill collection kept in a single format and symlinked into multiple harnesses so there's one source of truth. Avoids the drift that comes from maintaining parallel copies. Small and pragmatic.
dotfilesskillssymlinksportable
by therapys Aug 31, 2026 5/10
skill GitHub
A Claude Skill covering ETF and BTP taxation, capital-loss carryforwards, rebalancing and succession, with verification against primary regulatory sources. The primary-source verification is what separates it from generic financial prompting. Documentation in Italian.
financetaxitalyskills
by eliazv Aug 31, 2026 5/10
skill GitHub
Covers the full B2B sales cycle from finding target companies through objection handling, written natively in Russian. Language-native sales material is rare in agent skill collections. Practical rather than theoretical.
salesb2brussianskills
by Marchenko-sales Aug 31, 2026 5/10
skill GitHub
Generates zine-style numbered quote cards from notes using a Seedream backend, with halftone portraits and a verbatim CJK text check. The verbatim check catches the classic failure of image models mangling Chinese characters. Bilingual documentation.
designcardscjkskills
by logog782-cmyk Aug 31, 2026 5/10
skill GitHub
A multimodal LLM coaching suite for intraday trading, working over a schema-versioned journal and validated in CI. The schema versioning and CI validation are unusual discipline for a trading-adjacent project. Coaching rather than execution.
tradingjournalcoachingskills
by solidx86 Aug 31, 2026 5/10
skill GitHub
An agent skill plus buyer-side examples for x402 pay-per-request inference, letting agents pay for calls without a subscription. Interesting as an early agent-payments integration. Requires the BridgeNode network.
x402paymentsinferenceskills
by bridgenode-ai Aug 31, 2026 5/10
skill GitHub
Guides writing about your own work in your own voice through staged interview, outline, draft, edit and social steps. The interview stage is what keeps the output yours rather than generic. Aimed at newsletter authors.
writingnewslettervoiceskills
by intentionaut Aug 31, 2026 5/10
skill GitHub
A Claude Code devlog skill that captures stamped screenshots of any program without stealing focus, then produces a personal asks to changes to proof report plus a dev-process record. Focus preservation matters when capturing during a live session. Documents both what you asked and what actually changed.
devlogscreenshotsreportingskills
by Detcader101 Aug 31, 2026 6/10
skill GitHub
A Claude Code skill implementing rigorous French law research methodology, built explicitly to counter fourteen identified LLM error modes. Enumerating the failure modes and designing against each is a strong approach. Documentation in French.
legalfranceresearchskills
by brissonjo-sudo Aug 31, 2026 6/10
skill GitHub
Instruments Node.js or Python with OpenTelemetry and then generates Terraform for Grafana, Datadog, New Relic and Dash0. Covering both the instrumentation and the backend configuration is what makes it observability-as-code rather than just tracing. Works in Claude Code and Codex.
opentelemetryterraformobservabilityplugin
by radra23 Aug 31, 2026 7/10
skill GitHub
A cross-platform Agent Skill covering subagent selection, structured task packets, permissions, handoff and verification. Treating the task packet as a first-class artifact makes delegation auditable. Works beyond Claude Code.
delegationsubagentspermissionsskills
by clearlove7818 Aug 31, 2026 6/10
skill GitHub
A skill set aimed at EAs, PAs and support roles rather than engineers. Underserved audience in the agent skills ecosystem. From the sortedEA community.
executive-assistantproductivityskills
by OlgaKurki Aug 31, 2026 5/10
skill GitHub
Structures interview prep around evidence from your actual experience rather than rehearsed generic answers, for any role. Portable between ChatGPT and Claude. Straightforward and practical.
interviewpreparationcareerskills
by amirbena Aug 31, 2026 5/10
skill GitHub
Two personal skills invoked as superb:* — craft converts a vague product idea into a decision-rich brief, and pipeline takes a settled idea through to a finished branch. Splitting ideation from execution keeps each stage honest. Works in Codex and Claude Code.
productbriefpipelineskills
by kardebadas Aug 31, 2026 5/10
skill GitHub
A personal skill set the author wrote so they'd stop forgetting where they left off between sessions. Shared as-is rather than packaged as a product. Practical starting point for session continuity.
skillscontinuitysessions
by SpoiledMilkLabs Aug 31, 2026 5/10
skill GitHub
Tracks progress in project-local markdown so Codex, Claude Code and MCP-compatible agents can resume across sessions, reboots and context resets. Keeping it in the repo means it travels with the work. Plain markdown, no service required.
progressmemorymarkdownresumable
by AndriiLavrekha Aug 31, 2026 6/10
skill GitHub
A Claude Code skill that produces schema documentation and a design review together, so the review is grounded in the documentation it just generated. Saves the usual two-pass effort. PostgreSQL specific.
postgresqlschemareviewskills
by greenstevester Aug 31, 2026 6/10
skill GitHub
Runs define, spec, build, review, QA and ship with an explicit stop at every gate, so nothing advances without a decision. Framed as a CTO reviewing each stage. Installs as a Claude Code skill.
pipelinegatesqaskills
by laltaffer Aug 31, 2026 6/10
skill GitHub
A Claude Skill that turns an idea or an existing game into a playable, verified Sega Master System .sms ROM, with Game Gear and SG-1000 targets too. Generates C compiled with SDCC against devkitSMS (SMSlib + PSGlib) and verifies the result rather than just emitting code. A concrete example of wrapping a full retro toolchain in a skill.
skillretrogamedevsegasdccdevkitSMS
by haroldo-ok Aug 30, 2026 7/10
skill GitHub
A skill that convenes five distinct expert personas to argue over a consequential decision before you commit to it, rather than returning a single agreeable answer. Each member attacks the proposal from a different angle so weak assumptions surface. Works with both Claude Code and Codex.
decision-makingpersonasreviewskill
by glichtenthal Aug 30, 2026 6/10
skill GitHub
Takes scattered notes, threads, and half-formed requirements and compresses them into a structured brief suitable for reasoning over. Intended as the step before you hand a task to an agent, so the agent starts from an organized problem statement. Available for Claude Code and Codex.
context-engineeringplanningskillsummarization
by glichtenthal Aug 30, 2026 6/10
skill GitHub
A skill that takes a claim, idea, or decision and probes it for failure modes before you act on it. Sits alongside the same author's briefing-room and the-quorum as a set of pre-commitment thinking tools. Works with Claude Code and Codex.
validationdecision-makingskillcritical-thinking
by glichtenthal Aug 30, 2026 6/10
skill GitHub
An original design skill encoding a restrained aesthetic: natural materials, functional typography, asymmetric whitespace, and honest everyday imagery. Gives an agent a coherent visual vocabulary instead of generic default styling. Useful when generating UI or marketing surfaces that should feel deliberately understated.
designvisual-styleskilltypography
by yanliudesign Aug 30, 2026 5/10
skill GitHub
A plugin collection covering BTP, CAP, Fiori, ABAP, HANA, Analytics Cloud, and Datasphere for use with AI coding assistants. Encodes SAP-specific conventions that general models handle poorly without guidance. Valuable for enterprise teams where SAP work dominates.
sapenterpriseskillsabapplugins
by secondsky Aug 30, 2026 6/10
skill GitHub
An English-first academic writing skill for SCI manuscript revision, paper polishing, Chinese-to-English editing, peer review, citation and DOI audits, and figure/table QA. Targets the standards of top journals and conferences. Runs in Claude Code, Codex, and other Agent Skills clients.
academic-writingskillresearchediting
by niuyupeng Aug 30, 2026 6/10
skill GitHub
A Claude Code agent skill that appends a twelve-year-old-level explanation beneath the technical answer instead of replacing it. You keep the precise version and get an intuition check alongside it. Useful when working outside your own domain or handing output to non-specialists.
skillexplanationaccessibilitycommunication
by jkrepublic Aug 30, 2026 6/10
skill GitHub
A set of nine Claude Code skills for developer workflow where each skill specifies its non-activation conditions, not just its triggers. Directly addresses skills that fire too eagerly and pollute unrelated sessions. Worth reading as a pattern for skill authoring even if you do not install the pack.
skillsactivationworkflowskill-design
by Contexory Aug 30, 2026 7/10
skill GitHub
A collection of skills and agents packaged to install once and work across Claude Code, Codex, Cursor, and OpenCode. Avoids maintaining parallel copies per tool. Useful if your team is split across harnesses.
skillscross-toolportabilityagents
by vimoxshah Aug 30, 2026 6/10
skill GitHub
Skills for researching content on Xiaohongshu (RedNote) and Douyin through SocialDataX. Gives an agent structured access to Chinese social platform data for market and content analysis. Niche but well-scoped.
social-mediaresearchskillschina
by DevinChen2014 Aug 30, 2026 5/10
skill GitHub
A Claude Code skill where Claude drafts an answer and the OpenAI Codex CLI challenges it, debating across up to three rounds in one persistent session with explicit verdicts and a CONCEDE/HOLD relay. You keep whichever answer survives. A structured adversarial check rather than a second opinion you have to read and reconcile yourself.
skillcodexadversarial-reviewverification
by guyaga Aug 30, 2026 7/10
skill GitHub
A Claude Code plugin for spec-kit projects that follows an observed bug backwards to the specification clause responsible. Distinguishes an implementation defect from a spec defect, which changes what you should fix. Useful on projects where specs are the source of truth.
spec-kitdebuggingtraceabilityplugin
by SunilJeong95 Aug 30, 2026 7/10
skill GitHub
A personal collection of agent skills packaged for Claude Code, Gemini, Codex, and Cursor. Worth browsing for individual skills to lift rather than installing wholesale. Cross-harness by design.
skillscollectioncross-tool
by n0an Aug 30, 2026 5/10
skill GitHub
Analyzes a codebase for security design flaws, threat modeling gaps, and architectural weaknesses rather than surface-level lint findings. Recommends fixes backed by evidence from the code instead of generic security advice. For architecture-level review passes.
securitythreat-modelingarchitectureskill
by rahozosman Aug 30, 2026 7/10
skill GitHub
A Claude Code skill that hands coding sub-tasks to DeepSeek Harness via browser automation, then enforces strict review and merge gates before anything lands. Lets you offload bulk work to a cheaper model without accepting its output blindly. Browser-driven, so no API key for the target model is required.
delegationdeepseekcost-optimizationreview-gates
by naive000 Aug 30, 2026 6/10
skill GitHub
Classifies an incoming product question and selects the appropriate analysis method, then executes that method with checks rather than answering ad hoc. Prevents applying a heavyweight framework to a trivial question and vice versa. Product-side counterpart to code-focused skills.
productmethod-selectionskillanalysis
by 0trm Aug 30, 2026 6/10
skill GitHub
A Claude Code skill for generative engine optimization that keeps a separate lane for ChatGPT, Gemini, Claude, Perplexity, and Naver instead of treating AI search as one channel. Audits current visibility, implements changes, then measures the result. Relevant now that AI assistants are a real referral source.
geoseoai-searchskillmarketing
by kindsusu Aug 30, 2026 6/10
skill GitHub
Themed Agent Skills packs for Claude Code and Claude.ai, installed via /plugin marketplace add polar-bear-org/claude-skills. Current packs run workshops that end in actual decisions, and a full annual performance review cycle without HR software. Non-coding skills that still target real recurring work.
skillsmarketplaceworkshopsperformance-review
by polar-bear-org Aug 30, 2026 6/10
skill GitHub
Skills covering the German property market from property inspection through the Anlage V tax form. Structured prompts written to work with Claude, ChatGPT, and other LLMs. A domain-specific pack rather than a developer tool.
real-estategermanyskillsdomain-specific
by immoJUMP Aug 30, 2026 5/10
skill GitHub
A Claude Code plugin that fans out seven specialized agents across security, reliability, tests, DevOps, and launch blockers. Parallel specialists produce a broader audit than one generalist pass. Intended as a pre-launch gate.
auditproductionmulti-agentpluginsecurity
by Taimoorkhan1122 Aug 30, 2026 7/10
skill GitHub
Points at an existing Grafana instance and generates, deploys, and vision-verifies dashboards for AI and LLM observability, including FinOps by sovereignty, agent metrics, and EU AI Act reporting. Ships as a zero-dependency Agent Skill plus a CLI. Notable for verifying its own rendered output rather than assuming deployment succeeded.
grafanaobservabilityllmopsfinopsskill
by alebgl77 Aug 30, 2026 6/10
skill GitHub
Covers dbt, Airflow, Dagster, Prefect, Spark, Snowflake, BigQuery, Databricks, Kafka, and Iceberg as portable SKILL.md Agent Skills. Encodes idempotency, backfill, and data-quality know-how that models routinely get wrong without guidance. Runs in Claude Code, Cursor, Codex, Copilot, and Gemini CLI.
data-engineeringskillsdbtairflowspark
by Unknown-333 Aug 30, 2026 7/10
skill GitHub
A skill that makes the agent run a review pass, apply fixes, and then review again before declaring work delivered. Closes the gap where an agent hands over code it never re-examined. Chinese-language project.
code-reviewquality-gateskillself-review
by lifei6671 Aug 30, 2026 6/10
skill GitHub
A Claude Code agent skill that questions a tool before you hand it to someone else, across four gates: legal exposure, platform policy, the worst-case user, and silent failure. Aimed at the risks that surface after release rather than code defects. Complements technical review with adversarial product thinking.
releaserisk-assessmentskillpolicy
by jkrepublic Aug 30, 2026 6/10
skill GitHub
Computes an evidence-based impact radius for a proposed change, freezes current behavior with characterization tests, limits diff size, and requires human approval where breakage would be real. Built for Claude Code and OpenCode as the safety layer of the Expx method. Targets the specific danger of turning an agent loose on undocumented legacy code.
legacy-codecharacterization-testssafetyskill
by bittencourtthulio Aug 30, 2026 6/10
skill GitHub
Checks a Mac for signs of compromise and unwanted monitoring, covering orphaned root daemons, browser extensions with excessive reach, and stale configuration profiles, then removes the accumulated dead software and caches. Combines a security audit with cleanup in one pass. Practical for machines that have collected years of installs.
macossecurityauditcleanupskill
by camilocbarrera Aug 30, 2026 6/10
skill GitHub
A Claude Code and Codex plugin marketplace of knowledge-management skills that capture decisions as durable artifacts, then keep them current, queryable, and attributable across sessions. Attribution and freshness are treated as first-class rather than assumed. For teams where decisions currently die in chat logs.
knowledge-managementdecisionsmarketplacetraceability
by vivantel Aug 30, 2026 6/10
skill GitHub
A Claude Code harness bundling 8 plugins and 18 skills that add shared team memory, evidence-backed prompt coaching, prompt-injection defense, and onboarding docs. It advertises a small always-on footprint (~1,317 tokens) so the coaching layer stays loaded without eating the context window. Useful if you want team-wide prompt conventions enforced rather than left to each developer.
skillspluginsmemoryprompt-injectionteam
by MohammedMoataz Aug 30, 2026 7/10
skill GitHub
A Claude skill with blanks you fill in to describe your brand's voice, after which the assistant writes in that voice across the formats marketing actually ships. It is a template rather than a pretrained style, so the tuning work is a one-time setup. Useful for teams generating recurring marketing copy.
skillwritingmarketingbrand-voicetemplate
by moihars Aug 30, 2026 6/10
skill GitHub
An agent skill that manages Postman cloud resources (collections, environments, workspaces) and executes API requests through them, with guardrails around destructive operations. Lets an agent drive existing Postman assets instead of hand-rolling curl. Relevant to anyone whose API contracts already live in Postman.
skillpostmanapitestingautomation
by soapgu Aug 30, 2026 6/10
skill GitHub
A curated awesome-list of Claude Skills, Agent Skills, and LLM skill development resources, written in Chinese. It collects skill repos, guides, and tooling in one index. The main value is coverage of Chinese-language ecosystem projects that English lists tend to miss.
awesome-listskillschineseresourcescurated
by yzfly Aug 30, 2026 6/10
skill GitHub
An agent skill that researches which events, conferences, and communities your competitors sponsor and at what commitment level, then ranks what your brand should buy. Output is Markdown plus an xlsx, with every row linked to its evidence source. Niche to marketing teams, but the evidence-linked row pattern is worth stealing for other research skills.
skillresearchmarketingcompetitive-analysisxlsx
by aj-suresh Aug 30, 2026 5/10
skill GitHub
A Claude skill that writes developer-facing content in PostHog's published house style, paired with a style linter that flags deviations. The linter is the interesting half — it makes the voice checkable rather than vibes-based. A concrete example of encoding a public style guide as a skill.
skillwritingstyle-guidelinterposthog
by zmjafary Aug 30, 2026 5/10
skill GitHub
A skill supporting development on the Next2D Framework and Player, generating code that follows MVVM plus Clean Architecture plus Atomic Design, optimizing WebGL rendering, and helping implement animations. Narrow to Next2D users, but a good template for framework-specific skills that encode architectural conventions.
skillnext2dwebglanimationframework
by Next2D Aug 30, 2026 5/10
skill GitHub
A skill that generates single-file animated landing pages — Three.js scenes, liquid-glass shaders, springy poster walls — in the style of awards-site showcase work. Output is screenshot-verified, so the skill checks its own rendering rather than trusting the code compiled. One prompt produces a self-contained page.
skillthreejsanimationfrontendwebgl
by jiangyurong609 Aug 30, 2026 7/10
skill GitHub
A collection of SKILL.md Agent Skills built on an explicit editorial rule: include only expertise a frontier model does not already reliably know. That filter keeps the set small and avoids the common failure of skills that restate what the model already does well. Works with Claude Code, Codex, Cursor, and Gemini CLI.
skillsskill-mdcross-agentcuration
by sergeyizmailov Aug 30, 2026 7/10
skill GitHub
A web search skill for coding agents backed by both Tavily and Parallel AI, installable with npm i -g surf-skill. It rotates across multiple API keys and falls back to the second provider when the first fails or is rate limited. Ships as both a CLI and a Node library, with batch search support.
skillweb-searchtavilynpmfallback
by frederico-kluser Aug 30, 2026 6/10
skill GitHub
Open-source skills that let agents do real financial work with durable X1 account context. The notable design choice is a hard stop gate: the agent can research, analyze, and prepare, but any action that actually moves money requires explicit human approval. A useful reference for anyone building agent skills around irreversible operations.
skillsfinancehuman-in-the-loopsafety-gate
by x1wealth Aug 30, 2026 6/10
skill GitHub
A Claude Code skill that enumerates a theme small-cap universe from SEC filings, then mechanically screens out going-concern, death-spiral financing, and material-weakness names before any analysis. What follows is due diligence structured to be falsifiable, with forced disconfirmation steps and base-rate priors. Explicitly a research discipline, not a stock picker.
skillsec-filingsresearchdue-diligencefinance
by DaizeDong Aug 30, 2026 6/10
skill GitHub
A set of Claude Code skills covering a trip end to end: searching real fares through ITA Matrix, keyless driving and transit routing, and an in-trip companion agent that reads your trip dossier while you are traveling. Shows how to chain planning skills into a document that a later agent consumes.
skillstravelita-matrixroutingplanning
by Filip-Kin Aug 30, 2026 6/10
skill GitHub
An index of Claude Code skills pulled out of a production Next.js App Router codebase rather than written as demos. Covers help center, digital signage, KSeF e-invoicing, and Stripe Connect billing modules. Useful if you want skills that encode how a feature was actually shipped.
skillsnextjsapp-routerstripeproduction
by timerise-ai Aug 30, 2026 6/10
skill GitHub
A gated marketing pipeline skill that grounds copy in research and then forces it through a review gate specifically designed to catch AI slop. It maintains a living catalog of overused tropes that the gate checks against, so the filter sharpens as you use it. The gating pattern generalizes well beyond marketing copy.
skillmarketingcopywritingquality-gatereview
by laltaffer Aug 30, 2026 6/10
skill GitHub
A free Claude Code skill packaged with a "certified BI" doctrine: every figure the model reports must reconcile back to the source file's own totals. Aimed at analysts who want Claude to produce spreadsheet-derived numbers that can be audited rather than plausible-looking summaries. Published alongside the commercial kymira.ai methodology.
skillbusiness-intelligencedata-analysisreporting
by dylnbaker15 Aug 29, 2026 6/10
skill GitHub
An agent skill that turns a coding agent into a technical SEO specialist for building landing pages. It targets 100/100 Google PageSpeed and Core Web Vitals optimization as explicit build constraints. Handy for anyone shipping marketing pages with Claude Code instead of hand-tuning performance.
skillseoweb-performancecore-web-vitals
by aleksandr-alhoff Aug 29, 2026 6/10
skill GitHub
A collection of self-contained Agent Skills that work across Claude Code, Codex, and other agent runtimes. Each skill installs on its own — no framework, plugin manager, or shared runtime to adopt first. Good source if you want to cherry-pick capabilities rather than commit to a whole toolkit.
skillagent-skillsportablelibrary
by tsudo Aug 29, 2026 7/10
skill Reddit
Two complementary skills that control response length from opposite directions — one compresses answers into dense scannable notation, the other expands terse output into full explanation. Built by someone tired of typing 'just give me the conclusion' repeatedly. Addresses the two failure modes of response length as separate problems rather than one setting.
output-controlbrevityskills
by Ok-Challenge-7810 Aug 29, 2026 7/10
skill GitHub
A tool-agnostic instruction file built on a single rule: the prose you write for a change never outweighs the code. Keeps one AGENTS.md rather than a per-tool file for every assistant you use. A reaction to instruction files that grow until they cost more attention than the change they describe.
agents-mdinstructionstool-agnostic
by theomgdev Aug 29, 2026 6/10
skill GitHub
A large cross-platform skill collection covering malware analysis, software reversing, firmware and embedded work, protocol reversing, mobile apps, unpacking and deobfuscation, vulnerability research, managed code, forensics, and CTF. Chinese-language. One of the broader security-focused skill libraries published for agent runtimes.
reverse-engineeringsecurityctfskills
by dslsdzc Aug 29, 2026 7/10
skill GitHub
Agent-skill port of the Umami health manager covering fridge inventory, recipes, diet, workouts, body metrics, goals, and habits, with all data stored in local SQLite. Chinese-language. A worked example of a stateful personal-domain skill that owns its own database.
healthsqlitepersonalskills
by renchenxuan Aug 29, 2026 5/10
skill GitHub
Claude Code skill that walks a GitHub PR diff one hunk at a time, asks you to interpret each change, and then checks your answer. Japanese-language. A code-reading practice loop rather than a review automation tool.
code-reviewlearninggithubpull-requests
by kaleidot725 Aug 29, 2026 6/10
skill GitHub
Learns plot styles from papers, PDFs, articles, and screenshots, converts them into reusable R/Python recipes, and imitates them the next time you ask for a similar figure. The library grows with each source you feed it rather than shipping a fixed template set.
bioinformaticsplottingrpython
by Zessi-C Aug 29, 2026 6/10
skill GitHub
Claude Code skill with optional nightly automation that reads your mail and calendar and produces a short forward-looking brief — interviews to prep, replies you owe, threads worth nudging. Keeps a living tracker so you don't reconstruct the state of a search by scrolling email.
job-searchemailcalendarautomation
by jessicahiggs Aug 29, 2026 6/10
skill GitHub
Developer skill set covering PHP, Drupal, HTML, CSS, JavaScript, CMS delivery, web performance, audits, and defensive security, built on an evidence-first posture. Fills a gap in skill libraries, which skew heavily toward JS/TS stacks.
phpdrupalcmsperformance
by creoaurea-devlab Aug 29, 2026 5/10
skill GitHub
Skeleton that generates brand-specific real-estate agent skills from one config, covering four role types across 29 business modules for both firms and individual practitioners. Apache-2.0. An example of the config-to-skill generation pattern applied to a vertical.
real-estatechineseskill-generation
by danfeistar Aug 29, 2026 5/10
skill GitHub
Skill marketplace organised as ten domain plugins totalling 28 skills, targeting Claude Code, Codex, and Antigravity runtimes. Focused on personal automation rather than software engineering tasks.
marketplaceautomationmulti-runtime
by deuxksy Aug 29, 2026 5/10
skill GitHub
Agent skills for Flutter and Dart covering Riverpod v3, GoRouter, Melos monorepos, clean-architecture audits, and widget testing, plus 70 agents. Works across Claude Code, Cursor, and Codex. One of the more complete mobile-stack skill sets available.
flutterdartriverpodmobile
by iamantoniodinuzzo Aug 29, 2026 7/10
skill GitHub
A skill collection plus a `just` installer that symlinks skills into any skill-aware agent's folder, defaulting to ~/.claude/skills/. Because they're symlinks, edits stay live and the source stays under version control instead of drifting from a copied install.
skillsinstallersymlinkgit
by astrona-io Aug 29, 2026 5/10
skill GitHub
Platform engineering handbook spanning Kubernetes, OpenShift, Argo CD, Flux CD, AWS, Azure, Terraform, and GitHub Actions, with an optional Claude plugin layer for interactive guidance. Readable as docs on its own or installable as skills.
kubernetesterraformplatform-engineeringdevops
by nitinjain999 Aug 29, 2026 6/10
skill GitHub
Reads a folder of saved spam and proposes ranked mail filter rules Claude can install, with an honest cost estimate for each match so you can see what a rule would catch and what it might break.
emailspamfiltersautomation
by Samuellalight8026 Aug 29, 2026 5/10
skill GitHub
Rewrites a long response into an emoji-tagged list you can read in about five seconds. Post-hoc compression, so you keep the full answer and get a scannable version of it rather than constraining the model up front.
summarizationoutput-controlreadability
by Loriabient5377 Aug 29, 2026 5/10
skill GitHub
Skills for engineering, IT, data, HR, finance, legal, marketing, sales, product, and operations, each evaluated before release. Agent-agnostic. The measurement claim is the differentiator among the many enterprise skill bundles.
enterpriseskillsevaluationbusiness
by alihusains Aug 29, 2026 6/10
skill GitHub
A deliberately small set of six skills covering thinking through a problem, simplifying, writing, and shipping. Opinionated and narrow by design, in contrast to the hundred-skill bundles.
skillswritingsimplificationminimal
by mrmps Aug 29, 2026 6/10
skill GitHub
Zero-dependency CLI for pulling Bilibili comments so creators can analyse feedback on their own videos, exposed for Claude Code, Codex, and OpenClaw. An example of wrapping a platform API as an agent-native command rather than an MCP server.
bilibiliclicommentsanalysis
by Agents365-ai Aug 29, 2026 5/10
skill GitHub
A small collection of agent skills for software developers, written to stay simple rather than comprehensive. Worth a look if the large curated bundles feel like more machinery than you want.
skillsdevelopersminimal
by NazmusSayad Aug 29, 2026 5/10
skill GitHub
Claude Code skill that configures a themed Linux terminal environment — Starship prompt, Nerd Font, terminal palette, status line, and modern CLI tools — with no sudo required. The no-sudo constraint makes it usable on locked-down or shared machines.
linuxterminalsetupstarship
by abhibansal60 Aug 29, 2026 6/10
skill GitHub
Claude Code skill generating privacy policies and terms of service under Korean law, reflecting the April 2025 drafting guidelines and the March 2026 statutory amendments. Jurisdiction-specific legal drafting with a stated currency date, which matters more than usual here.
legalkoreanprivacycompliance
by kimlawtech Aug 29, 2026 6/10
skill GitHub
Generates nine Korean contract types — permanent, part-time, flexible, daily, freelance, outsourcing, amendment, and salary agreements — reflecting 2026 minimum wage and recent Supreme Court precedent, bundled with an MCP server for personal-data protection.
legalkoreancontractsmcp
by kimlawtech Aug 29, 2026 6/10
skill GitHub
Analyses a patent specification, picks the right diagram type — flowchart, block, state, graph, or process — and renders it to PNG at KIPO spec: 300 DPI, black and white, A4. Removes the manual redraw step in Korean patent filing.
patentkoreandiagramskipo
by kimlawtech Aug 29, 2026 6/10
skill GitHub
Bookkeeping skill for Korean startups, single-member corporations, freelancers, and sole proprietors: takes card statement PDFs and bank CSVs and produces financial statements plus a CSV for your accountant, with Level 2 sensitive-data masking applied.
accountingkoreanbookkeepingpii
by kimlawtech Aug 29, 2026 6/10
skill GitHub
Korean-domain agent kit with automatic classification across six modes, a guard requiring citations to the national law information service, PII masking, and prompt caching. The citation guard is aimed squarely at legal hallucination.
koreanagent-kitcitationspii
by kimlawtech Aug 29, 2026 5/10
skill GitHub
Covers the moments where one deliberate decision prevents rework — vetting a tool before signing up, choosing what to delegate to an agent versus keep, carrying context between sessions, and catching an expensive request before it runs. No setup required.
decision-makingdelegationcontextskills
by theAnirudhKumar Aug 29, 2026 6/10
skill GitHub
Skills wrapping the USDCtoFiat offramp so an agent can run cash-out flows on Base. Narrow and vendor-specific, but a concrete example of exposing a financial API surface to an agent as skills.
cryptobasepaymentsskills
by ADWilkinson Aug 29, 2026 5/10
skill GitHub
Claude Code skill that produces and audits accessible PPTX and PDF/UA presentations against roughly 75 checkable rules drawn from WCAG 2.2 AA via WCAG2ICT, ISO 14289, LBI, and e-MAG — alt text, reading order, contrast, sign language, and audio description. Portuguese-language.
accessibilitywcagpresentationspdf-ua
by RaulAraujoSilva Aug 29, 2026 7/10
skill GitHub
Over 125 skills organised into 15+ departments, each independently installable, so you adopt the marketing or finance department without taking the whole org. The company metaphor gives the collection a navigation structure that flat skill lists lack.
skillsorganizationdepartmentsmodular
by cbrock84 Aug 29, 2026 7/10
skill GitHub
A skill collection where each entry is a self-contained module teaching an agent to perform a complex task with context, structure, and best practices. Targets Kiro, Cursor, Windsurf, and Claude Code alike.
skillscross-agentmodules
by fabricioctelles Aug 29, 2026 5/10
skill GitHub
Skills built on learning-science practice — spacing, retrieval, and evidence-based method — rather than having the model explain a topic once and move on. For using an agent to actually retain material.
learningeducationretentionskills
by drveles Aug 29, 2026 6/10
skill GitHub
General-purpose open-source skill collection compatible with both Claude Code and DeepSeek Harness runtimes.
skillsopen-sourcedsh
by theorangee-makke Aug 29, 2026 5/10
skill GitHub
Any model orchestrates under an internal contract while Sonnet 5 implements through role-persona subagents, with .vibe/ carrying memory across sessions. The hard gate is mechanical: no red test, no code, enforced by a verified receipt rather than a prompt instruction. Stack-agnostic with no external skill dependency.
tddgatessubagentsverification
by santischurmann Aug 29, 2026 7/10
skill GitHub
Skill for folder self-governance — it writes a rules file that keeps agent-generated content structured, searchable, and reusable going forward, or does a one-off logical cleanup of an existing folder. Chinese-language.
organizationfilesgovernance
by TEXXXXTURE Aug 29, 2026 5/10
skill GitHub
Skill marketplace whose headline entry is a Bruno skill for authoring, generating, and running .bru API collections from an agent. Good fit if your API testing already lives in Bruno rather than Postman.
brunoapi-testingskills
by punkaze Aug 29, 2026 5/10
skill GitHub
Trading copilot skill built on the Binance Agent OS MCP, framed around risk controls rather than signal generation. Narrow and vendor-bound, but a concrete example of putting guardrails between an agent and a live financial API.
tradingbinancemcprisk
by acevod Aug 29, 2026 5/10
skill GitHub
Central repository collecting the agent skills that ship across Ahoo-Wang's open-source projects, so consumers install from one place rather than tracking each project separately.
skillsaggregationopen-source
by Ahoo-Wang Aug 29, 2026 5/10
skill GitHub
End-to-end design skill running structured discovery and competitor research, generating a WCAG-compliant design system, then building low-fidelity wireframes or high-fidelity prototypes with real navigation, exportable screens, and a design system you can carry into Figma.
designwireframesfigmawcag
by elifsue Aug 29, 2026 7/10
skill GitHub
French writing skill for READMEs and reports: simple words with no loss of technical precision, terms defined at first use, guided reading of tables and figures, and every number given a declared status. A precise editorial standard rather than a 'write clearly' instruction.
writingfrenchdocumentationreadme
by Guilou001 Aug 29, 2026 5/10
skill GitHub
Curated iOS and Swift agent skills — nine written by the author, plus a registry of community skills that were actually reviewed before inclusion. Works with Claude Code, Codex, Cursor, and OpenCode. The vetting is the value in a space full of unfiltered lists.
iosswiftskillscurated
by Vvlladd Aug 29, 2026 7/10
skill GitHub
Generates interactive, editable architecture diagrams from a project or idea, delivered as a single self-contained HTML file. Verifiable and editable after generation rather than a static image you have to redraw to change.
diagramsarchitecturehtmlvisualization
by lewes2 Aug 29, 2026 6/10
skill GitHub
Skills for producing, verifying, and submitting counter-signed evidence envelopes from Claude Code or any MCP-capable framework, formatted for external dispute venues including Internet Court, Kleros ERC-1497, and UMA. Niche, but a real answer to proving what an agent did.
attestationdisputesevidencemcp
by tersignhq Aug 29, 2026 5/10
skill GitHub
Official collection of skills, instruction files, and related material to help LLMs work with psake, the PowerShell build automation tool. An example of an upstream project shipping its own agent context.
psakepowershellbuildskills
by psake Aug 29, 2026 5/10
skill GitHub
Claude and Cowork skill packaging a GSAP motion system, a library of signature scroll moves, a brand-to-build workflow, a working starter template, and in-browser QA, aimed at producing sites that read as expensively made. Written to be beginner friendly.
gsapanimationmarketingweb-design
by navinramharak-rgb Aug 29, 2026 6/10
skill GitHub
An open-source suite of agent skills that builds complete Astro websites from a prompt. It covers layout, accessibility, and SEO defaults so the generated site ships production-ready rather than as a scaffold. Works with Claude Code, Codex, and Antigravity.
astrowebseoskills
by karero Aug 29, 2026 6/10
skill GitHub
A Claude Code skill that breaks oversized tasks into recursively smaller subtasks so no single step blows the context window. The agent decomposes, solves the leaves, then reassembles results upward. Targets the failure mode where a task is too large to hold in one session.
contextdecompositionlong-contextskill
by massimodeluisa Aug 29, 2026 6/10
skill Reddit
After no amount of do/don't examples fixed verbose worklog and changelog output, this developer added a single line: 'Ask yourself: if each word cost $0.25, would I spend my budget on this sentence? If not, cut it.' Both the main agent and subagents snapped to tight, readable prose. A cheap edit for any CLAUDE.md or slash command that produces written summaries.
promptingclaude-mdslash-commandsverbosity
by callmejace Aug 29, 2026 7/10
skill GitHub
A curated index of agent skills for video production and visual support, organized around video workflows rather than general categories. Covers editing, generation, and visual asset tasks. A starting point if you are pointing an agent at video work.
videoskillsawesome-listmedia
by ella-wang-opus Aug 29, 2026 6/10
skill GitHub
A set of agent skills covering legal work — drafting, review, and document tasks — packaged for installation. Works across Claude, ChatGPT, and Codex rather than being tied to one harness. Narrow domain, but a rare example of skills built for a non-engineering profession.
legalskillsdocumentscross-agent
by Cancellationperiplocagraeca503 Aug 29, 2026 5/10
skill GitHub
A Claude Skill that runs five cheap diagnostic tests to identify why an agent prompt is misbehaving, so you fix the actual cause instead of piling on more rules. Ships with an eval harness that regression-tests the skill's own routing decisions. The self-testing part is the unusual bit.
promptingevalsskill-authoringdebugging
by amylyra Aug 29, 2026 8/10
skill GitHub
Chunks long-form text into macro-units sized around Sweller's Cognitive Load Theory, aiming for retention rather than token limits. Intended for studying and learning material, not for RAG ingestion. A different framing of the chunking problem than most tooling.
chunkinglearningtextcognitive-load
by K-Pourahmadian Aug 29, 2026 5/10
skill GitHub
Four skills covering the Bugzilla maintainer workflow: bug triage, patch review, schema migration checks, and template review. Encodes project-specific conventions that a general agent would not know. A concrete example of skills scoped to one codebase's practices.
bugzillatriagecode-reviewperl
by topunix Aug 29, 2026 5/10
skill GitHub
Translates DHH's Rails Doctrine — convention over configuration, majestic monolith, programmer happiness — into a single skill any agent can load. Pushes back on the sprawling, over-abstracted code agents tend to produce. One opinion, applied consistently.
railsconventionscode-styleskill
by bobbyryandra Aug 29, 2026 6/10
skill GitHub
Runs ten successive rounds of adversarial critique against a piece of work to surface blind spots a single review pass misses. Ships as both a Claude Code plugin and a claude.ai skill. Vietnamese-first, with English support.
critiquereviewadversarialvietnamese
by elisehanhnguyenus-cloud Aug 29, 2026 5/10
skill GitHub
A skill for Claude Code, Codex and Cursor that runs an audit-then-polish pass ("Impeccable") over AI-generated interfaces, checking them against real-world design references and a concrete interface checklist rather than vague taste instructions. Includes Shoogle and shadcn conventions. Written in Portuguese, which makes it one of the few non-English design skills in the ecosystem.
skilldesignuishadcnportuguese
by Bren0o Aug 28, 2026 6/10
skill GitHub
A Claude Skill that reads a cover letter, cold email or pitch and judges one thing: was it written for this specific recipient, or is it a generic template being performed at them. A narrow, opinionated check aimed at exactly the failure mode agent-drafted outreach falls into. Not a coding tool, but a clean example of a single-purpose evaluative skill.
skillwritingoutreachemailevaluation
by MichaelDoesMarketing Aug 28, 2026 6/10
skill GitHub
An agent skill for Claude Code and Codex that hunts the visual signatures of AI-generated websites — the gradient-and-glassmorphism house style — and prescribes a specific fix for each. The catalogue runs to 284 researched tells. Works either as an audit pass over an existing site or as a constraint set while building a new one.
skilldesignfrontendauditcodex
by Juuzoe Aug 28, 2026 7/10
skill GitHub
A skill collection written to run unchanged across four different agent harnesses rather than binding to Claude Code's format alone. The value is the portability: skills you write once do not have to be rewritten when you switch tools. Description is thin, so browse the repo to see which abilities are included.
skillsportablecodexcursorcross-tool
by majesticlabs-dev Aug 28, 2026 5/10
skill GitHub
Checks Markdown writing against ASD-STE100 Issue 9, the controlled-English standard from aerospace technical documentation, flagging vocabulary and constructions outside the approved set. Ships both as an omp extension and as a portable agent skill. Useful for keeping specs and docs readable when an agent is generating most of the prose.
skilllintingmarkdownwritingdocumentation
by donrami Aug 28, 2026 6/10
skill GitHub
A skills-and-plugin bundle covering the PM surface for agent-assisted work: evidence-tagged PRDs, specs, RICE prioritization, backlog and roadmap scoring, GTM launch plans and release verification. Its distinguishing rule is that every claim must carry a source or be explicitly labelled unsourced, which is a direct answer to agents inventing confident market numbers. Runs on Claude Code, Cowork and Codex.
product-managementprdprioritizationskillsroadmap
by naderelewa Aug 28, 2026 7/10
skill GitHub
A zero-dependency verification gate that refuses an agent claim of completion unless captured, tamper-evident evidence supports it. Packaged as an Agent Skill for Claude Code, Codex and Cursor.
verificationevidencegateskill
by Kaiser0733 Aug 28, 2026 7/10
skill GitHub
A rule set for Claude Code and GitHub pipelines where every rule documents the real incident it grew out of, the mechanism behind the failure, and where the rule does not apply. Russian and English. More useful than a generic best-practices list because the reasoning is preserved.
rulesincidentsgithubbest-practices
by ArtVsMark Aug 28, 2026 7/10
skill GitHub
A skill that forces clarifying questions when an instruction is underspecified, instead of letting the model guess and hallucinate a direction. Small and targeted at the failure mode where a vague prompt produces confident wrong work.
clarificationpromptinghallucinationskill
by irfanannaafi19 Aug 28, 2026 6/10
skill Reddit
A developer with too many globally installed skills across Claude Code and Codex found that skillsOverride lets you scope which skills a session sees. Solves the problem where similar skills from different tools compete and the agent picks the wrong one.
skillsconfigurationsessionscoping
by jason3gb Aug 28, 2026 6/10
skill GitHub
Open-source Claude Code skills that add explicit planning, building and verification gates to agentic coding. Aimed at workflows where the agent currently jumps straight from prompt to edit with nothing checking the result.
skillsplanningverificationgates
by adamlinscott Aug 28, 2026 6/10
skill GitHub
An anti-sycophancy guard for Claude Code that stops audits from inventing problems to look useful. Directly targets the failure where asking for a review guarantees you get findings whether or not any exist.
auditsycophancycode-reviewskill
by Dimerin1 Aug 28, 2026 7/10
skill GitHub
Claude Skills packaging production workflows for agents, including ai-creative-studio which covers AI video and image production end to end. Useful as a worked example of encoding a real production pipeline as a skill.
videoimageproductionskills
by bestudios-io Aug 28, 2026 5/10
skill GitHub
Points your AI assistant at your own git history, files and session logs and compares claimed progress against what the artifacts actually show. Local-only, and deliberately not a vibes-based self-assessment.
verificationgitsessionsevidence
by harshgoyal1 Aug 28, 2026 7/10
skill GitHub
Installs your repository procedures as skills into Claude Code, Codex and Antigravity, and converges the repository state to match them. The goal is the same cut in every project rather than per-repo drift.
skillsstandardizationmulti-agentrepo
by 0x0w1 Aug 28, 2026 6/10
skill GitHub
Agent skills covering the product development loop — deciding what to build, producing the assets and marketing page that announce it, and testing the app it ships in. Combines brand-neutral rendering engines with written method maps, readable by any agent that reads a folder.
productmarketingtestingskills
by notdaran Aug 28, 2026 5/10
skill GitHub
A curated collection of Claude Code skills, selected for having actually been used rather than merely published. Chinese and English.
curatedskillscollection
by Onevium Aug 28, 2026 6/10
skill GitHub
Skills a product manager actually runs during a work week: metric attribution, a PRD review panel, a cross-model GO/NO-GO gate, blind A/B testing, audience-tailored briefs, decision triage, session handoff, meeting notes and peer-feedback drafting. Presented as runnable engines rather than prompt snippets.
product-managementskillsreviewhandoff
by aaronartistzhang-afk Aug 28, 2026 5/10
skill GitHub
A Claude Code skill that audits any URL across security, application, performance, SEO and accessibility, then produces a price quote you can hand a client. Aimed at agencies and freelancers doing prospect audits.
auditsecurityperformanceaccessibility
by mohanedashraff Aug 28, 2026 6/10
skill GitHub
A Claude Code skill that builds scroll-animated websites end to end — a discovery wizard, a Scroll Score blueprint, a GSAP plus Lenis build, and real-browser verification through Playwright so the animation is checked rather than assumed.
gsapanimationplaywrightfrontend
by hemangjoshi37a Aug 28, 2026 6/10
skill GitHub
Nineteen skills for Claude Code and Codex CLI including an adversarial reviewer, its evidence-grounded analysis spine and a production-ops discipline suite. Notably ships a gauntlet that A/B-tests any skill against a no-skill control — and reports that three of these skills lost to loading nothing.
skillsadversarial-reviewab-testingops
by CassioRoos Aug 28, 2026 6/10
skill GitHub
Installs a memory loop for Claude Code centered on a single small BRIEF.md that every session reads before doing anything, fed by a capture discipline for keeping it current. A deliberately minimal answer to cross-session amnesia.
memorysessionsbriefcontext
by Elliotoh-jin Aug 28, 2026 6/10
skill GitHub
Keeps your Agent Skills in a separate library and searches it by name or task, loading only the selected SKILL.md into context. A direct fix for the context cost of a large global skills directory.
skillscontextsearchlibrary
by dd3ok Aug 28, 2026 7/10
skill GitHub
Seven skills that route a discovery question to whichever method your actual evidence can support, and explicitly refuse to invent a customer, a number or a confidence level. A useful pattern for any skill where fabrication is the main risk.
productdiscoveryevidenceskills
by riadchaban994-bot Aug 28, 2026 5/10
skill GitHub
CrowdStrike published skills for building Falcon Foundry apps — scaffolding, deployment and best practices for API integrations, collections, functions, UI extensions, UI pages and workflows. A notable example of a major security vendor shipping first-party agent skills.
crowdstrikesecurityskillsvendor
by CrowdStrike Aug 28, 2026 7/10
skill GitHub
A links-only curated index of frontend and UI skills for Claude Code and other AI agents. Useful as a starting point when you want a UI skill rather than writing one.
curatedfrontenduiskills
by ezra-y Aug 28, 2026 5/10
skill GitHub
Makes Claude Code behave consistently across repos, sessions and people using rules stored as files with explicit precedence, a journal of decisions that were declined, and objection sparring. Sanitized from a live production system, MIT.
rulesgovernancedecisionsconsistency
by tonydzi Aug 28, 2026 6/10
skill GitHub
A shared governance layer for Claude Code providing commit gates, contracts and skills that load automatically in whatever repo you are working in, so you do not re-install discipline per project.
governancecommit-gatesskillscontracts
by oliver-chase Aug 28, 2026 6/10
skill GitHub
A curated pack of custom Claude Code skills for developers, installable as a Claude Code plugin marketplace rather than copied file by file.
skillsmarketplacedevtoolsplugin
by Mattakushi432 Aug 28, 2026 6/10
skill GitHub
A Claude Code skill that takes existing audit findings and re-ranks them by how likely each is to produce a one-star App Store review. Uses named, overridable triggers and a pluggable seam for grounding against real reviews.
app-storeauditprioritizationmobile
by Terryc21 Aug 28, 2026 5/10
skill GitHub
An agent skill that removes telltale AI writing patterns from drafts, merging the stop-slop and Cursor unslop rule sets. Works with Claude Code, Codex, Cursor and claude.ai.
writingai-slopeditingskill
by jebradfield Aug 28, 2026 6/10
skill GitHub
Hunts for logic errors, broken assumptions, state machine gaps and semantic fragility — the classes of bug that rule-based and pattern-matching auditors do not catch because nothing about the code looks wrong.
bugsauditlogic-errorsreview
by Terryc21 Aug 28, 2026 6/10
skill GitHub
Scores any document 0-100 against 43 rules across plain words, human voice, structure and information density. One JSON rule pack compiles to 18 targets including a Claude Code skill, AGENTS.md, a Cursor rule, a system prompt and a Vale style. Zero dependencies, runs offline.
writinglintingstandardsoffline
by eugeniughelbur Aug 28, 2026 6/10
skill GitHub
A Claude Code plugin bundling skills, agents and a hook, drawn from real production delivery work rather than assembled from best-practice lists.
deliveryskillshooksproduction
by ViktorSoroka07 Aug 28, 2026 6/10
skill GitHub
A set of Claude Code plugins that keep coding agents on Jujutsu instead of falling back to git, enforced by a hard wall. Covers project setup, parallel workspace orchestration, commit workflows, peer review, and race-safe query helpers. Relevant if you have moved a repo to jj and agents keep reaching for git commands.
jujutsujjpluginsvcsworkflow
by muloka Aug 28, 2026 7/10
skill GitHub
A skill library giving Claude Code, Codex, and Pi a catalogue of 38 editorial diagram styles that render as standalone HTML + SVG. Explicitly avoids Mermaid output and decorative shadows in favour of print-quality layouts. Handy for docs, architecture write-ups, and slides where Mermaid looks too generic.
diagramssvgdocumentationskill
by cathrynlavery Aug 28, 2026 7/10
skill GitHub
One developer's format for presenting project status, bundled as a reusable Claude Code skill so the agent produces the same report layout every time. Documentation is in Spanish.
status-reportskillproject-management
by sergiohidalgo-pro Aug 28, 2026 5/10
skill GitHub
A skill for Claude Code and Codex covering Telegram rich message formatting, guarded bot publishing, YouTube thumbnail generation, and transcription. Aimed at people running a channel from their agent instead of a separate content tool.
telegrampublishingtranscriptionskill
by shromarketing Aug 28, 2026 5/10
skill GitHub
Skills that give an agent working knowledge of Scalekit authentication: agent auth, full-stack login, MCP OAuth 2.1, enterprise SSO, and SCIM provisioning. Supports Claude Code, Cursor, Windsurf, and 35+ other agent hosts.
authssooauthmcpskill
by scalekit-inc Aug 28, 2026 6/10
skill Reddit
A CLAUDE.md instruction for code review: treat anything committed from 2023 onward as possibly AI-generated regardless of the listed author, so unusual complexity is not automatically read as intentional. Addresses a real reviewer bias where the agent assumes hard-to-write code must exist for a reason.
code-reviewclaude-mdpromptpull-request
by Future_Addendum_8227 Aug 28, 2026 5/10
skill GitHub
Code review and pull request skills written to work across Claude Code, Cursor, Codex, Copilot, Aider, or a plain chat window. Emphasizes precision over volume, aiming to cut the false positives that make agent reviews easy to ignore.
code-reviewpull-requestportableskill
by Barney241 Aug 28, 2026 5/10
skill GitHub
A Claude Code skill that runs Claude and OpenAI Codex as independent voices on architecture questions and root-cause investigations, requiring each to argue from evidence. Useful when a single model keeps confidently landing on the wrong diagnosis.
multi-modelarchitecturedebuggingdeliberation
by Marcussy34 Aug 28, 2026 7/10
skill GitHub
Show an agent your brand, describe what you need, and get assets that match the existing visual language. Free skills packaged for Codex, Claude Code, and other Agent Skills hosts.
brandingdesignassetsskill
by Lemonbrand Aug 28, 2026 5/10
skill GitHub
A plain-markdown knowledge base template that an agent maintains, versioned in git with a two-tier memory split between durable facts and working notes. No database or service dependency; MIT licensed.
knowledge-basememorymarkdowngit
by karrvel Aug 28, 2026 6/10
skill GitHub
A ready-to-use Claude Code configuration covering both development and operations, with global rules, 23 skills, hooks, and memory scaffolding. Deliberately generic with no personal data, installed by one script.
devopsskillshooksconfiguration
by WhiteMuush Aug 28, 2026 6/10
skill GitHub
One stack-agnostic kit shipping skills, subagents, slash commands, hooks, rules, and a Claude Code plugin manifest, organized around agile lifecycle stages. Supports exactly two hosts — Claude Code and Cursor — rather than claiming universal compatibility.
agileskillssubagentsplugin
by yusufkaracaburun Aug 28, 2026 6/10
skill GitHub
An agent skill for Codex and Claude that produces product walkthroughs, launch films, and pitch videos, driving the real app with Playwright and assembling footage with FFmpeg. Motion is deterministic and shots are linked back to actual product behaviour rather than mocked up.
videoplaywrightffmpegdemo
by Afnanksalal Aug 28, 2026 6/10
skill Reddit
Argues that CLAUDE.md is easy to grow and hard to trust — months on, some rules describe deleted code and some workarounds have quietly become architecture. Proposes an audit where each instruction must cite live code, a test, or an ADR, repo invariants stay, and temporary warnings need an owner or an expiry condition.
claude-mdmaintenanceauditadr
by Gleb_SV Aug 28, 2026 6/10
skill GitHub
Keeps a live record of every named part of a project — modules, concepts, entities — updated by the agent as it works, so you and the agent mean the same thing by the same word. Addresses the drift where an agent invents its own vocabulary mid-project.
glossarynamingcontextdocumentation
by All3glory Aug 28, 2026 6/10
skill GitHub
A Claude Code skill that reformats explanations into short chunked steps rather than long paragraphs. Written for ADHD readers, but useful to anyone who loses the thread in a wall of agent output.
accessibilityadhdoutput-styleskill
by cedricrabarijohn Aug 28, 2026 6/10
skill GitHub
A LinkedIn writing skill that interviews you first and is constrained to only use what you actually said. Trades speed for authenticity, avoiding the generic voice that makes AI-written posts obvious.
linkedinwritinginterviewskill
by alexis-morain Aug 28, 2026 5/10
skill GitHub
A portable system prompt and skill for Claude, ChatGPT, Cursor, and other coding agents, structured around test-driven development, explicit debugging protocols, and verification gates before work is called done. Aims to be host-agnostic rather than tied to one tool.
system-prompttddverificationportable
by AKzar1el Aug 28, 2026 5/10
skill GitHub
Skills and review protocols for drafting EB-2 National Interest Waiver petitions and then adversarially poking holes in them. Explicitly educational and not legal advice, but a concrete example of applying agent review protocols outside software.
immigrationdraftingreview-protocolskill
by kateaiuser Aug 28, 2026 5/10
skill GitHub
A Claude skill that structures reasoning into four moves — gather details bottom-up, interpret them in context, verify deliberately, then give one integrated answer — using the lightest process that still works. Aimed at avoiding both sloppy conclusions and unnecessary ceremony.
reasoningverificationprocessskill
by garcane Aug 28, 2026 5/10
skill GitHub
A community atlas collecting AI skills, agent workflows, coding prompts and reusable instruction files aimed at modern web application development. Useful as a starting library when setting up skills for a frontend or full-stack project rather than writing each from scratch.
skillsweb-developmentcollectionprompts
by pneqnp-iswr Aug 27, 2026 6/10
skill GitHub
A guidance pack that corrects the outdated Python idioms models tend to reach for and pushes generated code toward current best practices. Drop it into a project so Claude Code writes modern typing, packaging and stdlib usage instead of legacy patterns learned from old training data.
pythoncode-qualityguidanceclaude-md
by yottayoshida Aug 27, 2026 6/10
skill GitHub
Turns a single prompt into a structured story by first building a blueprint from John Truby's Anatomy of Story framework, then writing prose against it. The two-stage structure keeps long-form fiction coherent instead of drifting. Unofficial and unaffiliated.
writingfictioncreativeagent-skill
by NeuraCerebra-AI Aug 27, 2026 6/10
skill GitHub
A Claude Code skill that audits and optimizes a site across SEO, AEO, GEO, LLMO and Naver NEO without an agency in the loop. Aimed at replacing recurring retainer work with an agent that runs the same checks on demand.
seomarketingauditagent-skill
by leopard627 Aug 27, 2026 6/10
skill GitHub
Meteor-maintained skills covering building, migrating, testing, securing and deploying Meteor 3 applications. Framework-authored rather than community-guessed, so the guidance matches what the Meteor team actually recommends.
meteorjavascriptofficialframeworkagent-skill
by meteor Aug 27, 2026 7/10
skill GitHub
A Claude Code skill that installs, diagnoses and repairs Telegram MTProxy on a remote host over SSH. Specifically catches the case where a proxy behind VPN or Docker advertises a private IP to Telegram — every health check passes green while clients hang on 'Connecting'.
telegramproxysshdevopsagent-skill
by guid-empty Aug 27, 2026 5/10
skill GitHub
A set of eight open-source Agent Skills that turn Claude Code or Codex into a LinkedIn operating system — campaign planning, content and outreach handled from the CLI. Useful if you'd rather script your social presence than click through the web UI.
linkedinmarketingsocial-mediaagent-skill
by sunny-chandel Aug 27, 2026 5/10
skill GitHub
A large MIT-licensed bundle of 83 skills and 10 agents with enforced guardrails, written once and deployable to five different AI platforms. Worth a look mainly for its portability layer — the same skill definitions run outside Claude Code without a rewrite.
skillsagentsportabilityguardrailsmit
by SufficientDaikon Aug 27, 2026 6/10
skill GitHub
A Claude Code plugin packaging a Google Ads knowledge base and audit workflow derived from Nils Rooijmans' public blog and newsletter, with attribution. Unofficial, and written in Dutch. Narrow, but a clean example of turning a practitioner's published body of work into an agent skill.
google-adsmarketingauditplugindutch
by arnozaman Aug 27, 2026 5/10
skill GitHub
A persistent memory hub for Claude Code that stays available no matter which directory you launch from, bundled with a curated skill set and a guided local setup. Solves the annoyance of memory being scoped to a single project root.
memorypersistenceskillssetup
by ManceRayder42 Aug 27, 2026 6/10
skill GitHub
Converts a YouTube video or web article into didactic study notes rendered as a single self-contained HTML page. Works as an agent skill across Claude Code, Codex, Cursor, OpenCode and Gemini rather than being tied to one CLI.
noteslearningyoutubehtmlagent-skill
by davertor Aug 27, 2026 6/10
skill GitHub
Rather than answering 'what do you think?' directly, this skill converts the question into multiple choice and then questions you the way Socrates would until your own view surfaces. Aimed at decision-making where you want the model to sharpen your thinking, not replace it.
socraticdecision-makingthinkingagent-skill
by jungogogogo Aug 27, 2026 6/10
skill GitHub
A learning engine that builds first-principles curricula, verifies understanding through free recall with receipts rather than self-assessment, and schedules review with FSRS. Produces explorable artifacts so the material stays reviewable after the session ends.
learningspaced-repetitionfsrscurriculum
by nagisanzenin Aug 27, 2026 6/10
skill GitHub
Builds a style profile from writing you've actually done — sentence length, vocabulary you reach for and words you never use, how you open a message — then rewrites text to match. Ships a check pass that scores AI tells and a polish pass that strips them. Works with Claude Code, Codex CLI and any agent that reads skills off disk.
writingstylehumanizeragent-skill
by an2n Aug 27, 2026 7/10
skill GitHub
An installable Claude Code security-review skill that insists on executed proof-of-concept evidence rather than a list of plausible-sounding findings. The adversarial framing is aimed squarely at the false-positive problem in agent-generated security reports.
securitycode-reviewadversarialproof-of-concept
by acartag7 Aug 27, 2026 7/10
skill GitHub
A curated list of SRE-focused agent skills, MCP servers and AI-SRE resources. A useful index if you're wiring an agent into incident response, observability or on-call workflows and don't know what already exists.
sredevopsmcpcollectionawesome-list
by anyshift-io Aug 27, 2026 6/10
skill GitHub
A public Apache-2.0 skill library that teaches AI agents how to use the Annie CLI and the Anyshift MCP server correctly. Vendor-specific, but a clean example of shipping usage knowledge for your own tool as skills rather than docs.
mcpclivendor-skillsapache-2.0
by anyshift-io Aug 27, 2026 5/10
skill GitHub
Skills that let AI coding tools run Sokrates source-code analyses, explore the results interactively, and generate configuration. Findings are verifiable against the underlying scan rather than being model assertions about the codebase.
static-analysiscode-qualitysokratesagent-skill
by zeljkoobrenovic Aug 27, 2026 6/10
skill GitHub
A personal Claude Code configuration published in full — 28 skills, 28 agents, deterministic multi-agent workflows and hooks that act as quality gates. Worth reading as a reference for how a heavily-invested setup is actually structured.
dotfilesconfigurationskillshooksmulti-agent
by thkt Aug 27, 2026 6/10
skill GitHub
A Chinese-language index of agent skills for stock analysis, quantitative trading and stock screening, collecting projects from GitHub with compliance notes on reposted material. Narrow domain, but well organized for it.
financequanttradingcollectionchinese
by Serennity007 Aug 27, 2026 5/10
skill GitHub
Takes a viral cover image and produces an annotated anatomy report card explaining what makes it work, plus a reusable recipe. Renders deterministic HTML and uses no crawler, so results are reproducible.
designvisualanalysishtmlagent-skill
by jahidashok714-svg Aug 27, 2026 5/10
skill GitHub
After a workflow finally works, say 'save this as a skill' and it captures the session into an installable SKILL.md. Inverts the usual authoring order — you discover the procedure by doing it, then record it, rather than writing the skill up front. Works with Claude Code, Cursor and Codex.
skillsauthoringsessionsmeta
by rezamini Aug 27, 2026 8/10
skill GitHub
Claude Code skills covering the surrounding half of design work — handoff, specs, naming, and the product documents that sit beside the file — rather than generating the screen itself. Aimed at product designers whose real time sink is everything around the canvas.
figmadesignproductdocumentationagent-skill
by byjunyoung Aug 27, 2026 6/10
skill GitHub
A set of output styles that keep the answers and line numbers identical while changing the persona delivering them, drawn from anime character archetypes. Purely cosmetic, and a compact example of how far output styles can be pushed.
output-stylespersonafuncustomization
by Luscha Aug 27, 2026 5/10
skill GitHub
A Claude Code skill that scripts the whole WeChat sticker pipeline from a single front-facing character image — generation, slicing, automated pre-checks, copy validation and the final submission checklist. Every step is scripted rather than manual.
wechatstickersimage-generationpipelinechinese
by webkubor Aug 27, 2026 5/10
skill GitHub
An unofficial skill encoding the Proxmox documentation house style so generated docs match the project's existing voice and conventions. Narrow, but a good template for anyone maintaining docs against an established style guide.
documentationwriting-styleproxmoxagent-skill
by msoltanov Aug 27, 2026 5/10
skill Reddit
A skill built because the author found Claude Code's native infographic output lacking — it pulls the data, generates the graphics and animates the result. Author is actively asking for feedback on the output quality.
infographicsdatavizanimationagent-skill
by b0nz Aug 27, 2026 6/10
skill GitHub
A skill collection for AI coding agents covering Laravel, PHP, React and TypeScript along with testing, security and general code quality. Framework-specific guidance rather than generic best-practice text.
laravelphpreacttypescripttesting
by AsyrafHussin Aug 27, 2026 6/10
skill GitHub
Reviews Claude Code skills and says plainly what's wrong, citing file and line for each point and ranking the actions to take. Explicitly avoids the padding that makes most generated reviews hard to act on.
code-reviewskillsqualitymeta
by Terryc21 Aug 27, 2026 7/10
skill Reddit
Studies mature public engineering and agent repositories, records the observed patterns with source links and confidence, then distils them into small practice cards you can review and apply. An npm CLI generates the resulting managed guidance directly into CLAUDE.md.
claude-mdbest-practicescliguidanceopen-source
by MadJagStudios Aug 27, 2026 6/10
skill GitHub
A PowerShell library plus Claude skills for the multi-company Pennylane Company API v2, shipped with a catalogue of the API's known pitfalls. The pitfalls catalogue is the interesting part — encoded failure modes an agent would otherwise rediscover the hard way.
apipowershellaccountingagent-skill
by Xileades Aug 27, 2026 5/10
skill GitHub
Looks at your repository the way a first-time visitor would, points out what fails to land, and rewrites the README accordingly. Targets the gap between a project being good and a project looking good on arrival.
readmedocumentationrepo-hygieneagent-skill
by erdalacundakonuk Aug 27, 2026 6/10
skill GitHub
Expands a single sentence into a detailed video, but asks clarifying questions before generating rather than guessing at the intent. The upfront questioning is what separates it from the usual one-shot generators.
videogenerationagent-skill
by minhhoangho Aug 27, 2026 5/10
skill GitHub
A curated directory of Agent Skills for course creators, instructional designers and L&D teams, covering course assets, research, role-play practice, training analysis, visuals and delivery workflows.
educationinstructional-designcollectionagent-skill
by minicoursegenerator Aug 27, 2026 5/10
skill GitHub
A direct-response copywriting skill that runs in Claude Code, Claude.ai, Cursor, ChatGPT or any LLM. Encodes the classic response-driven structure rather than generic marketing prose.
copywritingmarketingportableagent-skill
by Bilusca Aug 27, 2026 5/10
skill GitHub
Audits German text against 72 catalogued AI-writing patterns using deterministic linters and rewrites that preserve the facts. Explicitly refuses to bend facts or use detector-bypass tricks, which sets it apart from most humanizer tools.
writinggermanhumanizerlinting
by marmbiz Aug 27, 2026 6/10
skill GitHub
An open-beta plugin for Codex and Claude Code covering SEO planning, writing, editing, auditing and visual production, with an evidence-safe stance that avoids inventing supporting claims. Broader than the usual single-purpose SEO skill.
seocontentwritingpluginaudit
by flexim-io Aug 27, 2026 5/10
skill GitHub
A portable AI-agent setup that keeps a single canonical rules file working across Claude Code, Codex, and Cursor instead of maintaining three divergent configs. It ships skills, hooks, and a four-layer memory system split into rules, knowledge, structure, and history. Useful if you switch agents often and want one source of truth for behavior.
configmemoryportabilitymulti-agent
by AuroraBackcountry Aug 27, 2026 6/10
skill GitHub
skillsmith turns any process or document into a Claude Skill by interviewing you about it, then drafting, validating, and packaging the result. It runs as a CLI or natively inside Claude products. Lowers the barrier for people who know what they want a skill to do but not how SKILL.md should be structured.
skillsgeneratorcliauthoring
by marcosmodly Aug 27, 2026 8/10
skill GitHub
An agent skill focused on GitHub discoverability: it generates your README, llms.txt, repo topics, and About line so both search engines and LLMs can parse what your project does. Works with Claude Code, Codex, Cursor, and Zed. The author explicitly makes no ranking promises.
readmeseollms-txtdocumentation
by NeuraCerebra-AI Aug 27, 2026 6/10
skill GitHub
A community implementation of the OWASP Agentic Skills Top 10 (AST01-AST10) turned into eleven installable detector skills, each backed by evals. It is explicitly unofficial and carries no OWASP endorsement. Useful if you want a concrete checklist for auditing the skills you install.
securityowaspskillsauditing
by jhkchan Aug 27, 2026 7/10
skill GitHub
A curated directory of QA and testing skills built for AI coding agents including Claude Code, Cursor, and Copilot. It collects testing-specific capabilities in one browsable place rather than leaving you to find them repo by repo. A reasonable starting point if your agent workflow is weak on test authoring.
qatestingskillsdirectory
by PramodDutta Aug 27, 2026 7/10
skill GitHub
A curated skill collection pulling from superpowers, VoltAgent, addyosmani, alireza, and others, adapted to be OpenCode-native. It uses a two-tier catalog: 18 core skills always loaded, 35+ extended skills pulled in on demand. The tiering is aimed at keeping context cost down while retaining breadth.
skillsopencodecatalogcuration
by viasrijan Aug 27, 2026 6/10
skill GitHub
A Claude Code skill that brings Bose SoundTouch speakers back to life after Bose shut down the cloud service they depended on. It stands up a self-hosted replacement, recovers each stations direct stream URL, and verifies every preset actually plays. A good concrete example of using an agent skill for hardware reverse-engineering rather than coding.
hardwareself-hostedreverse-engineeringiot
by bitranox Aug 27, 2026 6/10
skill GitHub
A set of Claude skills that flip a conversation into a named creative writing voice: Yoda, Shakespearean sonnet, stage play, Dr. Seuss, haiku, limerick, Homeric epic, hard-boiled noir, and Hemingway. Each mode carries precise structural rules so the output stays well-formed rather than vaguely themed. Activated by slash command, exited with /normal.
writingstylesslash-commandscreative
by LkwdBrian Aug 27, 2026 6/10
skill GitHub
A single adaptive skill that spans the whole delivery path, from stating intent to shipping a verified release, rather than splitting the work across many narrow skills. The pitch is trustworthy AI software delivery with checks built into each stage. Worth evaluating if you prefer one broad skill over a large catalog.
skillsdeliveryverificationsdlc
by leoncuhk Aug 27, 2026 5/10
skill GitHub
Packages a cross-language engineering coding standard as an AI skill, targeting C, Rust, and Go. Instead of restating style rules in every prompt, the agent loads the standard and applies it consistently. Useful for systems codebases where conventions matter more than the agent guesses.
standardscrustgo
by 29anan29 Aug 27, 2026 6/10
skill GitHub
Claude Code skills for writing and revising non-fiction prose, aimed specifically at removing the tells that mark text as AI-generated. Covers both English and German. From a university research group, so the guidance leans academic rather than marketing-flavored.
writingproseeditinggerman
by UBA-PSI Aug 27, 2026 7/10
skill GitHub
A Claude Code skill that convenes a 25-member panel of famous experts to critique a difficult decision rather than agree with it. The explicit design goal is adversarial feedback instead of a yes-man advisory board. Documentation is in Korean.
advisoryadversarialdecision-makingpanel
by airoasting Aug 27, 2026 6/10
skill GitHub
A Claude Code skill plus written playbook that takes a single unedited facecam recording and produces a finished short-form motion-graphics ad, rendered through HyperFrames. The playbook encodes the editing decisions — pacing, captions, graphic beats — so the agent isn't improvising the format each run. Aimed at creators who want repeatable ad output rather than one-off edits.
skillvideocreativeautomation
by gquthier Aug 27, 2026 6/10
skill GitHub
A CLAUDE.md fragment plus a tuning prompt that trim Claude Code's verbosity — both in the prose it emits and in the volume of code it writes. There is nothing to install: you paste the fragment into your existing config, and the prompt rewrites the rules you already have to match. A cheap experiment if your sessions feel padded.
claude-mdpromptingverbosityconfig
by V-Songbird Aug 27, 2026 6/10
skill GitHub
A Claude Code skills plugin covering everyday Git and GitHub workflows plus the meta-task of authoring new skills. Bundling skill authoring alongside the Git skills means the plugin can help extend itself as your conventions evolve. A reasonable starting pack if you haven't built up a personal skills library yet.
skillsgitgithubplugin
by fvadicamo Aug 27, 2026 6/10
skill GitHub
A read-only audit that reports on the health of your Claude Code skills library — what each skill costs in context, where descriptions overlap, and which entries are duplicates or dead weight. It names the offenders rather than just producing a score, so the cleanup is actionable. Worth running once a skills directory grows past the point you can hold in your head.
skillsauditcontextcleanup
by Mr-heka Aug 27, 2026 7/10
skill GitHub
An agent skill that plans a meeting as a decision process: it names the decision being made, picks the decision rule, cuts the invite list, and prepares for deadlock in advance. Ships fill-in agenda templates and needs no terminal, so non-engineers on the team can use it too. Off the usual coding-tools path but a clean example of skills applied to process work.
skillmeetingsprocesstemplates
by theAnirudhKumar Aug 27, 2026 5/10
skill GitHub
A collection of agent skills aimed at QA work — requirements review, test design, and test automation scenarios — written from practical use rather than as a generic template set. Documentation is primarily in Chinese. Useful if you want the agent participating in test planning instead of only writing test code after the fact.
skillsqatestingautomation
by signjing Aug 27, 2026 6/10
skill GitHub
A verification skill built on the observation that matching row counts and a clean migration run are perfectly compatible with a completely wrong result. It checks the destination data itself rather than trusting the migration job's exit status. Pure stdlib Python with no dependencies, so it drops into most environments unchanged.
skilldatamigrationverificationpython
by shaheershoaib Aug 27, 2026 6/10
skill GitHub
A broad skills collection spanning UI/UX, code repair, security, testing, architecture, backends and APIs, databases, mobile, DevOps, docs, debugging, refactoring, optimization, planning, verification, and auditing. The skills are written to work across major coding agents rather than being Claude Code specific. Large surface area, so cherry-pick rather than installing wholesale.
skillscross-agentarchitecturetesting
by cassielxyz Aug 27, 2026 6/10
skill GitHub
A CLI skill for ClawdHub/OpenClaw that generates CLAUDE.md and AGENTS.md files from architecture decision records. Grounding agent instructions in ADRs means the guidance reflects decisions the team actually made rather than aspirational rules someone typed once. Fits projects already maintaining ADRs.
skillclaude-mdadropenclaw
by actual-software Aug 27, 2026 6/10
skill GitHub
A skills pack covering business strategy work, SEO and generative engine optimization, and analytics, published by the Emotion Machine team. Extends Claude Code past implementation into the planning and measurement side of shipping a product. Narrow audience, but a useful reference if you're writing skills for non-engineering domains.
skillsstrategyseoanalytics
by sarbak Aug 27, 2026 5/10
skill GitHub
A read-only Claude Code skill that audits any web application for security issues and produces an HTML report written to be readable by the system's owner, not just by engineers. Targeted specifically at code generated by AI, where the usual review pass may never have happened. Documentation is in Portuguese.
skillsecurityauditweb
by rootLdr Aug 27, 2026 6/10
skill GitHub
Encodes Keshav's three-pass method for reading papers as agent skills, alongside reproduction specs, paragraph-by-paragraph translation, and durable note-taking. The three-pass structure means the agent triages before committing to a deep read, rather than summarizing everything at the same shallow depth. Aimed at people who read papers seriously and want notes that survive past the session.
skillsresearchpapersnotes
by hirovel Aug 27, 2026 6/10
skill GitHub
A small skills collection built around getting a model to question its own claims rather than assert confidently and move on. The framing is epistemic: make uncertainty explicit as part of the workflow instead of a caveat at the end. Sparse documentation, but the premise is a useful counterweight to agents that never hedge.
skillsepistemicsverificationuncertainty
by h-dubitans Aug 27, 2026 5/10
skill GitHub
Prompting skills and playbooks for AI video generation across Google Veo 3.1, Gemini Omni Flash, ByteDance Seedance, and Alibaba Wan 3.0. Sources are cited, and the material covers cost models, debugging content-filter rejections, and keeping continuity across multiple clips. More operational detail than the usual prompt list.
skillsvideopromptinggenerative
by raphaelbgr Aug 27, 2026 6/10
skill GitHub
An agent skill packaging hard-won conventions for developing Even Realities G2 / EvenHub smart-glasses applications. It front-loads platform gotchas so the agent does not rediscover them on every project. Narrow audience, but a good example of encoding device-specific tribal knowledge as a skill.
skillsmart-glasseseven-realitiesdomain-knowledge
by goodrahstar Aug 26, 2026 5/10
skill GitHub
A skills pack covering month-end close, bank reconciliation, journal entries, GL coding, financial statements, AR aging and three-way match, running against real books through the MosoFin MCP gateway. Every output is a proposal for a human to post, never a direct write, which is a sensible safety design for financial data. Distributed through the mosofin-plugins marketplace and requires a paid subscription.
skillaccountingfinancemcppluginread-only
by mosofin Aug 26, 2026 5/10
skill GitHub
A set of AI skills for customer success teams covering renewal risk assessment, business reviews, onboarding plans, post-call follow-ups and email critique. No setup or external service required. A straightforward example of packaging a non-engineering job function as skills.
skillcustomer-successbusinessno-setup
by CSPulse Aug 26, 2026 5/10
skill GitHub
A Claude Code plugin bundling 23 German-language skills aimed at freelancers and small businesses, marketed as an AI-employee starter kit. Notable mainly as evidence that the skills ecosystem is developing outside English. Useful if you operate in German and want business tasks covered rather than coding tasks.
skillgermanpluginbusinesslocalization
by fabio-baumgartner Aug 26, 2026 5/10
skill GitHub
A Karpathy-style knowledge base paired with two auditor agents that re-measure its claims against the running system before every session, so stale documentation gets caught instead of silently misleading the agent. Ships as an installable Claude Code skill alongside an explanatory article. Directly attacks the problem where memory files anchor an agent to facts that stopped being true weeks ago.
skillknowledge-baseauditdocumentationverification
by yvalenta Aug 26, 2026 6/10
skill GitHub
A self-driving /goal skill that takes one objective, breaks it into falsifiable deliverables, and does one bounded unit of work per cycle. Shell hooks enforce the rules mechanically, on the premise that prose instructions do not hold over long autonomous runs. A useful pattern for anyone whose agent drifts halfway through a multi-hour task.
skillhooksautonomygoalslong-running
by TimothyVang Aug 26, 2026 7/10
skill GitHub
A set of agent skills that encode engineering judgment rather than syntax rules, covering pull-request quality review and TypeScript unit, mutation, and property-based testing. Written to be portable across Cursor, Claude Code, and Codex. Useful if your agents write tests that pass but do not actually test anything.
skillstestingtypescriptcode-reviewmutation-testing
by elearningplugins Aug 26, 2026 6/10
skill Reddit
A first-release plugin that reshapes Claude Code's replies to be cognitively easier to read and scan, aimed at users who find the default answer style dense. The author reports noticeably nicer messages on their own project and pairs it with the newer concise output style. Early and feedback-wanted, but a small fix for a common complaint.
pluginoutput-stylereadabilityux
by t10ko Aug 26, 2026 6/10
skill GitHub
A skill pack for social media research from a coding agent: finding outlier posts, mining comments, competitor teardowns, ad libraries, and trends across TikTok, Instagram, YouTube, Reddit, X, and LinkedIn. Backed by the ScrapeCreators API and works with Claude Code, Cursor, Codex, and Gemini CLI. Note that the data layer is a paid third-party service.
skillsresearchsocial-mediascrapingmarketing
by ScrapeCreators Aug 26, 2026 6/10
skill Reddit
A shared CLAUDE.md snippet that treats prose to the user as the scarce resource and tool calls as free: spend freely on reading, grepping, re-checking APIs, and running tests; spend almost nothing on narrating, restating, summarizing, or offering unrequested alternatives. It explicitly forbids truncating the work or skipping verification to save words. Written after the author noticed Opus 5 becoming terse and productive once told context was low.
claude-mdpromptingopus-5verbosityconfiguration
by pornthrowaway42069l Aug 26, 2026 7/10
skill GitHub
A skill and plugin that lets an agent produce visuals programmatically — both static images and animations — instead of describing what a diagram would look like. Useful for generating charts, illustrations, and motion output as part of a coding session.
skillpluginvisualsanimationrendering
by imshaikot Aug 26, 2026 6/10
skill GitHub
A Claude Code skill that reconstructs your weekly timesheet by reading git history across every repository you configure, inferring hours from the gaps between commit timestamps. A pragmatic fix for retroactive time tracking when you forgot to log anything. Estimates are heuristic, so treat the output as a starting draft.
skillgittimesheetautomationreporting
by lucas-lima-s Aug 26, 2026 6/10
skill GitHub
Combines guardrails for coding agents with workflow skills intended to keep them working on the problem you actually posed. The pairing matters — constraints alone stop bad actions but do not prevent an agent solving the wrong thing. Aimed at long sessions where scope quietly shifts.
guardrailsskillsworkflowscopesafety
by sid-thephysicskid Aug 26, 2026 6/10
skill GitHub
A Claude Code plugin marketplace bundling 35 skills, 15 subagents, and workflow hooks for structured AI-assisted development. Broad enough to serve as a starting kit rather than a single-purpose add-on. As with any large third-party bundle, worth reading the hooks and permissions before installing.
marketplacepluginskillssubagentshooks
by r-bart Aug 26, 2026 6/10
skill GitHub
A model-agnostic skill that removes AI writing tells on two levels: surface phrasing, using the Wikipedia Signs of AI writing list, and narrative structure, using the StoryScope framework from arXiv:2604.03136. The two-layer approach is the interesting part, since most de-slop tools only catch stock phrases and miss structural giveaways.
skillwritingeditingai-detectionprose
by badmuriss Aug 26, 2026 7/10
skill GitHub
Skills covering everything upstream of implementation — lean canvas, PRD, story map, context maps, ADRs, and INVEST-sliced issues — while deliberately leaving the build stage to you. A useful counterweight to tooling that jumps straight to code. Good fit if your agents produce working code for underspecified problems.
skillsproductprdadrplanningrequirements
by clnnn Aug 26, 2026 6/10
skill GitHub
A family of ten skills covering the data-science lifecycle for agents: problem framing, exploration, data prep, metric design, experiments, model auditing, dashboards, reporting, and production analytics. Structured as discrete stages rather than one catch-all analysis skill. Useful if you want an agent to follow a defensible method instead of jumping to a model.
skillsdata-scienceanalyticsexperimentsreporting
by DAlanMtz Aug 26, 2026 6/10
skill GitHub
A UX and UI skill for Claude Code that runs surface-class-aware audits, WCAG 2.2 accessibility checks, visual craft review, research methods, and deceptive-pattern screening, backed by runnable lint tools rather than opinion alone. The deceptive-pattern screening is an unusual inclusion. Good for teams shipping UI without a designer in the loop.
skilluxuiaccessibilitywcagdesign-review
by ahammadnafiz Aug 26, 2026 7/10
skill GitHub
Treats prompt engineering as a routine with steps: it routes to the appropriate artifact, sizes the eval set to the expected volume, and ships both a linter and a benchmark. The emphasis on measurement separates it from prompt-tip collections. Useful if you are maintaining prompts in production and need to know when a change helped.
skillprompt-engineeringevalslinterbenchmark
by AdrianAdem Aug 26, 2026 6/10
skill GitHub
Give it a URL and it returns a crawler's-eye pass/fail report backed by evidence, running 26 structural SEO checks with no LLM involved in the verdicts. Determinism is the point — the same page always produces the same result, unlike a model asked to eyeball SEO. Packaged as an Agent Skill so it drops into an existing workflow.
skillseodeterministicauditweb
by tigerless-labs Aug 26, 2026 7/10
skill GitHub
A skill for finding project opportunities that requires evidence for each idea rather than generating plausible-sounding suggestions, with explicit anti-slop constraints. Works with Claude Code and Codex. Useful if brainstorming sessions with an agent tend to produce confident but unfounded ideas.
skillideationresearchevidencecodex
by lokicik Aug 26, 2026 5/10
skill GitHub
Checks a CLAUDE.md or AGENTS.md for size problems, dead file references, and claims that have drifted from reality, then does the part nobody else does: backtests each rule against your own session history to show which rules actually get followed, which get ignored, and which never come up. The report cites its evidence. Directly targets the common problem of instruction files that keep growing while quietly losing effect.
claude-mdauditagents-mdsession-historyconfiguration
by agent-clinic Aug 26, 2026 8/10
skill Reddit
A working list of banned words and phrasing patterns one user keeps in AGENTS.md to stop the model producing invented jargon and compressed buzzwords. The thread collects additions from other people hitting the same problem. Copy-pasteable if you want plainer output.
claude-mdwritingprompting
by endgamer42 Aug 26, 2026 5/10
skill Reddit
A short report on stacking two published skills — caveman and ponytail — to cut Opus 5 responses down to a few readable lines. Includes links to both on skills.sh and a screenshot of the result. Worth a look if verbose agent output is slowing your review loop.
skillsoutput-styletokens
by zyakita Aug 26, 2026 5/10
skill Reddit
The author built an Agent Skill for backend performance review, then blind-tested it against their own manual review of the same public repo. The agent found a Python 2 except clause in fastapi/full-stack-fastapi-template that made the module unimportable — something reading alone had missed. A concrete argument for execution-based review skills.
skillscode-reviewperformancetesting
by Alarmed_Offer_3213 Aug 26, 2026 7/10
skill Reddit
Concrete CLAUDE.md rules addressing specific Opus 5 habits, starting with its reluctance to spawn subagents by default — which lets the main context fill with detail it does not need. Includes a delegation section spelling out self-contained briefs and read-only exploration that returns conclusions, not file contents.
claude-mdsubagentsdelegationcontext
by ychamel Aug 26, 2026 7/10
skill GitHub
A troubleshooting knowledge base packaged as a skill for Codex, Claude Code, and opencode, which accumulates cases as the agent hits and resolves them. Bilingual Chinese/English. Aimed at teams that keep debugging the same class of failure across projects.
troubleshootingknowledge-baseskills
by cjc505 Aug 26, 2026 6/10
skill GitHub
Attach a PDF tender or device datasheet and ask questions — no account needed. Multilingual (English, Simplified and Traditional Chinese). A narrow domain, but a clean example of packaging document expertise as a skill.
pdfdocumentsdomain-skill
by Leon-SG Aug 26, 2026 5/10
skill GitHub
A GEO/AI-search audit toolkit built around two original tools — agent-readiness-scan and audit-report-kit — plus the method connecting them. For checking whether your site is legible to AI search and agent crawlers.
seogeoauditai-search
by techhorizonlabs Aug 26, 2026 5/10
skill GitHub
One SKILL.md teaching agents modern CSS with Baseline browser-support awareness, so suggestions account for what actually ships. Works across Claude Code, Codex, Cursor, Pi, OpenCode, and Kiro.
cssfrontendbaselineskills
by PyModel Aug 26, 2026 6/10
skill GitHub
A Claude Code skill that generates a shareable HTML explainer with Technical, User, and Business tabs from any project or idea. The output is meant to be readable by both humans and agents, so it doubles as project context.
documentationdiagramshtmlskills
by svag2003 Aug 26, 2026 6/10
skill GitHub
A math research toolkit packaged as an agent skill, aimed at AI and cryptography problems. Chinese-language. Niche but a substantial example of encoding deep domain knowledge into a skill.
mathcryptographyresearchskills
by the-thinker0 Aug 26, 2026 5/10
skill GitHub
Skills covering design, implementation, review, and team standards that compose rather than replace each other. The pitch is better process rather than better prompts — the constraint lives in the workflow, not in one large instruction block.
skillsprocessreviewstandards
by techygarg Aug 26, 2026 6/10
skill GitHub
Two skills for long-lived agents — context-budget audits per-turn token weight and fails CI when context bloats, and claim-audit flags factual claims the agent has not verified. Standalone tools, CI-ready, compatible with Claude Code, Codex, and OpenCode.
contexttokensciverification
by trac3r00 Aug 26, 2026 6/10
skill GitHub
An open-source skill that detects filler patterns in writing and removes them while leaving the factual content intact, scoring the draft before and after so you can see what changed. Useful for anything an agent drafted that a human has to sign.
writingeditingai-slopskills
by manavmishra Aug 26, 2026 6/10
skill GitHub
A collection covering use cases, meeting reviews, technical summaries, training manuals, translation, and web-to-document conversion, plus a documentation-lifecycle consolidation toolkit. Broad but practical if you generate a lot of internal docs.
documentationskillsgenerators
by StefanoZaghi1987 Aug 26, 2026 5/10
skill GitHub
A skill covering query diagnosis and rewriting across PostgreSQL, MySQL, SQLite, and SQL Server, including EXPLAIN plan interpretation and index strategy. Gives the agent a method instead of leaving it to pattern-match on the query text.
sqlperformancedatabaseskills
by myclaude-sh Aug 26, 2026 6/10
skill GitHub
Pipeline validation for GitHub Actions, GitLab CI, CircleCI, Jenkins, and Azure DevOps, bundling a security scanner and a performance profiler. Paid tier of a larger skill family.
ci-cdsecurityvalidationskills
by myclaude-sh Aug 26, 2026 5/10
skill GitHub
Teaches agents to handle API and tool call failures with exponential backoff plus jitter, circuit breakers, timeout management, and rate-limit handling. Relevant if your agent silently gives up or hammers a failing endpoint.
resilienceretriescircuit-breakerskills
by myclaude-sh Aug 26, 2026 6/10
skill GitHub
A skill that audits CLAUDE.md, cursor rules, and project config files for the structural flaws that cause rule non-compliance — ambiguity, conflicts, and placement problems — rather than just restating the rules louder. Answers the recurring "it keeps ignoring my instructions" complaint.
claude-mdrulesauditcompliance
by myclaude-sh Aug 26, 2026 7/10
skill GitHub
A publicly usable skill collection from LOGIN in the SKILL.md format, working with Claude Code, the Claude app, and the API. German-language documentation.
skillsgermancollection
by LOGIN-TB Aug 26, 2026 5/10
skill GitHub
An open-source agent skill for social listening, competitor-user research, content opportunity spotting, and product-demand validation, with the emphasis on citing evidence rather than asserting trends.
researchsocial-listeningmarketskills
by datou202307-design Aug 26, 2026 5/10
skill GitHub
A small plugin bundling skills for AI-assisted development across three areas: working with research papers, Python development, and publishing to GitHub Pages.
skillspythonresearchgithub-pages
by geronimo-iia Aug 26, 2026 5/10
skill GitHub
Sixteen named pattern categories, a 70-term banned vocabulary list, and a built-in self-check pass that re-reads its own output. Italian and English. More prescriptive than most humanizer skills because the patterns are enumerated rather than described.
writingeditingitalianskills
by giudegio-ai Aug 26, 2026 6/10
skill GitHub
Produces GPT images from Codex or Claude Code using an existing ChatGPT subscription rather than the Images API, avoiding per-image API billing. Handy if you already pay for ChatGPT and want images inside your coding session.
imageschatgptskillsgeneration
by GENEXIS-AI Aug 26, 2026 6/10
skill GitHub
Complete Chinese-language study notes on CIE colorimetry, CIEDE2000, CIECAM02, chromatic adaptation, and color rendering, packaged as a skill. Also works with Codex.
color-sciencechineseskillsreference
by Ayueh0102 Aug 26, 2026 5/10
skill GitHub
A Claude Skill that lays down a modern Python project in one step with the current standard toolchain already wired together. Saves the usual round of config fiddling at the start of a project.
pythonuvruffscaffolding
by akakritagya Aug 26, 2026 6/10
skill GitHub
One design system expressed as two Claude Code skills: a house web style checked by a five-lens agent audit, and a pipeline taking Blender scenes to web 360 tours.
design-systemauditblenderskills
by sva-admin Aug 26, 2026 5/10
skill GitHub
A skill for pushing a short message from an agent to a phone, with no account required. Simple enough to wire into a long-running session as a completion ping.
notificationsmobileskills
by sudo5zzb Aug 26, 2026 5/10
skill GitHub
Three chained agent skills producing markdown and xlsx outputs, with a proof audit that blocks unverified claims from reaching the positioning. The audit gate is what separates this from a prompt chain.
marketingpositioningchained-skillsaudit
by aj-suresh Aug 26, 2026 5/10
skill GitHub
An open-source skill for PostKing covering post generation, multi-week content planning, blog articles, and landing pages. Installable in Hermes, Claude, and Codex.
content-marketingskillspublishing
by bitsandtea Aug 26, 2026 5/10
skill GitHub
A Claude Code skill turning raw COROS watch data into a performance curve adjusted for gradient, heat, humidity, and altitude using published physiological models rather than heuristics.
fitnessdata-analysisskillscoros
by MaximeBedoin Aug 26, 2026 5/10
skill GitHub
Takes chat-pasted content and builds a searchable knowledge base with ad detection, translation, and summarization, kept local-first and RAG-ready. Zero dependencies, works across Hermes, Claude, Codex, and Cursor.
knowledge-baseragtranslationskills
by atukunare Aug 26, 2026 5/10
skill GitHub
Multi-engine, cross-platform Prolog sandboxing covering Scryer, SWI, and Trealla, with agent standards and a skills toolkit. Supports Google Antigravity, Claude Code, GitHub Copilot, and Cursor.
prologsandboxskillslogic-programming
by dougransom Aug 26, 2026 5/10
skill GitHub
Scans a dbt project for the gaps — missing descriptions, ambiguous naming, undocumented logic — that cause an agent pointed at the data to produce confidently wrong answers.
dbtdataauditagent-readiness
by GetCassis Aug 26, 2026 6/10
skill GitHub
A Claude Code skill covering live site audits, Core Web Vitals, Search Console, validated JSON-LD, and Brazilian Portuguese copy. Evaluates, fixes, and then verifies rather than only reporting.
seoportugueseweb-vitalsskills
by pedrenrick Aug 26, 2026 5/10
skill GitHub
Give it one subjective failure mode plus real labeled traces and it produces an LLM evaluator prompt that returns a binary verdict. Constraining the output to Pass/Fail is what makes the resulting judge usable in CI.
evalsllm-judgepromptingskills
by m1nga Aug 26, 2026 6/10
skill GitHub
Extracts a quantified style fingerprint from real writing samples, then scores drafts against it so AI phrasing does not gradually take over your voice. More measurable than the usual "write like me" prompt.
writingstyleevalsskills
by m1nga Aug 26, 2026 6/10
skill GitHub
Validates an LLM evaluator against labeled data before it grades production output, reporting true positive and true negative rates alongside bias and uncertainty. The step most eval pipelines skip.
evalsllm-judgemetricsskills
by m1nga Aug 26, 2026 6/10
skill GitHub
A skill for framing under-specified problems and holding several genuine options open, converging only when evidence or stated values justify a decision — instead of the model picking an answer on turn one.
reasoningdecision-makingskills
by m1nga Aug 26, 2026 5/10
skill GitHub
Captures an idea that surfaces mid-task, dispatches bounded background work to a sub-agent, and returns the result to the main session. Directly targets the derail that happens when you chase a tangent inline.
sub-agentscontextdelegationskills
by m1nga Aug 26, 2026 6/10
skill GitHub
Analyzes experimental evidence, evaluates the claims drawn from it, and produces structured research reports. Aimed at checking whether the conclusions a paper reaches are supported by its data.
researchevidenceauditskills
by SreeDharshan-GJ Aug 26, 2026 5/10
skill GitHub
Covers delegation, self-auditing, loops, and incident journals, bundled with 22 reusable skills for audit, workflow, documentation, and state handoff. Russian-language. Written for projects that outlive any single session.
operationsdelegationskillsrussian
by VibeEngineering-LLC Aug 26, 2026 5/10
skill GitHub
Runs software work as a factory rather than a conversation, with separation of duties across four stages, plus vskills, a zero-dependency installer. Done is a locked command that exits 0 — the claim is checkable, not asserted.
pipelinereviewseparation-of-dutiesskills
by vraj-ai Aug 26, 2026 6/10
skill GitHub
Covers evidence-backed skill creation plus discovery, updates, rollback, and quarantine through a user-defined marketplace, with distribution to 17 platforms. Quarantine and rollback are what most skill tooling lacks.
skillslifecyclemarketplacegovernance
by FrancyJGLisboa Aug 26, 2026 6/10
skill GitHub
A Claude Code plugin that derives one authored moment from the page's own argument, enforces a mechanical craft floor, and runs a cliche detector over the copy. Targets the sameness of AI-generated marketing pages.
landing-pagesdesigncopywritingplugin
by MartinOlivero Aug 26, 2026 5/10
skill GitHub
A community pack built on the public Reqbeat API that converts live hiring signals into sales pipeline. Narrow use case, but a clean template for wrapping a public API as a set of skills.
skillsapihiringsales
by reqbeat-growth Aug 26, 2026 5/10
skill GitHub
A Claude Code skill that sends a single hard question to five models outside the Claude family in parallel, then reconciles their answers. Diversity across model families is the point — five Claudes would share the same blind spots.
multi-modelconsensusskillsreview
by heiyuneo Aug 26, 2026 6/10
skill GitHub
Covers the full content creation pipeline plus content retrieval from 30 platforms and a developer toolbox. Chinese-language, with video tutorials referenced on Douyin.
contentchineseskillscollection
by hanzhcn Aug 26, 2026 5/10
skill GitHub
A free router skill that picks the right procedure for the situation, bundled with Router, To-Spec, Grill, and Skill Craft modules adapted from mattpocock/skills under MIT.
soprouterskillsworkflow
by jalano0i9u8y7-lab Aug 26, 2026 5/10
skill GitHub
A Codex and Claude Code skill that reads your problem statement and picks which of 17 analysis methods actually applies, instead of running a fixed heavyweight planning template every time. Each method is evidence-gated with explicit stop conditions so the agent stops as soon as more analysis would not change the decision. Zero dependencies.
skillplanningdecision-makingcodex
by nnfct Aug 26, 2026 7/10
skill GitHub
A Claude Code and Cursor plugin that replaces ad-hoc grep-and-read exploration with a fixed structure: 18 rules, 20 skills, and 11 enforcement hooks. The pitch is structure over search — spend tokens on a known layout rather than brute-forcing the codebase each session. Aimed at teams that keep re-paying the same discovery cost.
plugincontext-engineeringhookscursor
by lparfieniuk Aug 26, 2026 6/10
skill GitHub
A skill that takes a single semantic SVG master and generates a reviewed icon family for every target — favicon, PWA, Tauri, Electron, and system tray. Its design rule is that distinctiveness comes from specificity, and it verifies each output stays legible at 16px. Removes a fiddly manual export step from app projects.
skilldesigniconssvgtaurielectron
by snowyukitty Aug 26, 2026 6/10
skill GitHub
One developer's curated skill set covering reviewable planning, disciplined execution, and capturing durable engineering lessons back into the repo. The lessons layer is the interesting part — it treats what went wrong as a persistent artifact rather than something lost at session end. Worth reading as a template for your own stack.
skillsplanningexecutionlessons-learned
by hani-q Aug 26, 2026 5/10
skill GitHub
A Claude Code plugin with 8 skills and 24 tools for academic manuscript work, calibrated against ApJ, MNRAS, PRD, and JCAP-class corpora. Enforces non-waivable integrity blockers, a zero-target lexicon for AI tells, and explicit measurement states so a missing calibration never silently reads as a clean result. Serious tooling for physics and astronomy writing.
pluginacademicwritingresearchintegrity
by skymanbp Aug 26, 2026 7/10
skill GitHub
A skill set for enterprise sales workflows — account research, prospect qualification, and execution steps — derived from real GTM practice rather than generic prompts. Example of Claude Code skills applied outside software engineering. Useful template if you're packaging domain expertise as skills.
skillssalesresearchgtm
by hannahstone15 Aug 26, 2026 6/10
skill GitHub
A root-level Claude Code skill implementing a full local-first memory lifecycle, including the part most memory systems skip: forgetting. Adds audit and consolidation workflows so accumulated memories get reviewed and merged rather than growing without bound. Pairs naturally with staleness-focused memory tools.
skillmemorylocal-firstconsolidation
by TerminallyLazy Aug 26, 2026 6/10
skill GitHub
A set of skills targeting the tells that mark generated prose — predictable structure, hedge stacking, and the usual vocabulary giveaways. Applies as a rewriting pass over drafts rather than a prompt prefix. Handy for docs, READMEs, and anything customer-facing that a model drafted.
skillwritingeditingprose
by whit3rabbit Aug 26, 2026 6/10
skill GitHub
Points an agent at your full Claude, Codex, and Cursor history and produces an audit of your real working patterns — counts, dates, and counterexamples rather than impressions. Deliberately built to surface evidence that contradicts your self-narrative. A more rigorous cousin of the built-in insights command.
skillsauditanalyticshistoryself-review
by YannisKiefer Aug 26, 2026 7/10
skill Reddit
Takes an existing static site and generates localized versions while preserving SEO and site structure — handling translation extraction, batching, localized pages, hreflang, canonicals, sitemaps, RTL languages, and a verification pass. Open source and requires no ConveyThis account despite being built by them. Covers the tedious SEO plumbing most ad-hoc translation attempts get wrong.
skilllocalizationi18nseostatic-site
by alexburan Aug 26, 2026 7/10
skill GitHub
Reads native iOS (SwiftUI) and Android (Jetpack Compose) source and extracts the implicit design system into a DESIGN.md — colors, spacing, type scale, component patterns. No build, no simulator, no dependencies; it works purely from source. Gives an agent a stable design contract to code against on mobile projects.
skilldesign-systemswiftuijetpack-composemobile
by seunghan91 Aug 26, 2026 6/10
skill GitHub
A Claude Code plugin marketplace pairing 8 general engineering skills with doc-this, a 14-skill pipeline that walks a legacy codebase and produces traceable, ATDD-ready specifications. The reverse-engineering pipeline is the standout — it targets the case where the code is the only surviving documentation. Installable as a marketplace.
marketplaceskillslegacy-codespecsatdd
by wagneripjr Aug 26, 2026 6/10
skill GitHub
A Spanish-language plugin marketplace with two stack-specific bundles: backend@jl-stack covering Go, MySQL, Docker, and AWS, and frontend@jl-stack covering React/Next.js, shadcn, performance, and OWASP. Stack-scoped skills rather than a generic collection. Useful if your stack matches.
marketplacepluginsgonextjsowaspspanish
by JoseLuis21 Aug 26, 2026 5/10
skill GitHub
A UI design skill enforcing a NASApunk aesthetic — golden-age NASA palette, report-figure style charts — with a zero-overlap auditor that catches layout collisions before you see them. Portable across 9 agent stacks rather than Claude Code only. Documented in both Chinese and English.
skillui-designaestheticchartsaudit
by duanth Aug 26, 2026 6/10
skill Reddit
A discussion thread collecting the global and project-level directives practitioners consider mandatory, plus how they structure them — verbose versus short, greppable versus prose. The shared examples include a notable rule that auto-memory is evidence and provenance, not higher authority than the current source. Good source material for auditing your own CLAUDE.md.
claude-mddirectivesconfigurationmemorydiscussion
by allemaar Aug 26, 2026 6/10
skill GitHub
A toolkit bringing security review into the AI-assisted development loop rather than bolting it on at the end. Covers secure-development practices as agent-executable checks. Fits alongside runtime guardrail tools, which address a different layer.
securitytoolkitsecure-developmentreview
by Twodragon0 Aug 26, 2026 6/10
skill Reddit
A skill pack covering defensive security auditing, written by distilling an extended session with a less refusal-prone model into reusable skills. Originates from a real frustration: sandboxing and isolation work kept triggering refusals. The author is upfront about not being a security expert, so treat these as a starting point to review rather than authoritative.
skillssecurityauditdefensivesandboxing
by Sakhund Aug 26, 2026 7/10
skill GitHub
Takes the ARIS loop — plan, draft, adversarial review, iterate, persist — and applies it outside academic research to investment due diligence, legal work, market analysis, self-directed learning, journalism, and engineering post-mortems. The adversarial review step is what distinguishes it from generic research prompting. Bilingual documentation.
skillresearchadversarial-reviewdue-diligenceworkflow
by wanshuiyin Aug 26, 2026 6/10
skill GitHub
Checks an autoresearch paper for self-consistency and fabrication across 61 signals — 46 verdict-bearing integrity hack-patterns in families A through H, 13 zero-weight AI writing-style impressions, and 2 advisory — producing a deterministic verdict. Explicitly not an opaque AI-text classifier: every signal is inspectable. Designed as the dual of ARIS, for the reviewer's side of the table.
skillresearch-integrityreviewforensicsacademic
by wanshuiyin Aug 26, 2026 6/10
skill GitHub
Audits a site for classic search SEO, then separately checks answer-engine optimization — whether ChatGPT, Claude, Perplexity, Gemini, and Google AI Overviews can actually crawl, parse, and cite the content. The AEO half is the newer and less covered problem. An MIT-licensed fork of claude-seo.
skillseoaeoauditanswer-engines
by Solnest-AI Aug 26, 2026 6/10
skill GitHub
Builds premium scroll-driven websites against a real design standard: eight mutually exclusive page grammars, a required signature move per build, a headless-browser verification pass, and a fingerprint gate that prevents two of your sites from sharing a skeleton. The anti-sameness gate is the notable mechanism — most generation skills happily produce the same layout forever.
skillweb-designscrollverificationplugin
by samdoom-coder Aug 26, 2026 6/10
skill GitHub
A bank of 20 Claude skills written in Spanish and organized across six business areas, built for the regulatory and cultural context of Latin America. It is part of the XPROF Empresas 5.0 program. One of the few substantial non-English business skill collections in the ecosystem.
skillsspanishbusinesslatam
by Comunidad-XPROF Aug 25, 2026 6/10
skill GitHub
A skill collection covering frontend, backend, mobile, infrastructure, and QA with framework-specific guidance for each. Every workflow includes a verification step rather than ending at "written." The verification emphasis is what distinguishes it from the many generic skill packs.
skillsverificationfullstackqa
by Aarvion-AI Aug 25, 2026 6/10
skill GitHub
A single Markdown file that instructs coding agents to skip the self-imposed ceremony — status files, plan documents, progress trackers — and just do the work. The author benchmarked it on gpt-5.6-sol and reports zero ceremony across twelve trials in five scenarios. Small, testable, and easy to drop into any project.
promptsimplicitybenchmarkinstructions
by MongLong0214 Aug 25, 2026 6/10
skill GitHub
Fourteen skills covering commercial real estate work: due diligence, underwriting, lease and loan review, title and survey analysis, and market research. They need no API keys and run against Claude, ChatGPT, or any LLM. A concrete example of domain-expert skills rather than developer tooling.
skillsreal-estatefinancedue-diligence
by cre-ai-skills Aug 25, 2026 6/10
skill GitHub
A Claude skill that converts documents, articles, and brainstorms into interactive mind maps and then links them into a personal knowledge atlas. It goes past layout with contradiction detection, gap analysis, and source attribution, plus seven export formats and adaptive layouts. Notably more ambitious than typical diagram-generation skills.
skillmindmapknowledgevisualization
by 0x-man Aug 25, 2026 7/10
skill GitHub
Gives Claude Code multimodal vision capability when running on a text-only LLM backend, for screenshot, UI, and chart analysis. Paired with a browser harness it can perform automated frontend layout checks. Aimed at users running Claude Code against alternative models that lack native image input.
skillvisionscreenshotsui-testing
by xiincs Aug 25, 2026 6/10
skill GitHub
An SEO audit skill built around a fixed registry of 217 checks, where every item gets an explicit status and coverage is reported separately from the score. The separation is the point: a thin audit that only ran 30 checks cannot masquerade as a passing site. A good template for making any agent audit honest about what it actually inspected.
skillseoauditdeterministic
by thegreatsao Aug 25, 2026 7/10
skill GitHub
A Chinese-language project-based-learning resource set for teachers and parents, bundled with one-click-installable AI skills that generate PBL lesson plans. Combines curated open educational material with the tooling to produce new plans from it. A domain example of skills built for educators rather than developers.
skillseducationchineselesson-plans
by excellence-wh Aug 25, 2026 5/10
skill GitHub
A Claude Code skill that audits a repository for absent safeguards — CI that never triggers on pull requests, a check target that silently rewrites files, a migration with no gate in front of it — and returns a numbered plan. It changes nothing until you choose an item. The "diagnose, then wait" contract is what makes it safe to run on a real repo.
skillciauditengineering-practices
by rlx Aug 25, 2026 7/10
skill GitHub
A Claude Code skill that exhaustively verifies a code or config change: every change site, boundary conditions, file integrity, and the upstream and downstream call chain. It refuses to report "all OK" without command output backing the claim. Directly targets the failure mode where an agent declares success it never checked.
skillverificationreviewevidence
by zhujian0409 Aug 25, 2026 7/10
skill Reddit
A small skill set that changes the shape of an assistant's answer based on your current state — so saying you are overloaded does not get you a twelve-step productivity plan, and saying you are foggy does not get you five things to remember. Includes modes such as overloaded-mode for shrinking the response instead of expanding it. An unusual and practical take on skills as tone and format control.
skillsuxpromptingaccessibility
by Sad_Construction2179 Aug 25, 2026 6/10
skill GitHub
Seven agent skills tuned for Chinese cultural contexts: guofeng IP characters, WeChat sticker packs, app icons, Xiaohongshu covers, WeChat article headers, blind-box figurines, and the twenty-four solar terms. Derived from and crediting s1dashu's ip-as-logo-skill. A good illustration of skills adapted to a specific market's visual conventions.
skillsdesignchineseimage-generation
by Dwade8128 Aug 25, 2026 5/10
skill GitHub
An agent skill that searches the open skill ecosystem for what you need, then asks whether to install it permanently or load it just for this session. The load-once option keeps your permanent skill set from bloating with one-time needs. A sensible answer to skill discovery now that the ecosystem is large.
skilldiscoveryinstallationmeta
by ipavelm Aug 25, 2026 7/10
skill GitHub
A Claude skill that produces design tokens in the W3C DTCG format, renders an HTML preview, and builds the corresponding Figma Variables library. It closes the loop between a token definition and something designers can actually use. Standards-compliant output rather than an ad-hoc token format.
skilldesign-tokensfigmadtcg
by Blingkusano Aug 25, 2026 6/10
skill GitHub
A Claude skill that performs automated technical analysis on Forex and crypto markets by pulling data through the Simsar and CCXT MCP servers. Explicitly a work in progress and open to contributions. Interesting as an example of a skill built on top of live-data MCP servers rather than static knowledge.
skilltradingmcpccxt
by avatGit Aug 25, 2026 5/10
skill GitHub
A Portuguese-language agent skill for studying programming and mathematics through coding: it keeps memory between sessions, issues TDD challenges validated by mutation testing, and maintains a master document that teaches an LLM to reconstruct the whole system. Mutation testing as the validity check for practice exercises is a nice touch. Aimed at deliberate practice rather than passive tutoring.
skilleducationtddmemoryportuguese
by frederico-kluser Aug 25, 2026 5/10
skill GitHub
Russian-language Claude Code skills for setting up and analyzing Yandex Direct advertising campaigns. Covers campaign configuration and analytics workflows. A useful pattern for anyone building skills around a regional ad platform's API.
skillsadvertisingyandexrussian
by visualklik Aug 25, 2026 5/10
skill GitHub
A cross-platform agent skill that runs an independent, evidence-backed evaluation of work, portable across Codex, Claude Code, and Agy CLI. The independence framing matters — it is designed to assess work it did not produce. Part of the growing pattern of using a separate agent pass as a check on the first one.
skillevaluationreviewcross-agent
by clearlove7818 Aug 25, 2026 6/10
skill GitHub
A live directory of Claude and Codex agent skills organized by category, refreshed daily, with the ability to combine skills into bundles. It is browsable rather than a static README list. Useful as a discovery surface now that skill repos number in the thousands.
skillsdirectorydiscoverycuration
by skymined Aug 25, 2026 7/10
skill GitHub
Curated bundles of memories, rules, and skills that are scoped to specific paths in your repository, so an agent working in one directory gets the knowledge relevant to it. Works with Claude Code, Cursor, Codex, Copilot, Windsurf, and any MCP client. First-party and free.
knowledgerulesskillspath-scopedmcp
by pathrule Aug 25, 2026 6/10
skill Reddit
A designer-built skill collection that takes a fuzzy idea and surfaces the actual decisions, tradeoffs, and options before any execution starts — usually rendering them visually so they are quick to digest. It is aimed at the pre-implementation phase where most agent workflows jump straight to code. A useful counterweight to plan-and-build defaults.
skillsdesignplanningdecisions
by jontomato Aug 25, 2026 6/10
skill GitHub
Seventeen skills written to the open SKILL.md Agent Skills standard, covering engineering discipline, research, safely killing processes, and thinking with the ability to back out of a decision. Russian-language, installable into Claude Code, OpenCode, Codex, Gemini, or any harness. The safe-process-kill and rollback-thinking skills address real agent failure modes.
skillsrussiandisciplineresearch
by aidvizhhub Aug 25, 2026 5/10
skill GitHub
In-depth security-audit skills for Claude Code built on the v12x method: run deterministic tools first, then actively try to refute every finding, and return a verdict rather than a score. The refutation step is aimed squarely at the false-positive flood that makes most agent security audits unusable. A strong pattern to borrow for any audit skill.
skillsecurityauditverification
by V12X Aug 25, 2026 7/10
skill GitHub
A cross-agent skill that brings your git branches up to date before any AI coding work begins, so the agent is not building on a stale base. Emphasis on doing it safely rather than blindly pulling. Small but prevents a genuinely common and annoying class of merge pain.
skillgitsynccross-agent
by vaibhavarora14 Aug 25, 2026 6/10
skill GitHub
Eleven Claude Code skills spanning intent, architecture, craft, interaction, adaptation, state, experimentation, forensics, critique, review, and shipping — the full arc of building an interface. It treats critique and forensics as first-class steps rather than afterthoughts. One of the more thoroughly decomposed UI skill sets available.
skillsuidesignfrontendreview
by Dragoon0x Aug 25, 2026 6/10
skill GitHub
Claude Code skills encoding Clean Code practice for Python, TypeScript, and Java, idiomatic Go conventions, and the Gang of Four design patterns. Gives the agent an explicit standard to write against instead of inferring one from the codebase. Handy for teams that already hold these as house style.
skillsclean-codedesign-patternsgotypescript
by CasLubbers Aug 25, 2026 6/10
skill GitHub
A Claude skill backed by Python scripts that analyzes construction drawings — splitting sheets, extracting polygons, and classifying drawing types — for general contractors, estimators, and project managers. The scripts do the deterministic geometry while the skill handles interpretation. A solid template for skills over technical document formats.
skillconstructionpdfpython
by hamzaabduljabbar Aug 25, 2026 6/10
skill GitHub
Converts a rough product idea into a specification detailed enough for a coding agent to execute directly. Works with Claude Code, Codex, OpenCode, Cursor, Gemini CLI, and any Agent Skills client. Targets the gap where "build me a SaaS" is too vague to act on.
skillspecplanningsaas
by Megaleios Aug 25, 2026 6/10
skill GitHub
A marketplace of Spring Boot skills usable from both Claude Code and Codex. Gives the agent framework-specific conventions instead of generic Java advice. Useful for JVM teams where Spring idiom matters as much as correctness.
skillsspring-bootjavamarketplace
by a-pavithraa Aug 25, 2026 6/10
skill GitHub
A set of Claude skills intended to shift Opus 5's working style toward Fable 5's. Aimed at people who prefer one model's behavior but want or need to run the other. An unusual use of skills as behavioral tuning rather than added capability.
skillsopusfablebehavior
by gncdev Aug 25, 2026 6/10
skill GitHub
A quality gate for the prose agents produce — READMEs, docs, commit messages, release notes — that works across harnesses rather than being tied to one. Applies editorial standards where most tooling only gates code. Useful if agent-written text ships to users.
writingquality-gatecross-agentdocs
by carlosboeing Aug 25, 2026 5/10
skill GitHub
A Claude Code skill that watches a YouTube video on your behalf and returns a report with judgments you can check, installable with a single line. Korean and English documentation. Saves the time cost of videos that turn out not to be worth watching.
skillyoutubesummarizationkorean
by promotoa Aug 25, 2026 6/10
skill GitHub
A skill library for lawyers practicing in mainland China, covering case handling and contract work. Published as open Agent Skills so the legal reasoning is inspectable rather than hidden in a product. One of the more substantial jurisdiction-specific legal skill sets published so far.
skillslegalchinesecontracts
by Lawyeah-Tech Aug 25, 2026 6/10
skill GitHub
A Claude Code skill for the moment you step away from the machine: it takes over autonomously while maintaining a ledger of everything within its blast radius and adhering to a defined report contract. Also plays a Volkswagen jingle, which tells you the tone. The blast-radius ledger is the genuinely useful idea underneath the joke.
skillautonomyhandoffsafety
by sterlixlol Aug 25, 2026 6/10
skill GitHub
Skills covering NixOS and Nixpkgs so an agent can work with Nix expressions and system configuration correctly. Nix is exactly the kind of ecosystem where models guess badly without explicit guidance. Valuable for a community that is underserved by general-purpose coding assistance.
skillsnixnixosinfrastructure
by atvari-eu Aug 25, 2026 6/10
skill GitHub
A pack covering the real lifecycle of a Playwright suite: scaffolding specs, hardening brittle locators, triaging a red suite, reviewing a test diff, and scoping the work before any of it begins. The scoping-first step is unusual and prevents the agent from rewriting the whole suite. One of the more complete testing skill sets available.
skillsplaywrighttestingsubagents
by AndreiBanu1 Aug 25, 2026 7/10
skill GitHub
Reusable agent skills implementing a five-stage pipeline — brainstorm, interview, plan, execute, review — that works in both Cursor and Claude Code. The interview stage between brainstorming and planning is what keeps the plan grounded in your actual intent. A clean, portable structure for feature work.
skillsplanningreviewcursor
by ayberkcansever Aug 25, 2026 5/10
skill GitHub
Live data artifacts, interactive apps, and advanced financial charts for Claude Code, built as 27 skills plus an SVG chart kit with no dependencies. It exists because in a strict-CSP environment no charting library can load at all. A well-constrained solution to a real enterprise limitation.
skillschartssvgcspartifacts
by Lukehle Aug 25, 2026 6/10
skill GitHub
Encodes real security-testing methodology as tool-agnostic agent skills: white-box bug hunting, AI agent and LLM red-teaming, supply-chain risk assessment, and appsec depth. Works in Claude Code or any agent runtime. The LLM red-teaming coverage is notable — most security skill packs stop at conventional appsec.
skillssecurityred-teamingappsecsupply-chain
by UnboundCompute Aug 25, 2026 7/10
skill GitHub
An AI assistant that helps business analysts — or whoever on the project is filling that role — work to the BABOK v3 methodology. It encodes a recognized professional standard rather than generic requirements advice. A Russian-language version is maintained on a separate branch.
skillbusiness-analysisbabokrequirements
by chaussky Aug 25, 2026 5/10
skill Reddit
Deterministic wrappers around Maven, npm, and Go that collapse successful build/test output to a single line while keeping full logs in .agent-logs/ and returning bounded diagnostics on failure. Measured reductions run from 2KB down to 25 bytes on a Vitest run and 136KB down to 12 bytes on a Tape run. Ships with a lite-tools Agent Skill (SKILL.md) that teaches Claude Code when to prefer the quieter commands.
skillcontext-windowbuild-toolsmavennpmtesting
by fykup Aug 25, 2026 8/10
skill GitHub
Keeps a personal skill library in one repository and installs it into Claude Code, Cursor, and Codex from that single source of truth. Removes the usual drift of maintaining near-identical skill files per tool. Worth a look if you switch between harnesses and keep re-copying the same instructions.
skillscross-toolcursorcodexdotfiles
by EdbertChan Aug 25, 2026 6/10
skill GitHub
A free Claude skill from Benchmark Email that generates HTML email markup targeted at their editor's constraints. Handles the usual cross-client table layout pain so you are not hand-writing email HTML. Vendor-specific, so its value depends on whether you use Benchmark Email.
skillemailhtmlmarketing
by Benchmark-Email Aug 25, 2026 5/10
skill GitHub
A knowledge-capture plugin that gives agents structured context about a data platform: standard schemas, lineage, streams and jobs, medallion layers, semantic layer and glossary. Extends the PKC and OKF frameworks and runs on Claude, Grok, Codex and OpenCode.
data-engineeringknowledge-baselineageplugin
by SpillwaveSolutions Aug 25, 2026 5/10
skill GitHub
An agent skill that batch-converts English word lists into .apkg Anki decks complete with IPA transcription, pronunciation audio and a styled card template. Supports idempotent incremental updates so you can keep adding to a large deck without rebuilding it.
ankivocabularylanguage-learningskill
by userAlex110 Aug 25, 2026 5/10
skill GitHub
A Claude Code skill encoding one opinionated standard for modern web frontends — stack choice, data fetching, state, styling, security, logging, i18n and deploy. Written to be read by an agent rather than a human, so the agent picks consistent patterns instead of improvising per file.
frontendarchitecturestandardsskill
by Amir-Abushanab Aug 25, 2026 6/10
skill GitHub
Audits how AI crawlers, answer engines and agents discover, read, cite and act on a website, then fixes what it finds in the codebase. Combines a live probe of the deployed site with source-level changes, scored across six pillars. Aimed at the shift from ranking for humans to being usable by agents.
seoaeocrawlersaudit
by codydeny Aug 25, 2026 6/10
skill GitHub
An Agent Skills plugin for Codex and Claude Code that scaffolds a new repository to the conventions of a well-maintained public GitHub project — licensing, CI, issue templates, contribution docs and the rest. Removes the tedious setup pass most new repos skip.
scaffoldinggithubpluginconventions
by MinhThang1009 Aug 25, 2026 5/10
skill GitHub
A packaged set of agent skills for integrating Meta's Graph API into a React and Supabase app: OAuth, ad sync, campaign creation, audiences, pixels and CAPI, Instagram publishing and DM automation. Domain-specific, but complete enough to skip a long integration slog.
metagraph-apiinstagramintegration
by bittencourtthulio Aug 25, 2026 5/10
skill GitHub
Four security skills for Claude Code — auth hardening, vulnerability audit, threat modeling and secrets detection — built on a four-layer detection approach. The design point is proof-before-done: the skill has to demonstrate a finding rather than assert it, cutting the overclaiming common in AI security passes.
securityauditthreat-modelingsecrets
by AL-JANEF Aug 25, 2026 6/10
skill GitHub
A field-tested App Store Optimization methodology packaged as a Claude Code skill, with free scripts for autosuggest scraping, App Store Connect analysis and metadata validation. Russian-language core but works in any locale.
asoapp-storemarketingskill
by Muxxik Aug 25, 2026 5/10
skill GitHub
An agent skill that takes an informal idea and works it into a formal model: decomposition, parameter tables, modeling from multiple perspectives, and validation code to check the result. Useful when you want the assumptions made explicit rather than buried in a prompt.
modelingmathematicsanalysisskill
by Furox-Art Aug 25, 2026 6/10
skill GitHub
Agent skills for Claude Code and Codex that pull Polish and EU legal texts from official sources — the Sejm ELI API and CELLAR/EUR-Lex. Handles consolidated texts, single articles, amendments and CELEX identifiers, so citations come from the authoritative text rather than model recall.
legalpolandeu-lawapi
by jamarpl21 Aug 25, 2026 5/10
skill GitHub
Semgrep and Opengrep rules that scan agent skill files (SKILL.md) against the OWASP Agentic Skills Top 10. Lets you run skill review in CI with an existing static-analysis tool instead of reading every third-party skill by hand.
securitysemgrepowaspskills
by computersarebad Aug 25, 2026 7/10
skill GitHub
A Claude skill and CLI that merges multiple font weights into one installable file, repairs Arabic rendering in italic styles, and adds the Saudi Riyal, UAE Dirham and Omani Rial symbols. Narrow, but it solves a real typography problem that is tedious to do by hand.
fontsarabictypographycli
by Mulhamx4 Aug 25, 2026 5/10
skill GitHub
Packages the Google developer documentation style guide as a cross-agent plugin — a skill, a formatter and hooks — for Claude Code, Codex, Cursor and Grok Build. Gives agent-written docs a consistent house style enforced at write time rather than in review.
documentationstyle-guideformatterhooks
by SpillwaveSolutions Aug 25, 2026 6/10
skill GitHub
A Pushary skill plus setup guide and plugin manifest that sends phone notifications from Claude Cowork and lets you approve or redirect work from your phone. Closes the gap where a long-running session stalls waiting for a human who is away from the desk.
coworknotificationshuman-in-the-loopmobile
by Pushary Aug 25, 2026 5/10
skill Reddit
A set of Claude Code skills built on the observation that CLAUDE.md rules get followed about 80% of the time and firmer wording does not fix the rest. Named after Shigeo Shingo's mistake-proofing method, it restructures tasks so the failure cannot occur rather than instructing the agent to avoid it.
poka-yokereliabilityclaude-mdskills
by rainmanjam Aug 25, 2026 7/10
skill GitHub
An opinionated set of rules and skills installed with a single npx command into Cursor, Claude Code, Codex, OpenCode and Copilot. Useful if you switch harnesses and want the same baseline behavior in each rather than maintaining five config trees.
cross-agentrulesskillsnpx
by balacodeio Aug 25, 2026 5/10
skill GitHub
Agent skills that check claimed project status against the actual evidence in Jira, GitHub, Slack and the PRD, surfacing where reported progress and real progress have diverged. A useful pattern given how readily both people and agents report work as done.
project-managementjiragithubverification
by Pulseboard-ai Aug 25, 2026 6/10
skill GitHub
A Spanish-language tuning kit for out-of-the-box Claude Code: a context traffic light, a concise output mode, four hooks that block destructive commands and secret leaks, and cc-doctor.sh, which audits your installation and reports what is missing.
configurationhooksauditspanish
by Carlos-Dominguez-faber Aug 25, 2026 6/10
skill GitHub
A Claude Code skill that OCRs images and PDFs through Tesseract, defaulting to German, English and Simplified Chinese with extensible language packs. Written specifically to give vision capability back to Claude Code when it is running on a DeepSeek backend that lacks it.
ocrtesseractdeepseekpdf
by syLionchen Aug 25, 2026 5/10
skill GitHub
A kit of subagents, skills and commands packaged for Claude Code, OpenCode, Ampcode and Droid. Broad rather than deep, useful as a starting library if you are setting up a new harness from scratch.
subagentsskillscommandscross-agent
by hamr0 Aug 25, 2026 5/10
skill GitHub
A Claude Code plugin that generates visuals matched to the product they belong to and builds them on whatever stack that particular job actually needs, rather than defaulting to one output format for every request.
visualsdesignplugingeneration
by matheusPavaneli Aug 25, 2026 5/10
skill GitHub
Point an AI coding agent at this NCEAS repo and it installs a personalized ruleset for reproducible, analysis-first data science in R and Python, oriented toward environmental, ecological and geospatial work. Institutional rather than hobby-grade, which shows in the reproducibility focus.
data-sciencereproducibilityrpython
by NCEAS-AI Aug 25, 2026 7/10
skill GitHub
A Claude Code skill that generates module, system and guide documentation from actual source code, with the output verifiable against that source and usable offline. Targets the failure mode where generated docs describe an architecture the code does not have.
documentationwikiverificationoffline
by GeziP Aug 25, 2026 6/10
skill GitHub
A broad open collection of agent skills covering browser automation, docs, mail, media, security, networking and orchestration, published for the skills.sh ecosystem. Useful as a browsing ground when you want to see what a category of skill typically does.
skillscollectionopen-sourceskills-sh
by DrOlu Aug 25, 2026 5/10
skill GitHub
Distills a strong model's behaviour into an indexed CLAUDE.md with rules and skills loaded on demand, forming an executable specification. The target is sessions running on weaker or cheaper models that need the guidance made explicit.
claude-mdrulesskillscontext
by curtischoutw Aug 24, 2026 6/10
skill GitHub
A portable skill set covering product and engineering planning work, installable with a single `npx skills add` command. Not tied to one agent tool.
planningproductskillsportable
by amicableapps Aug 24, 2026 5/10
skill GitHub
A Japanese-language Claude Skill set for designing and producing training material end to end: narrated educational videos, distributable PDF handouts, and the overall program structure. Aimed at people building corporate training content with an agent.
videoeducationtrainingjapanese
by daito-dot Aug 24, 2026 5/10
skill GitHub
A free collection of 29 GEO/AI-search Agent Skills plus an installable CLI, covering site audits, citability checks, AI crawler behaviour, prompt packs, and owner maps. Works with Claude Code and Codex, MIT licensed.
seogeoskillsaudit
by TheSmokeDev Aug 24, 2026 6/10
skill GitHub
A content-production pipeline as Claude Skills: generate presentation code, add per-page motion, then render the result to finished video through Remotion. Covers decks, motion design, and video from one workflow.
videoslidesremotioncontent
by TimeCraker Aug 24, 2026 6/10
skill GitHub
An Agent Skill set for running computer science and AI research with playbooks that demand evidence, decisive quality gates between stages, and a traceable project dossier. Ships audit tooling to check the dossier holds up.
researchevidenceauditskills
by honghuy127 Aug 24, 2026 5/10
skill GitHub
A skill pack that turns Claude into a senior design reviewer: DTCG design tokens, 42 components, WCAG 2.2 accessibility checks, framework-agnostic code output, and references for 138 design systems. Skills are runnable, not just prose guidance.
designuxaccessibilitydesign-tokens
by plugin87 Aug 24, 2026 7/10
skill GitHub
A skill that both prevents and strips the telltale patterns of AI-generated prose, working in German as well as English. Useful when agent-written copy needs to read like a person wrote it.
writingeditinggermananti-slop
by jlwin Aug 24, 2026 6/10
skill GitHub
Splits a technical-analysis workflow cleanly: deterministic scripts compute Chan Theory structures (fractals, strokes, segments, pivots, divergences, buy/sell points) while the LLM only interprets the output. Runs as an Agent Skill across Claude Code and MCP-capable clients; explicitly not stock advice.
tradinganalysisdeterministicchinese
by adsorgcn Aug 24, 2026 5/10
skill GitHub
An engineering skill bundling persistent memory, MCP and tool orchestration, dynamic skill discovery, context-aware routing to specialists, automated validation, and security verification steps. Aims to be the single entry point for a multi-stage engineering task.
memoryorchestrationmcpvalidation
by soden46 Aug 24, 2026 5/10
skill GitHub
Go engineering skills where each rule traces back to a cited source, validated with a Codex-first eval suite. Packaging for multiple agents is generated rather than hand-maintained.
golangskillsevals
by ashwingopalsamy Aug 24, 2026 6/10
skill GitHub
A Claude Skill encoding a strategy-consulting HR advisor persona with roughly a decade of practice behind it, focused on talent, organisation design, and AI-driven transformation. Chinese-language.
personahrconsultingchinese
by TongyiDai Aug 24, 2026 5/10
skill GitHub
A personal investment research system combining a Claude Code skill with a data pipeline, where sourcing rules and a ban on trade signals are enforced by code rather than prompt text. Pulls from SEC EDGAR, FRED, ECB, and Toss Securities. Korean-language.
financeresearchkoreanpipeline
by MinSeok1o28 Aug 24, 2026 5/10
skill GitHub
Skills that let an AI assistant fetch data from 21 major platforms including Douyin, TikTok, Bilibili, and Xiaohongshu through one consistent interface. Documentation is multilingual across Chinese, English, Japanese, and Korean.
socialdataapimultilingual
by XieWxx Aug 24, 2026 6/10
skill GitHub
Agent skills that route a presentation through eight sequential quality gates, from raw source material to a deck ready to present. Extracted from the open-slide project as a standalone skill set.
presentationspipelineskills
by samulee003 Aug 24, 2026 6/10
skill GitHub
A skill that gives agents a consistent method for debugging in the browser, rather than each session improvising its own approach to console logs, network inspection, and reproduction steps.
browserdebuggingskills
by asterd Aug 24, 2026 6/10
skill Reddit
Packages routine Polish company due diligence as a skill: look up a company by NIP, KRS, or REGON, check VAT status and registered bank accounts against the Ministry of Finance White List, and validate EU VAT numbers via VIES. Runs on a free public REST API with no key or signup.
compliancepolandvatapi
by bambi696 Aug 24, 2026 6/10
skill GitHub
Analysing a subject region by region instead of as a whole raised measured coverage from 0.46 to 0.69 across code, plans, and physical designs. The repo publishes the full evidence behind the number, including the cases where the approach did not help.
analysisevalscoverageevidence
by stilletto Aug 24, 2026 7/10
skill GitHub
Generates PowerPoint decks in the visual and structural conventions of management consulting output. Written to work across multiple AI agents rather than being tied to one tool.
presentationspowerpointconsulting
by BotTony329 Aug 24, 2026 6/10
skill GitHub
Writes, audits, and repairs Seedance 2.5 prompts across text-to-video, reference-video, editing, extension, and multimodal modes for Dreamina. Packaged as an Agent Skill so the optimization runs inside your normal session.
videopromptsseedanceskills
by silentbuilds Aug 24, 2026 5/10
skill GitHub
Compares what a company claims publicly against what its product actually does and surfaces the gaps. Packaged as an Agent Skill for competitive and due-diligence research.
researchanalysisskillsproduct
by jovelove7 Aug 24, 2026 5/10
skill GitHub
An anti-slop writing skill built around the constraint that improving prose must not alter the underlying claims. Targets the common failure where an editing pass smooths text and silently rewrites meaning.
writingeditinganti-slop
by benjaminstelzer Aug 24, 2026 5/10
skill GitHub
Claude Code skills covering pharmaceutical brand management with separate Rx and CHC/OTC personas for the Russian and Ukrainian markets. Includes task checklists, document templates, and notes on local advertising-law compliance.
pharmamarketingcomplianceskills
by mznaevskaya-dotcom Aug 24, 2026 5/10
skill GitHub
Audits prose against a reference corpus and grounds revisions in what that corpus actually does, rather than in generic style rules. Portable across agent tools.
writingauditcorpusskills
by metalaureate Aug 24, 2026 5/10
skill GitHub
Builds demos, launch videos, tutorials, and release notes from an HTML deck, AI voiceover, and real screen recordings, rendering the result to MP4 with ffmpeg. The video is defined as code, so it can be regenerated when the product changes.
videoffmpegdemosskills
by kritikmodi Aug 24, 2026 6/10
skill GitHub
A set of narrowly scoped Agent Skills covering Flutter and Dart app delivery end to end, rather than one large catch-all instruction file. Aimed at keeping each skill small enough to load only when relevant.
flutterdartmobileskills
by thiennc-tesoglobal Aug 24, 2026 6/10
skill GitHub
Thirteen skills for secondary-market investment research, with adapters for Claude Code, Codex, and OpenCode plus scaffolding for an analyst workspace. Published as an open prompt stack rather than a product.
financeresearchskillscross-tool
by joansongjr Aug 24, 2026 5/10
skill GitHub
An Agent Skill that routes personal-assistant memory across multiple providers while keeping private data local. It decides which store handles each fact instead of pushing everything to one vendor. Works with both Claude Code and Codex.
memoryskillprivacycodex
by Euraika-Labs Aug 24, 2026 6/10
skill GitHub
Packages cross-LLM sub-agent orchestration as an Agent Skill, so any compatible tool can hand a task off to another model's CLI. Supported targets include Codex, Claude Code, Grok, GLM, Kimi, Cursor, Gemini, and OpenCode. Useful when you want a second model's take without leaving your current session.
sub-agentsorchestrationskillmulti-model
by shinpr Aug 24, 2026 7/10
skill GitHub
A Claude Code and Codex skill that reads chat transcripts and support tickets and turns them into a ranked list of product pain points. It also proposes PRD updates and flags gaps in end-to-end test coverage. Aimed at product work rather than pure coding.
skillproductresearchtesting
by tombelieber Aug 24, 2026 6/10
skill GitHub
A CLI plus agent skill that converts a shared ChatGPT conversation link into a local, agent-readable archive. Useful for pulling prior ChatGPT work into a Claude Code session as context instead of copy-pasting it.
skillclichatgptarchive
by tombelieber Aug 24, 2026 6/10
skill GitHub
A free Claude Code skill for business intelligence work, packaged with a doctrine requiring every figure to reconcile against the source file's own totals. The aim is to stop agents from producing plausible-looking numbers that do not add up. From kymira.ai.
skillbusiness-intelligencedataverification
by dylnbaker15 Aug 24, 2026 6/10
skill GitHub
A Claude Skill that takes raw data to a working interactive visualization through a five-stage workflow with five layers of verification. The guardrails exist to keep vibe-coded charts from silently misrepresenting the data.
skilldatavizverificationworkflow
by hsuan1012 Aug 24, 2026 7/10
skill GitHub
A plugin for Claude and Codex that rewrites generated prose so it reads less like an AI wrote it. One more entry in an already crowded field of humanizer skills.
skillwritinghumanizerplugin
by matonhp5108 Aug 24, 2026 5/10
skill GitHub
A catalog of reusable skills for Claude Code and Codex, plus a `yk` CLI that installs them into a repo. It also runs bundled workflow tools including PBench, transcript processing, and A-share market data.
skillscatalogcliinstaller
by Yaphet2015 Aug 24, 2026 6/10
skill GitHub
Verifies the claims in design documents and refactoring plans using seven structural and seven adversarial logic-primitive probes. Rather than reviewing code, it checks whether the plan's reasoning holds up. Runs on Claude Code, Codex, Cursor, Kimi, OpenCode, ZCode, and DeepSeek Harness.
verificationplanningreviewmulti-model
by AmethystLuna Aug 24, 2026 7/10
skill GitHub
Turns an expert's working method into a Skill that any agent or bot can load. Previously published as Colleague Skill.
skillsdistillationknowledgeauthoring
by titanwings Aug 24, 2026 6/10
skill GitHub
A Claude Code skill that audits a site for how well AI answer engines can crawl, extract, and cite it, then applies the fixes. Built Shopify-first but works on any stack. Targets ChatGPT, Perplexity, and Google AI Overviews.
seoaeoauditshopify
by snapdevio Aug 24, 2026 7/10
skill GitHub
Two public Claude Code skills with standalone CLI versions: `tts` turns a document into spoken-word audio, and `explain-yourself` walks through code the way you would actually want it explained.
skillsttsexplanationutilities
by ArunskiOrg Aug 24, 2026 6/10
skill GitHub
Claude Code and Codex skills for legal academic writing, with verified citation placement across Bluebook, OSCOLA, and McGill styles. Includes law-review docx pipelines and document delivery tooling.
legalcitationswritingdocx
by kennethkhoocy Aug 24, 2026 6/10
skill GitHub
Packages the Community Scripts / Proxmox VE Helper Scripts contribution guidelines into an agent skill. Loading it means your assistant already knows the project's formatting, structure, and review conventions before it writes a script. A clean example of turning a project's CONTRIBUTING doc into something an agent actually follows.
skillproxmoxcontributinghomelab
by aroldobossoni Aug 23, 2026 5/10
skill Reddit
A reminder that `.claude/settings.json` has a `cleanupPeriodDays` key defaulting to 30 days, after which past conversations are purged. If you work on long-running projects and expect to resume a thread months later, raise the value or export the transcript. The poster learned this by returning to half-finished research that was already gone.
settingsconfigurationsessionsretention
by cleverhoods Aug 23, 2026 6/10
skill GitHub
A skill collection covering agentic test automation end to end: test case authoring, context and intent capture, self-healing selectors, failure classification, guardrails, and progressive context disclosure. Each concern is a separate skill so you can load only what a given task needs. Aimed at teams pointing agents at flaky end-to-end suites.
skilltestingqaautomationself-healing
by vivekkrishna Aug 23, 2026 7/10
skill GitHub
A library of reusable procedures that make an assistant handle recurring work the same way every time. Installation is conversational: paste a single prompt, it recommends a handful of relevant skills, and installs only the ones you approve. Works with both Claude and Hermes.
skilllibraryproceduresinstaller
by TechNickAI Aug 23, 2026 7/10
skill GitHub
A skill and CLI for Claude Code and Codex that converts images, PDFs, image-based PPTX files, and mixed decks into genuinely editable PowerPoint presentations. Aimed at the common case where you receive a deck as flattened pictures and need to change the text. Available both as an agent skill and a standalone command.
skillpptxpdfdocumentscli
by DSY-Xueai Aug 23, 2026 7/10
skill Reddit
Argues the generic purple-gradient SaaS look comes from the model defaulting to the statistical average of landing pages, not from a model weakness. The fix is a strict set of design rules written as SKILL.md or .cursorrules that force actual design decisions. Practical for anyone shipping AI-built frontends.
designskillfrontendprompting
by AudienceNo2554 Aug 23, 2026 6/10
skill GitHub
Give it a topic and the skill produces learning materials for it. Small, single-purpose skill for using the agent as a tutor rather than a coder.
skilllearningeducation
by adamaiken89 Aug 23, 2026 5/10
skill GitHub
A Claude Skill that converts a deck into a single self-contained HTML presentation with native animated SVG charts, sequenced entrances, and live-embedded demos. Exports back to PDF when you need the static form. Practical for anyone who presents from the browser.
skillpresentationhtmlsvg
by hunkim Aug 23, 2026 7/10
skill GitHub
A Claude Code skill that builds a phone-reachable panel for waking, monitoring, and powering machines over Tailscale using Wake-on-LAN. The skill generates the panel rather than shipping a fixed app. Handy for anyone running a home lab behind a sleeping workstation.
skillwake-on-lantailscaleremote
by REMvisual Aug 23, 2026 6/10
skill Reddit
Open-sourced skill built with legal input that pushes Claude toward production-ready output — PII handling, GDPR, env key protection, and geographic regulation. The author's complaint is that vibe-coded apps ship failing these checks by default. Pairs a skill with a hosted service.
skillcompliancegdprsecurity
by Uditakhourii Aug 23, 2026 6/10
skill GitHub
Skills drawn from production Salesforce work, including User-object mixed DML and Files querying, plus three platform-agnostic working methods. The Salesforce specifics are narrow but the working methods generalize. MIT licensed.
skillsalesforceapexmit
by rob-alexa Aug 23, 2026 6/10
skill GitHub
A rules file covering distinctive UI, WCAG 2.2 accessibility, SEO, Core Web Vitals, form handling, and human-sounding copy. Works with Cursor, Claude Code, and Codex through AGENTS.md and Cursor rules. Concrete constraints rather than general style advice.
frontendaccessibilityseoagents-md
by romanveselovski Aug 23, 2026 7/10
skill GitHub
Takes a game idea or port target through to a playable .32x ROM, covering build, optimization, and testing. The notable part is that it knows how to prove the ROM actually runs instead of stopping at a successful compile. A good example of a skill that encodes verification, not just generation.
skillretrogamedevverification
by haroldo-ok Aug 23, 2026 7/10
skill GitHub
An agent skill for Claude Code and Codex that frames raw screenshots in iPhone, iPad, Galaxy, Fold, and Flip devices, generates app-matched backgrounds and marketing copy, and exports at exact App Store and Google Play sizes. Removes a tedious pre-launch chore. Korean and English.
skillscreenshotsapp-storemarketing
by LeeHueeng Aug 23, 2026 6/10
skill GitHub
A set of best practices for writing AGENTS.md files that comply with the open specification and work across tools. Focuses on prompt structure that survives being read by different agents. Reference material rather than an installable package.
agents-mdpromptingspecreference
by JularDepick Aug 23, 2026 6/10
skill GitHub
Two writing skills — anti-slop editing that strips AI tells, and technical content writing. Ships as a Claude Code and Codex plugin installable through skills.sh. Useful for anyone whose agent output goes in front of readers.
skillwritingeditingplugin
by Kaos599 Aug 23, 2026 6/10
skill GitHub
A skill collection implementing the git-loopy workflow, covering the loop from idea through implementation to shipping. Modeled on the mattpocock/skills layout, so the skills are meant to be dropped in and composed rather than used as a monolithic framework. Useful if you want an opinionated, ready-made engineering loop instead of assembling your own.
skillworkflowgitengineering-process
by bradcstevens Aug 23, 2026 6/10
skill Reddit
An agent skill that lets you hand a coding agent a YouTube link or screen recording instead of describing a UI interaction in words. It analyzes the video itself — not a transcript — so animations, transitions, layout, and interaction timing become usable context while the agent works on your codebase. Installs via npm and works with Claude Code, Cursor, Codex, and Antigravity CLI.
skillvideouimultimodalfrontend
by PumpkinNarrow6339 Aug 23, 2026 7/10
skill GitHub
A Claude Code skill that wraps Gemini, OpenAI and Kie AI image/video generation behind a single CLI and MCP server. One interface means you can swap providers without rewriting prompts or plumbing. It also stamps generated media with EU AI Act content markings, which matters if you ship AI media in the EU.
skillmcpimage-generationvideo-generationeu-ai-act
by Cripacx Aug 23, 2026 7/10
skill GitHub
A skill collection covering the Korean patent attorney workflow end to end — from the inventor interview through drafting a Korean-format patent specification to exporting docx. Encodes domain conventions that a general model does not reliably produce on its own. Narrow but deep if you work in KR patent practice.
skillpatentkoreanlegaldocx
by lsj4232 Aug 23, 2026 5/10
skill GitHub
A set of Agent Skills that encode product-management practice for Claude Code: customer discovery, metrics definition, PRD writing, and visual design, plus higher-level CPO and "Frontier CTO" personas. Instead of re-prompting the same product framing each time, you install the skill and invoke it. Aimed at PMs and founders using Claude Code beyond pure coding.
skillsproduct-managementprddiscoveryagent-skills
by pedroromeroluna Aug 23, 2026 6/10
skill GitHub
A Claude Code skill that takes any prompt and runs it through an iterative review loop between Claude and GPT, with each model critiquing the other's revisions. It returns an optimized version of the prompt rather than a list of suggestions. Useful if you write agent or system prompts and want a second model's perspective baked into the workflow.
prompt-engineeringskillgptcross-model
by yorilavi Aug 23, 2026 6/10
skill GitHub
A Claude Code skill that converts a trip description into an itinerary map using real OSRM routes over an OpenStreetMap basemap. It outputs both an interactive page and a PNG for sharing. Triggers on phrases like "itinerary map", "travel recap", or the Chinese 行程图.
skillmapsosmtravelvisualization
by ShawNova Aug 23, 2026 5/10
skill GitHub
Addresses the problem that only a fraction of your installed skills are visible in the model's context at any time — the author reports 78 of theirs are invisible. It acts as a router that matches an incoming task to the right skill even when that skill was never surfaced. Worth a look if your skills directory has outgrown what Claude Code auto-loads.
skillroutingcontext-managementdiscovery
by advegaf Aug 23, 2026 7/10
skill GitHub
A Claude Code skill backed by a Python core that audits any codebase with no configuration required. It hunts leaked API keys, IDOR, billing bypass, prompt injection, and vulnerable or malicious dependencies, then produces a VAPT-grade report. Output is available as SARIF or JSON so it can feed CI security dashboards.
securityskillsarifauditstatic-analysis
by adhuniklabs Aug 23, 2026 8/10
skill GitHub
Two skill packs for AI coding agents covering contract review and legal research. They are agent-agnostic rather than Claude Code specific, so they work anywhere the skill format is supported. Relevant if you are building domain skills outside of software engineering and want a reference structure.
skilllegaldomain-skillscontract-review
by code-lawyer Aug 23, 2026 6/10
skill GitHub
A set of agent skills aimed at the tell-tale sameness of AI-produced product work. One half targets building UI with deliberate design decisions instead of default component-library output; the other unslops the marketing and docs prose written about it. Useful if your generated frontends all look like the same template.
uidesignskillwritingfrontend
by XavierAgostino Aug 23, 2026 7/10
skill GitHub
A skill for scaffolding production-grade LLM agents using patterns distilled from studying real agent codebases rather than from tutorials. It encodes the structural decisions — tool design, control flow, error handling — that working agents converge on. Aimed at people writing new agents who want a defensible starting architecture.
skillagent-designpatternsllm
by alfredzhang98 Aug 23, 2026 7/10
skill GitHub
A Claude Code skill that builds an onboarding tour for a web app using driver.js — spotlights, tooltips, and a pointing hand. It wires up exactly-once state so returning users are not shown the tour again. Handles the persistence detail that most hand-rolled tours get wrong.
skillonboardingfrontenddriver-jsux
by nt11111 Aug 23, 2026 6/10
skill GitHub
A daily-digest skill that takes a list of saved articles and produces a full podcast episode narrated with Qwen3-TTS, published through the save-to-spotify CLI. The output is a finished episode, not a script to record yourself. A concrete example of chaining a skill on top of an existing CLI tool.
skillttspodcastspotifyautomation
by schmug Aug 23, 2026 6/10
skill GitHub
An AppSec prompt and skill module that walks a coding agent through hardening a vibe-coded prototype into production-grade software. Covers the usual gaps such prototypes ship with: auth, secrets, input validation, and dependency risk. Targets Antigravity, Cursor, and Copilot, but the prompt structure ports to Claude Code.
securityappsecskillhardening
by softwareasg-tools Aug 22, 2026 6/10
skill GitHub
A set of Claude Code skills covering SEO operations across a portfolio of sites: technical audits, topical maps, link acquisition, local pack strategy, GA4 telemetry, and rapid indexing. Each area is its own skill so you invoke only the part you need. Useful if you run SEO work as a repeatable agent workflow rather than ad hoc prompts.
seoskillsauditga4
by abouchard11 Aug 22, 2026 6/10
skill Reddit
A small skill that keeps a local web page updated while Claude Code works — current activity, a screenshot where useful, and a running log. The author built it to avoid watching terminal output scroll by while juggling several sessions. MIT licensed and deliberately minimal.
monitoringskillsessionsdashboard
by Disastrous_Exam9484 Aug 22, 2026 6/10
skill GitHub
An agent skill that reconstructs a photo or theme into a flat ink-wash poster illustration — off-white textured paper feel, large areas of negative space. Documentation is primarily in Chinese. A narrow creative skill, useful mainly as an example of encoding a consistent visual style into an agent skill.
skilldesignillustrationposter
by shanhai256 Aug 22, 2026 5/10
skill GitHub
A portable operations skill for CC Switch that runs under both Claude Code and Codex, covering safe management of prompts, skills, MCP servers, and provider configs. It encodes the routine maintenance steps so an agent can edit your setup without corrupting it. Documentation is bilingual (English and Chinese).
skillcc-switchmcpconfigurationcodex
by RuriLothlorien Aug 22, 2026 6/10
skill GitHub
A reasoning skill that puts an agent into monotropic, depth-first analysis of a single system rather than broad divergent ideation. It is pitched as the complement to brainstorming-style prompts, for when you need one thread followed all the way down. Niche, but a clear framing of a real trade-off in agent prompting.
skillreasoningpromptingsystems-analysis
by khhvmc5g6f-eng Aug 22, 2026 5/10
skill GitHub
A design taste library of 57 references, 12 constants, and 8 style families, paired with a weighted interview that locks in a direction before the agent writes any UI code. It gives the agent something concrete to aim at instead of defaulting to generic styling. Useful when every agent-generated frontend comes out looking the same.
skilldesignuifrontendtaste
by Stianlars1 Aug 22, 2026 7/10
skill GitHub
An agent-harness skill (SKILL.md) that runs automated risk review over German employment contracts, producing bilingual DE/EN, evidence-first findings tied back to contract clauses. MIT licensed and explicitly not legal advice. A concrete example of packaging domain expertise as a reusable Claude Code skill.
skilldocument-reviewlegalbilingualgerman
by donrami Aug 22, 2026 5/10
skill GitHub
A Claude skill that rewrites AI-generated Turkish into natural, human-sounding Turkish by removing the telltale patterns of machine writing. Aimed at Turkish speakers who draft with Claude and want output that does not read as generated.
skillturkishwritinghumanizer
by bushrabeg Aug 22, 2026 5/10
skill GitHub
A set of seven portable agent skills covering product copy, prompts, prose, and code clarity. Each is written to drop into any SKILL.md-compatible agent, so the same editing standards apply across Claude Code, Codex, and the rest.
skillswritingpromptsportable
by itsMay21 Aug 22, 2026 6/10
skill GitHub
A skill that interrogates a fuzzy feature idea until it becomes a concrete, agreed requirement, running before any design or implementation begins. It targets the most expensive agent failure mode: building the wrong thing very quickly.
requirementsplanningskill
by bydtesla1609 Aug 22, 2026 6/10
skill GitHub
A library of 221 agent skills for construction work — BIM model analysis, cost estimation, scheduling, and document control — packaged for Claude Code. One of the larger domain-specific skill collections outside software engineering.
skillsconstructionbimdomain
by datadrivenconstruction Aug 22, 2026 7/10
skill GitHub
A skill that caps how much code an agent may add or change in a single pass, working across both Codex and Claude Code. A simple lever against the sprawling diff nobody can actually review.
skillguardrailsdiffreview
by stef-k Aug 22, 2026 6/10
skill GitHub
A Chinese-language skill system for security response center bug hunting, pairing a system-level prompt with fourteen specialised security testing knowledge bases. Built for Claude Code and Codex.
securityskillsvulnerability-researchchinese
by zhaji2333 Aug 22, 2026 6/10
skill GitHub
Agent skills covering AI-assisted video production and evaluation, written in the domain's own vocabulary rather than generic prompting. Works with Claude Code and Codex.
skillsvideoproductiondomain
by sb-dev Aug 22, 2026 6/10
skill GitHub
An agent skill that audits ZMK and QMK keymaps, tunes home row mods, makes trackballs layer-aware, generates keymap diagrams in CI, and adds alternative layouts like Graphite and Colemak-DH. It covers the failure modes the firmware docs leave out.
skillkeyboardfirmwarezmkqmk
by johncattrall Aug 22, 2026 7/10
skill GitHub
A complete Claude Code configuration for .NET and fullstack projects: deterministic hooks, a spec-driven pipeline, subagents, skills, and formal verification using Allium and TLA+. Unusually far toward the formal end for an agent setup.
dotnetconfigformal-verificationhooks
by johanolofsson72 Aug 22, 2026 7/10
skill GitHub
A skill that trims coding token usage by as much as 94% while holding output quality, and ships the reproducible benchmark it used to measure that. The included measurement is what separates it from the usual claim.
tokensskillefficiencybenchmark
by Sarveshmehta1504 Aug 22, 2026 7/10
skill GitHub
A portable agent skill that assembles scrapbook-style photo collages with a tactile, physical look, keeping faithful control over each source image. Works with any agent supporting the Agent Skills format.
skilldesignimagescollage
by ShaineDemo Aug 22, 2026 5/10
skill Reddit
Four skills built around one rule: if the real output is not achievable, stop and ask instead of emitting a placeholder. They cover backend provisioning with real credentials, a security scanner that fixes rather than reports, a frontend builder, and a relevance router, with CI validating each on push.
skillsmitno-placeholdersci
by MonitorFlat4465 Aug 22, 2026 7/10
skill GitHub
A skill set laying out one engineering loop — question the ask, research, structure, plan, implement, then hand off — as discrete steps an agent moves through. Aimed at real project work rather than demos.
skillsworkflowplanninghandoff
by racastellanosm Aug 22, 2026 5/10
skill GitHub
Curated agent skills for social science research where validity, transparency, and auditability matter more than speed. Each skill is written so the resulting analysis can be checked by someone else.
skillsresearchsocial-sciencereproducibility
by yifeifrank Aug 22, 2026 6/10
skill GitHub
A Cursor and Claude skill that takes a job description and produces a one-page resume tailored to it, in HTML, PDF, or plain text. Chinese-first and MIT licensed.
skillresumecareerchinese
by BAK262 Aug 22, 2026 5/10
skill Reddit
A landlord running twenty custom skills across two laptops and a phone found that reference facts — which unit a tenant is in — had accumulated inside individual skills, so Claude only knew them when that skill fired, and put a tenant in the wrong unit. The thread covers where shared facts should live given CLAUDE.md is per-machine and per-folder.
claude-mdmemoryskillsdiscussion
by Little_Thought_8911 Aug 22, 2026 6/10
skill Reddit
A long-time Superpowers user asks whether its brainstorming, TDD, and subagent skills still earn their token cost now that Claude Code has absorbed many of the same capabilities. Relevant to anyone carrying a large legacy skill set.
skillssuperpowerstokensdiscussion
by YUL438 Aug 22, 2026 5/10
skill GitHub
A library of 131 developer skills pairing deterministic PowerShell collectors with LLM judges, producing read-only audits where every claim carries file and line proof. The collector-plus-judge split keeps the evidence out of the model's imagination.
skillsauditpowershellevidence
by skillshop-ostyles Aug 22, 2026 7/10
skill Reddit
Two Claude Code skills modeled on Stefan Zweig's method — one front-loads density into the first draft, the other runs a refinement loop making real cuts, then hands the result to a fresh-reader subagent allowed only to ask what is confusing and what is missing. The writeup shows before-and-after passes and the skills are on GitHub.
writingskillssubagentsediting
by WhatHasKHANGotToSay Aug 22, 2026 7/10
skill GitHub
A registry that installs a pinned set of skills for OpenAI Codex and Claude Code with a single reproducible command. Aimed at teams that need every machine running the same skill versions.
skillsregistryreproducibleinstall
by wzy8996 Aug 22, 2026 6/10
skill GitHub
Agent skills that repair the sentence-level expression and document design of Korean text Claude produces, for when the output is technically correct but reads wrong to a native speaker. Aimed at reports and formal documents.
skillskoreanwritingdocuments
by JangHyun-bin Aug 22, 2026 6/10
skill GitHub
Skills for building production mobile apps, each verified in a simulator and benchmarked against how top-grossing apps handle the same problem. The verification step is what distinguishes it from a prompt collection.
skillsmobileiosverification
by pianoteachervandegraaffgenerator47 Aug 22, 2026 6/10
skill GitHub
An extensible Spanish-language skill for handling SAT tax declarations and invoicing for individuals in Mexico. An example of agent skills reaching into country-specific compliance work.
skilltaxmexicocompliance
by angelroma Aug 22, 2026 6/10
skill GitHub
A pipeline of Claude Code skills that ingests academic PDFs and emits a didactic Obsidian wiki instead of a flat dump of extracted text. Each stage is a separate skill, so the chain also runs under Open Code and other agentic assistants. Aimed at people building study vaults from dense source material.
skillobsidianpdfpipelineresearch
by superoptimo Aug 22, 2026 7/10
skill GitHub
An Agent Skill that gives Claude Code, Claude Desktop, and Cursor access to actual video editing — auto-edit, clipping, subtitles, avatars, and publishing — by driving the free Shorz desktop app's MCP server and its 160+ tools. The skill layer supplies the editing know-how; the MCP server does the rendering work locally.
skillmcpvideosubtitlesshorz
by Vossy Aug 22, 2026 7/10
skill GitHub
A personal but curated set of Claude Code skills that installs by cloning straight into ~/.claude/skills. Flat namespace, no build or package step, so it doubles as a readable reference for how to structure your own skills directory.
skillcollectiondotfiles
by benjaminematton Aug 22, 2026 5/10
skill GitHub
A bundle of Claude Code skills paired with guard hooks and plugin profiles for the free Programmer-Wander MCP dev shell. The guard hooks are the interesting part — they gate what the agent is allowed to do inside the shell rather than trusting prompt instructions alone.
skillhooksmcpguardrails
by AIWander Aug 22, 2026 5/10
skill GitHub
An open-source skill that lets Claude Code or Codex work with .hwp and .hwpx files directly, no Hancom Office install required. Covers reading, generating, and editing, which matters for Korean government and academic document workflows where HWP is mandatory.
skillkoreanhwpdocumentscodex
by DoHyun468 Aug 22, 2026 6/10
skill GitHub
An experimental repo that treats Agent Skills as reusable packages — with discovery, a validation step, and a sharing convention. The validation angle is the differentiator versus the many plain skill-collection repos.
skillregistryvalidationsharing
by laojin1900 Aug 22, 2026 6/10
skill GitHub
A Spanish-language skill for Claude Code and Codex that audits a live web system strictly read-only: it documents every screen as it exists (AS-IS) and then designs the API that would replace it (TO-BE). No writes are ever executed, so it is safe to point at production.
skillauditapi-designlegacyspanish
by Espiritu16 Aug 22, 2026 6/10
skill GitHub
A Chinese-language coaching skill that takes a single problem and explains the formula behind it from first principles, emitting browser-readable HTML. Each equals sign gets its own line with a written justification for why that step holds.
skilleducationmathhtmlchinese
by jinshanbaihai Aug 22, 2026 5/10
skill GitHub
A two-stage writing skill: first it removes the usual AI giveaways (em dashes, 'delve', rule-of-three cadence), then it reshapes the result for a specific channel — LinkedIn, X, cold email, Slack, exec memo, blog, or landing page. The channel-fitting pass is what separates it from the many generic humanizer skills.
skillwritinghumanizermarketing
by msdanyg Aug 22, 2026 5/10
skill GitHub
A markdown skill that rewrites a vague ask into a prompt precise enough for a coding agent to execute correctly on the first attempt. Works with Claude Code, Cursor, or any agent that reads markdown, so it is not tied to one harness.
skillpromptingcursorrequirements
by sazzadurrahmaan Aug 22, 2026 6/10
skill GitHub
A free collection of Claude Code skills covering SEO, content strategy, keyword research, landing pages, and social captions. Notably it ships anti-slop quality gates rather than just generation prompts, so output gets checked before it ships. Relevant to anyone using Claude Code outside pure engineering work.
skillsmarketingseocontentquality-gates
by rdoser13 Aug 21, 2026 6/10
skill GitHub
A Portuguese-language legal agent for Claude Code covering Brazilian digital law, LGPD data protection, and consumer law. It works from a local library of official sources rather than model recall, and escalates to a human lawyer when a question exceeds what it should answer. A concrete example of a regulated-domain agent with a built-in handoff path.
legallgpdbrazilcompliancedomain-agent
by manfredjr Aug 21, 2026 5/10
skill GitHub
A skill pack covering keyword intake, monitoring how AI answer engines cite you, an evidence-driven writing driver, and citation-sourced backlink outreach. The four skills share one data layer behind a single Monid API key. Worth a look for the GEO angle — tracking AI answer-engine visibility rather than only classic search rank.
skillsseogeoanswer-enginescontent
by Jasper0122 Aug 21, 2026 6/10
skill GitHub
A skill for standing up greenfield code quickly by fanning work out to parallel agents. Its distinguishing idea is blind spec tests — tests written against the specification by an agent that has not seen the implementation, so they cannot be shaped to fit the code. A useful pattern for keeping fast parallel generation honest.
skillparallel-agentsgreenfieldtestingspec
by jgoetzmann Aug 21, 2026 7/10
skill Reddit
A continuously updated repository that keeps a copy of the Claude Code system prompt alongside the bundled subagent definitions, built-in skills, and a wider collection of Claude Code prompts. It is a reference for understanding what the harness already tells the model before your CLAUDE.md is read. Handy when writing agents or skills that need to avoid duplicating built-in behavior.
system-promptreferenceagentsskillsprompts
by frubberism Aug 21, 2026 7/10
skill GitHub
A cross-harness marketplace of agent plugins and skills that targets Antigravity (AGY), Claude Code, and Cursor from one catalog. The pitch is write the skill once and install it into whichever agent you happen to be using. Worth a look if you split work across more than one coding agent.
marketplacepluginsskillscursorcross-harness
by orin-dx Aug 21, 2026 6/10
skill GitHub
A Claude Code skill that scans a website for missing images and video, then generates them with Gemini models (Nano Banana Pro for stills, Veo 3.1 for motion). Prompts are anchored to the actual copy of each page block, so the generated media matches the section it sits in. Documentation is in Portuguese.
skillgeminiimage-generationvideoweb-design
by christian-jorge Aug 21, 2026 6/10
skill GitHub
A Claude Code plugin that turns the Claude Academy curriculum into hands-on lessons inside your editor. It walks through Anthropic product material and then reviews your actual sessions against Academy best practices. Aimed at people who want structured onboarding rather than trial-and-error learning.
pluginlearningbest-practicesonboarding
by MrMarudi Aug 21, 2026 6/10
skill GitHub
An Agent Skill that attacks your AI system the way an adversary would, probing for prompt injection and tool poisoning across your prompts and MCP tool surface. Output is a prioritized findings report with concrete fixes rather than a raw vulnerability dump. Relevant to anyone shipping agents that read untrusted content.
securityprompt-injectionred-teamauditmcp
by Itachi3355 Aug 21, 2026 7/10
skill GitHub
An Agent Skill that audits AI-generated content for reliability, producing a structured Trust Report that classifies each claim and flags the ones at risk of being hallucinated. Intended as a review pass over drafts, research summaries, or generated documentation before you rely on them.
verificationhallucinationreviewquality
by Itachi3355 Aug 21, 2026 6/10
skill Reddit
A custom Claude Code output style aimed at Opus 5's tendency toward dense, metaphor-laden explanations, replacing lines like 'the retry path short-circuits on the tombstone marker' with 'deleted records are now skipped during retry.' Drop the gist file into ~/.claude/output-styles/plain-english.md and select it via /config, then start a fresh session. The author is actively soliciting refinements.
output-styleopus-5verbosityconfiggist
by gthing Aug 21, 2026 7/10
skill GitHub
A complete DSH port of DietrichGebert/ponytail that adapts its 'lazy senior engineer' operating mode into six Chinese-language Claude Code skills. The port deliberately ships no empty tool stubs. Useful mainly to Chinese-speaking teams who want the ponytail workflow without translating it themselves.
chineseskillsponytailportlocalization
by Wenaixi Aug 21, 2026 5/10
skill GitHub
A standard Agent Skill that guides Chinese MBA and EMBA thesis work through a topic-selection gate, the conventional five-chapter structure, a theory menu spanning eight research directions, and methodology norms. It is explicitly guidance rather than ghostwriting. The author recommends installing it at project level.
chineseacademicagent-skillwritingthesis
by stephenlzc Aug 21, 2026 5/10
skill GitHub
curb.sale exposes local physical-goods listings to agents through a single unauthenticated HTTP call — no account, no API key, no signup. An optional Claude Code plugin wraps it, but the API works without installing anything. An unusual example of designing a real-world marketplace API for agent consumption rather than human forms.
marketplacehttp-apipluginagentsno-auth
by curb-sale Aug 21, 2026 5/10
skill Reddit
A Claude Code skill that implements glassy "Liquid Glass" styling in web apps. It packages the CSS, the SVG displacement filter setup, and the handful of rules that decide whether the effect actually reads as glass rather than a blurred rectangle. Useful if you keep re-explaining the same visual treatment to the model every session.
skillcssuidesignsvg
by rfusername Aug 21, 2026 7/10
skill GitHub
A skill toolkit for bridge software engineers working between Japanese and Vietnamese teams. Covers translation, specification and code analysis, Excel validation, output verification, report generation, and project-aware memory. Niche, but a solid example of encoding a whole job role into agent skills.
skilltranslationjapanesevietnamesespecs
by jame-hv Aug 21, 2026 5/10
skill GitHub
Implements the ISO 24495 plain language standard as a set of agent skills plus a Claude Code plugin. Gives you a citable standard to point at when asking the model to simplify documentation or user-facing copy, instead of vague "make it clearer" instructions.
skillpluginwritingplain-languageiso
by GaZmagik Aug 21, 2026 6/10
skill GitHub
A squad of ethical offensive-security subagents for Claude Code that audits, hardens, and verifies projects you are authorized to test. The knowledge corpus holds 122 procedures across 7 role packs, each with per-stack detection patterns, false-positive criteria, and traceability back to the relevant standard.
securitysubagentsauditpentestskills
by CristianAjavi Aug 21, 2026 7/10
skill GitHub
A curated collection of AI agent skills covering market analysis, product strategy, go-to-market, pricing, growth, and executive strategy. Useful if you want the model to work through a structured strategy framework instead of improvising business advice.
skillsstrategyproductgtmcollection
by petrichorprojects Aug 21, 2026 5/10
skill GitHub
A skill pack addressing the environment problems Chinese developers hit constantly: npm registry mirrors, API routing, WeChat mini-program development, and deployment to domestic cloud providers. Fixes the assumptions most agent tooling makes about network access.
skillschinanpmwechatdeployment
by 2005selene2005-a11y Aug 21, 2026 5/10
skill GitHub
A reference lookup skill giving AI agents accurate TYPO3 TypoScript, TSconfig, and Fluid syntax instead of hallucinated approximations. Narrow scope, but reference-lookup skills like this are exactly where models fail most predictably on older or less-documented frameworks.
skilltypo3typoscriptreferencecms
by netresearch Aug 21, 2026 5/10
skill GitHub
Seven opinionated agent skills aimed at the characteristic sloppiness of AI output: stop-slop, red-pen, clarify, distill, quieter, polish, and harden. Each targets a specific failure — padding, hedging, over-explanation, unhardened code — rather than offering generic "improve this" prompting.
skillswritingcode-qualityreviewediting
by wpgaurav Aug 21, 2026 7/10
skill GitHub
A module-by-module source map of Apple internals (objc runtime, CoreFoundation, libdispatch, Foundation) plus common third-party libraries such as AFNetworking, JSONModel, and SDWebImage, with behavior specs and version management scripts. Gives agents a navigable structure over code they would otherwise grep blindly.
iosobjcsourcenavigationchinese
by XiyouMobile3G-iOS Aug 21, 2026 5/10
skill GitHub
A host-neutral skill that lets one coding CLI spawn another agent as a child process and resume that same child session later. The pitch is billing: spend a second subscription you already pay for instead of another subagent on the same bill.
skilldelegationmulti-agentclicost
by isCopyman Aug 21, 2026 7/10
skill GitHub
A large skill pack (116 skills, 35 rules) letting Claude Code assemble 1C sources — metadata, forms, extensions, roles, SKD, data processors — from compact JSON, parse them back, verify results against an export, and check BSP calls against an API reference. Works without Configurator or EDT. Documentation is in Russian.
skills1crussiancodegenenterprise
by Desko77 Aug 21, 2026 5/10
skill GitHub
A portable skill that wraps the Gemini API for use from Claude Code, Codex, Gemini CLI, Cursor, and other agent harnesses. Handy when you want a second model available inside a Claude Code session without wiring up an MCP server.
skillgeminiapimulti-modelportable
by runapi-ai Aug 21, 2026 5/10
skill GitHub
A set of portable agent skills for Claude Code, Codex, OpenClaw, and Hermes covering temporary file-share links, layout-preserving PDF translation, PDF-to-Markdown extraction, and book search. The layout-preserving translation is the standout — most PDF translation pipelines destroy the original formatting.
skillspdftranslationmarkdownportable
by ghbhiee Aug 21, 2026 5/10
skill GitHub
Agent skills that give structure to UX and UI work: interface audits, dashboard redesigns, design system reviews, and AI product design. Provides a checklist the model actually follows rather than open-ended design opinions.
skillsuxuidesign-systemaudit
by Gonadotrophic-tangent41 Aug 21, 2026 5/10
skill GitHub
A skill that flips the usual dynamic — instead of producing a fix, the agent asks questions until you find it yourself. Genuinely useful when you are learning a codebase and want to keep the understanding rather than the patch.
skilldebuggingsocraticlearning
by centsandcode Aug 21, 2026 6/10
skill GitHub
A market research skill for Claude Code, Codex, and WorkBuddy that produces Markdown or PDF reports with cited sources, recomputable figures, and infographics of the core metrics. The recomputable part matters — it is what separates a research report from confident-sounding invention. Documentation is in Chinese.
skillresearchmarketreportschinese
by cxtx Aug 21, 2026 5/10
skill GitHub
An agent-agnostic tutoring skill that writes lessons and notes directly into an Obsidian vault, working with Claude Code, Codex, Cursor, Windsurf, and 70+ other agents. Persisting to a vault rather than a chat window means the material survives the session.
skillobsidianlearningnotesportable
by Mohamed-El-Sharqawy Aug 21, 2026 6/10
skill GitHub
A Claude Code skill that drives Oracle Designer (6i, 9i, 10g) through its CDAPI/CIO PL/SQL API — entities, tables, and forms — with no GUI involved. Ships proven SQL templates. A striking example of using an agent to reach legacy systems whose only interface is an undocumented API.
skilloraclelegacyplsqlautomation
by nuncij Aug 21, 2026 5/10
skill GitHub
Free agent skills for federal contracting work: a SOW/PWS builder, three IGCE builders covering FFP, LH/T&M, and cost-reimbursement, plus OT project description and cost analysis. Written in portable SKILL.md format so they run on Claude, Codex, Gemini, Copilot, Grok, Cursor, opencode, and LibreChat.
skillsgovernmentcontractingportabletemplates
by 1102tools-dev Aug 21, 2026 6/10
skill GitHub
An open agent skill that keeps repository context, feature specs, change handoffs, and README summaries synchronized across AI coding tools. Targets the drift that appears when each tool keeps its own stale copy of what the project is.
skillcontextspecshandoffinterop
by gviiisen Aug 21, 2026 6/10
skill GitHub
Nineteen research skills that build on Groww MCP server to cover Indian markets — stocks, ETFs, mutual funds, bonds, and F&O. A good illustration of layering domain skills on top of a single data-source MCP rather than expecting the MCP to do the analysis.
skillsmcpfinanceresearchindia
by getlost01 Aug 21, 2026 6/10
skill GitHub
A skill giving Windows users a multiplexed control unit for running several agents at once — the tmux-style workflow most multi-agent tooling assumes but Windows users rarely get. Documentation is in Chinese.
skillwindowsmulti-agentterminalchinese
by raystyle Aug 21, 2026 5/10
skill GitHub
Agent skills that run a job search end to end from a single prompt: find postings, track them in Google Sheets, surface LinkedIn leads, and score your resume against ATS filters. Works with Cursor, Claude, and Codex.
skillsjob-searchautomationsheetsats
by ashujha301 Aug 21, 2026 5/10
skill GitHub
Portable agent skills for Codex and Claude built around clean-room workflows, provenance tracking, security review, validation, and packaging for multiple clients. The provenance and validation focus is unusual — most skill collections ship the prompt and stop there.
skillsportableprovenancesecuritypackaging
by JovaniPink Aug 21, 2026 6/10
skill GitHub
A plugin marketplace and skill library installable in one step with /plugin marketplace add Anlo-Ventures/skills-and-agents-library. Uses the native marketplace mechanism, so updates flow through rather than requiring a manual re-copy of files.
marketplacepluginsskillslibrary
by Anlo-Ventures Aug 21, 2026 6/10
skill GitHub
A Claude skill that takes your dated, timed tasks and books them as Google Calendar events instead of keeping them in a separate to-do app. It schedules around fixed recurring commitments so protected blocks never get double-booked. Useful as a worked example of a personal-scheduling skill wired to a real calendar API.
skillcalendargoogle-calendarschedulingproductivity
by fenegroni Aug 21, 2026 5/10
skill GitHub
A Claude skill that builds a personal voice profile from your writing and then audits new drafts against it. It flags documented AI tells with evidence, issues a verdict, and proposes targeted rewrites rather than wholesale regeneration. Handy if you use Claude for drafting but want the output to stay in your own voice.
skillwritingvoiceeditingai-detection
by btmoriarty Aug 21, 2026 7/10
skill GitHub
A collection of portable Agent Skills aimed at software engineering workflows that insist on evidence before conclusions. Being provider-neutral, the skills are meant to work across Claude Code and other agent runtimes without rewriting. Good starting point if you want reusable engineering skills rather than one-off prompts.
skillagent-skillsengineeringportableworkflow
by haoyuqi Aug 21, 2026 6/10
skill GitHub
An open-source collection of Agent Skills published by the Chinese tech account 别动生产库, described as streamlined and reviewed from first principles. The emphasis is on trimming skills down rather than piling on instructions. Worth a look if you want examples of tightly written skill definitions.
skillagent-skillscollectionopen-sourcechinese
by miguchn Aug 21, 2026 5/10
skill GitHub
A Claude Code skill that expands a short brief into a detailed completion contract for long unattended runs. The contract spells out done-criteria up front so a multi-hour session has something concrete to check itself against. Aimed at people running agents overnight rather than babysitting each step.
skillgoalsunattendedautonomyplanning
by leoawesome Aug 21, 2026 7/10
skill GitHub
An Agent Skill packaging the full REST API v1.0 documentation for PayPlus, an Israeli payment gateway, as an offline knowledge base. It covers payment pages, Hosted Fields, server-to-server charging, tokens, recurring payments, Invoice+ and error codes. Works with Claude Code, Claude.ai, Codex and Cursor, so the agent stops guessing at endpoint shapes.
paymentsapi-referenceknowledge-baseisraelagent-skill
by DanielMaximov1995 Aug 21, 2026 5/10
skill GitHub
An AI skill for Claude, Codex and ChatGPT that scans your inbox for class action settlement notices and matches them against your actual purchase history to find cases you qualify for. It verifies claim links against known phishing patterns before you click, then tracks what you filed and what you were paid. A nice demonstration of a skill doing real cross-referencing rather than just prompt scaffolding.
emaillegalautomationphishing-checkagent-skill
by yingying-chu Aug 21, 2026 5/10
skill GitHub
Two Claude Code skills bundled together. God Dev runs code review through three sequential gates rather than one pass, so each stage can catch what the previous one missed. God Write rewrites AI-sounding prose into something that reads human. Small and focused, which makes them easy to lift patterns from.
code-reviewwritingskillsquality-gates
by xhanthis Aug 21, 2026 6/10
skill GitHub
A Claude Code plugin marketplace from DBHQ collecting their free, open-source skills, installable with /plugin marketplace add dbhq-uk/marketplace. It is the distribution point for their individual skills rather than a single tool. Convenient if you already use one of their skills and want the rest without hunting repos.
marketplacepluginsskillsdistribution
by dbhq-uk Aug 21, 2026 6/10
skill Reddit
A heavy Claude Code and Codex user, running roughly 117 messages a day, got fed up with walls of text surviving every instruction to be terse and went looking for why. The write-up documents the pattern behind directives being ignored and a technique using style contagion — shaping the surrounding context so the desired style propagates — rather than issuing more explicit instructions. Relevant to anyone whose CLAUDE.md tone rules keep getting steamrolled.
promptingstyleclaude-mdoutput-formattechnique
by allemaar Aug 21, 2026 6/10
skill GitHub
A collection of reusable AI engineering skills, workflows, templates and evaluation playbooks written to be tool-agnostic rather than tied to one agent CLI. The evaluation playbooks are the differentiator — most skill collections cover building but not how to measure whether the output is any good.
skillstemplatesevaluationworkflowstool-agnostic
by karthikrshet Aug 21, 2026 6/10
skill GitHub
An operator skill for gym owners that first builds a Gym Operations Knowledge Base, then runs recurring business tasks grounded in it rather than in generic model priors. The build-the-KB-then-operate-from-it shape is the transferable idea — it generalizes to any small business with repeatable weekly work.
businessknowledge-baseoperationsagent-skillvertical
by Level-Method Aug 21, 2026 5/10
skill GitHub
A meta-skill that compresses any other skill's instructions, hashes the result, and caches it so repeat invocations cost fewer tokens. Compression is license-checked and preserves allowed-tools declarations and structure verbatim, so the skill's permissions and shape survive intact. Aimed at people running large skill libraries where the same instructions reload every session.
token-efficiencycompressionmeta-skillcachingcost
by marianif Aug 21, 2026 7/10
skill GitHub
A Claude Code skill that critiques and scores CVs using a weighted engineering-leadership rubric. Includes ATS compatibility checks, AI-slop detection, and optional matching against a specific job description. Handy for anyone hiring or job hunting in engineering.
cvhiringrubricskill
by maccydee Aug 20, 2026 5/10
skill GitHub
Build, publish, and manage custom Claude Code skills as slash-command plugins distributed through a GitHub-hosted marketplace. Covers the packaging side that most individual skill repos leave to the reader.
marketplaceskillspluginsslash-commands
by rs2pydev Aug 20, 2026 6/10
skill GitHub
Every skill pick is field-tested by building a product from scratch with it, then scored on a public rubric. Currently 15 published picks across 16 field tests, with live demos and open source for each. A useful antidote to skill lists that are just README screenshots.
skillsreviewsrubriccuration
by phoebefu6 Aug 20, 2026 6/10
skill GitHub
A skill collection covering the parts of Rust that agents usually get wrong: unsafe code, atomics, FFI/JNI/UniFFI boundaries, sanitizers, profiling, and supply chain checks. Aimed at production work rather than tutorials.
rustunsafeffiprofilingskills
by po4yka Aug 20, 2026 7/10
skill GitHub
Takes rough working notes and produces an executive-ready HTML update, viewed through nine different leadership lenses. For the weekly-update writing that engineers tend to put off.
reportingwritingexecutiveskill
by yanliudesign Aug 20, 2026 5/10
skill GitHub
A production-oriented bundle of skills and subagents covering plan, build, test, debug, and ship, plus harness hooks and quality gates for long sessions. Claude Code native but written to work with any LLM host, in any repo or language.
skillssubagentshooksquality-gates
by jvalin17 Aug 20, 2026 6/10
skill GitHub
A set of Claude Code skills for website cloning, pixel-accurate design rebuilds, WordPress page-builder CMS work, modern CSS, and motion-graphics ad production. Front-end and design-heavy rather than backend.
designcsswordpresscloningskills
by abdul977 Aug 20, 2026 6/10
skill GitHub
An agent skill that finds matching job postings, deduplicates them, verifies they are real and still open, ranks them, and tracks status in a searchable HTML report. The verification step is what separates it from a scraper.
jobssearchreportskill
by yanliudesign Aug 20, 2026 5/10
skill GitHub
A large collection of agent skills for e-commerce content: product photography, short-form selling video, viral-post recreation, print-on-demand artwork, and cross-border product selection. Chinese-language, aimed at sellers rather than developers.
e-commercecontentmediaskillschinese
by autoagc Aug 20, 2026 5/10
skill GitHub
An adaptation of Anthropics claude-for-legal skills for mainland China, Hong Kong, Macau, Taiwan, and Singapore, covering 30 legal scenarios with 478 skills. One of the larger jurisdiction-specific skill systems published so far.
legalskillschinajurisdiction
by vivy-yi Aug 20, 2026 5/10
skill GitHub
Uses a vision model to detect the grid system underlying a poster, overlays it for inspection, and exports SVG guides, CSS Grid, or Tailwind code. Model-agnostic and ships as an installable agent skill.
designvisioncss-gridtailwindskill
by Ygria Aug 20, 2026 5/10
skill GitHub
A CLI plus portable agent skill that gives an agent only the environment variables it needs for the task at hand, rather than exposing your whole shell environment. Straightforward mitigation for the most common way secrets leak into transcripts.
securitysecretsenv-varsleast-privilege
by buhaistrikalo Aug 20, 2026 7/10
skill GitHub
Generates, reviews, and diagnoses Terragrunt configurations across AWS, Azure, and GCP. Notably it reads the installed terragrunt version from the machine rather than asserting one, and uses a grep-first reference set to avoid loading docs it does not need.
terragruntiacawsazuregcp
by kevin-burns Aug 20, 2026 6/10
skill GitHub
A universal SEO and technical-optimization skill suite that runs in Claude Code, Antigravity, Cursor, Windsurf, Copilot, ChatGPT, and Cline. Covers audits and content optimization from one skill set rather than per-tool configs.
seoauditcross-toolskills
by seoskillsai Aug 20, 2026 5/10
skill GitHub
A coding-agent skill that reworks your prompt before the agent acts on it, which the author measures as a 45% reduction in failures on agentic coding tasks. Worth a look if your failures cluster around underspecified requests.
promptingreliabilityskillbenchmark
by Spielewoy Aug 20, 2026 6/10
skill GitHub
Three Claude Code skills for engineering-management business writing, derived from Josh Bernoffs Writing Without Bullshit and built with a TDD-for-docs discipline. The methodology is the interesting part — the skills were tested against expected outputs before publishing.
writingmanagementtddskills
by introvenk Aug 20, 2026 5/10
skill GitHub
Fans out a literature query to OpenAlex, Semantic Scholar, arXiv, and Perplexity, deduplicates deterministically rather than by model judgement, and reconciles everything into one cited consensus report. The deterministic dedup is what makes results reproducible.
researchpapersarxivsearchskill
by PlutoLei Aug 20, 2026 7/10
skill GitHub
A Claude Code skill wrapping PaperBanana to generate publication-ready academic diagrams from a description. For the figures that usually cost an afternoon in Illustrator.
diagramsacademicfiguresskill
by PlutoLei Aug 20, 2026 5/10
skill GitHub
Research skills for Claude Code and Codex that tie every agent claim to a node in a verifiable evidence graph instead of leaving it floating in chat history. Makes it possible to audit where a conclusion came from.
researchevidencegraphprovenance
by Ahmad-Jaradat-Space Aug 20, 2026 6/10
skill Reddit
Run it and the agent interrogates you on the minutiae of your code, which quickly exposes the gap between how the code runs and what you believe about it. The author pitches daily use to hold down cognitive debt, and notes it also surfaces poor implementations and misaligned intent. Not a substitute for a real SDLC.
reviewlearningcognitive-debtskill
by jjw_kbh Aug 20, 2026 7/10
skill GitHub
A QA framework of methodology plus ten skills that makes an agent work like a senior test engineer, shipped with a reproducible benchmark so the claims can be checked. Chinese-language, works in Claude Code and other agent hosts.
qatestingbenchmarkskillschinese
by fishzjp Aug 20, 2026 6/10
skill GitHub
A deliberately small set of Claude skills for analytical work, each validated against real tasks before being published. Quality-over-quantity in a space full of hundred-skill dumps.
skillsanalysiscuration
by viktor-milev Aug 20, 2026 5/10
skill GitHub
A skill for Codex and Claude Code that scaffolds an effective engineering workflow onto a project, so the agent has a defined process to follow rather than inventing one per task.
workflowscaffoldingcodexskill
by xeonvs Aug 20, 2026 5/10
skill GitHub
Skills, hooks, and verification gates installed once globally, so product repositories stay untouched by your personal tooling. Works across both Claude Code and Cursor.
dotfileshooksskillsglobal-config
by bwkw Aug 20, 2026 5/10
skill GitHub
Curated skill and software-tool collections for scientific AI agents, generated by the AgenticScienceBuilder and grounded in cited evidence. Domain coverage for research work rather than general software engineering.
scienceresearchskillsevidence
by HolobiomicsLab Aug 20, 2026 5/10
skill Reddit
CLAUDE_CODE_SIMPLE_SYSTEM_PROMPT set to 0, false, no, or off opts out of the shorter system prompt and abbreviated tool descriptions even where the experiment would otherwise enable it. Full tool set, hooks, MCP servers, and CLAUDE.md discovery are unaffected either way. The poster reports noticeably fewer careless errors after 48 hours with it off.
env-varssystem-promptconfigurationtips
by dar-mit Aug 20, 2026 6/10
skill GitHub
Turns meeting transcripts into three outputs at once: an executive summary, a detailed technical record that preserves decision rationale, and action items aligned to both. The rationale-preserving record is the part most summarizers drop.
meetingssummarizationtranscriptsskill
by terravic Aug 20, 2026 5/10
skill GitHub
Agent skills covering financial literacy, BIST and TEFAS instruments, warrants, portfolio risk, and calibrated forecasting, in two languages. Notable for framing forecasts as calibrated rather than confident.
financeinvestingriskskills
by yigityildiz0 Aug 20, 2026 5/10
skill Reddit
PlayCanvas has published first-party agent skills for its engine, and one developer has been building a multiplayer FPS with them. First-party skills from an engine vendor are still rare enough to be worth noting.
playcanvasgamedevofficialskills
by Kpal81 Aug 20, 2026 6/10
skill GitHub
An agent skill collection spanning video editing and software work, written against SKILL.md so it runs in Claude Code, Codex, or any compatible host.
videoeditingskillscross-tool
by AFangTeam Aug 20, 2026 5/10
skill GitHub
Skills plus a full project harness built around an evaluate, issue, plan, resolve, verify cycle, with gitleaks, semgrep, and trivy gates, guard hooks, and score-aligned coding rules. The author frames it as harness engineering rather than prompt engineering.
cisecurityhooksharnessskills
by ymd38 Aug 20, 2026 6/10
skill GitHub
A planning skill that interrogates the request before producing a plan, shipped in three variants: claude.ai, engineers, and a read-only version for people with data access who do not ship code.
planningpromptingskillvariants
by marcosathanasoulis Aug 20, 2026 5/10
skill GitHub
A trimmed version of the BMAD method sized for people on smaller subscription tiers, where the full method burns the window before the work starts.
bmadplanningtoken-efficiencyskills
by rterakedis Aug 20, 2026 5/10
skill GitHub
Every skill you install effectively asks you to trust it; this one reads it first. Pre-install audit for agent skills, plugins, and MCP servers covering lethal-trifecta reach, prompt-injection wording, provenance, and drift after you approved it. The drift check matters — approval is not permanent.
securityauditsupply-chainprompt-injectionmcp
by kanywst Aug 20, 2026 8/10
skill GitHub
Keeps a CLAUDE.md and architecture.md next to each module so Claude loads verified local context before editing, and updates those files as part of the same change. Documentation that goes stale is the failure this targets.
claude-mdarchitecturecontextdocumentation
by rohit-patil-lifecode Aug 20, 2026 6/10
skill GitHub
Deterministic coding standards for Python, TypeScript, SQL, infrastructure as code, and repository policy — written so an agent applies them the same way every time rather than interpreting them afresh.
standardspythontypescriptsqliac
by sarj-ai Aug 20, 2026 5/10
skill GitHub
A set of agent skills for reasoning under uncertainty, shipped alongside a pre-registered, placebo-controlled harness that measures whether the skills actually change outcomes. The evaluation rigor is the unusual part — most skill packs ship without any evidence they help.
skillsdecision-makingevaluationbenchmark
by AngelCampa1 Aug 20, 2026 6/10
skill GitHub
A skills library for offensive security work that targets Claude, ChatGPT, Gemini, and Copilot from one source. Includes categories specific to AI systems — MCP attack surface, LLM pipeline weaknesses, and AI-native attack patterns — alongside conventional red-team material.
securityred-teamskillsmcp
by sunilgentyala Aug 20, 2026 5/10
skill GitHub
An agent skill that produces knowledge artifacts in a defined Markdown format where every claim links back to its source. Intended for evidence bundles, research summaries, and reproducible AI context you can hand to another agent or a human reviewer.
skillsresearchdocumentationprovenance
by israelsaba Aug 20, 2026 5/10
skill Reddit
Precis deliberately does not review or judge code — it points at a PR, MR, or raw diff and generates a single self-contained HTML report to orient a human reviewer. Built for teams that delegate the coding to agents but still want a person to genuinely understand what landed.
pull-requestcode-reviewskillshtml-report
by Anaq42 Aug 20, 2026 7/10
skill GitHub
An agent skill that reviews prose for formulaic phrasing, punctuation tells, cliches, and flat sentence rhythm, then suggests more human-sounding edits. Works in English and Brazilian Portuguese and is explicit about keeping authorship claims honest rather than promising undetectability.
skillswritingeditingportuguese
by israelsaba Aug 20, 2026 6/10
skill GitHub
Converts authorized public web pages to high-fidelity PDFs using Playwright screenshots, handling consent dialogs and lazy-loaded content. Preserves source URLs and timestamps in the output and deliberately keeps private browser profiles and credentials out of generated artifacts.
skillspdfplaywrightarchiving
by israelsaba Aug 20, 2026 6/10
skill GitHub
An agent skill giving exact character, word, phrase, sentence, paragraph, line, grapheme, and UTF-8 byte counts, with the counting method stated for each. Ships a dependency-free CLI helper so the model verifies constrained copy locally instead of estimating.
skillswritingcliseo
by israelsaba Aug 20, 2026 5/10
skill GitHub
A drop-in "operating system" for Claude Code that installs a role persona wholesale. The Product Manager OS bundles 40 skills grounded in PM literature, plus commands, memory, and getprompts/getskills helpers for inspecting what is loaded.
skillsproduct-managementpersonacommands
by Sidsaladi9 Aug 20, 2026 6/10
skill GitHub
Agent skills aimed at production correctness in distributed systems: idempotency, exactly-once effects, failure-mode analysis, and money-movement integrity. Targets the class of bugs that pass tests and surface later under retries or partial failure.
skillsdistributed-systemscorrectnessidempotency
by abhisheksharma2411 Aug 20, 2026 6/10
skill GitHub
Claude Code skills for parametric CAD in OpenSCAD, with machine verification of mechanical compatibility for moving assemblies. Catches interference and fit problems programmatically rather than leaving them to visual inspection.
skillscadopenscadhardware
by Altern92 Aug 20, 2026 6/10
skill GitHub
A Spanish-language skill pack for Claude Code and Cursor that generates advertising video and imagery through the KIE.ai API, covering Seedance 2.0, Sora 2, Veo 3.1, and Nano Banana. Turns ad creative generation into agent-callable steps.
skillsvideoadvertisingspanish
by itsninoduke Aug 20, 2026 5/10
skill GitHub
One repo holding a global CLAUDE.md, settings, and bash environment, symlinked into place and kept in sync across machines. A concrete reference for anyone tired of hand-copying their Claude Code setup to a new box.
dotfilesconfigurationclaude-mdsync
by danjdewhurst Aug 20, 2026 5/10
skill GitHub
Claude Code skills for M5Stack firmware work, supplying board pinouts, peripheral details, and ESP32 chip capability references. Gives the agent the hardware facts it would otherwise hallucinate.
skillsembeddedesp32m5stack
by iot-forge Aug 20, 2026 6/10
skill GitHub
Skills for querying on-chain crypto data APIs — Dune, Solscan Pro, Nansen, and Solana RPC via Helius or QuickNode. Credit-aware and batch-optimized so the agent does not burn paid API quota, and exposed cross-agent through AGENTS.md.
skillscryptoon-chainapi
by Vo1ganin Aug 20, 2026 5/10
skill GitHub
An agent skill running ten security checks against a shipped app, where every PASS must cite a file:line or probe output and anything unverifiable scores zero. That evidence rule is the point — it blocks the usual agent habit of asserting a check passed without looking. Emits a self-contained HTML scorecard and works with Claude Code and Codex.
skillssecurityauditverification
by jtlgrowth Aug 20, 2026 7/10
skill GitHub
A Claude Code setup where skills trigger themselves via a routing hook rather than waiting to be invoked, backed by 22 skills and 7 subagents. Includes a verification gate that blocks the agent from claiming a task is done when it is not.
skillssubagentshooksverification
by itsvedantkumar Aug 20, 2026 6/10
skill Reddit
A simple, well-received trick: have Claude build a skill from the Google Developer Style Guide, then instruct it to communicate only through that skill. The poster reports it eliminated padded three-page responses and stock phrases like "load bearing" across every session.
skillswriting-stylecommunicationprompting
by poster_nutbaggg Aug 20, 2026 6/10
skill GitHub
Mirko Bozzetto's personal collection of skills for AI coding agents, kept portable across Claude Code, Codex, and Cursor. Worth browsing as a real working set rather than an aspirational catalog.
skillscollectioncross-agentcurated
by mirkobozzetto Aug 20, 2026 5/10
skill GitHub
A skill pack covering document parsing, PDF engineering, systematic-review research, flashcard generation, and WhatsApp automation. Portable across Claude Code, Cursor, Codex, and ZCode.
skillspdfresearchautomation
by amgrbi96 Aug 20, 2026 5/10
skill GitHub
Twenty-seven agent skills for firewall and network security: Juniper SRX design, NAT, VPN, and MNHA playbooks, Security Director and ClearPass deployment, plus cross-vendor parse, audit, convert, and diff across Cisco, Fortinet, Palo Alto, and SRX. Also maps evidence to PCI, HIPAA, CMMC, CIS, ISO, SOC 2, and DISA STIG.
skillsnetworkingfirewallcompliance
by JNPRAutomate Aug 20, 2026 6/10
skill GitHub
A personal collection of Claude Code plugins, skills, and slash commands for AI-assisted development. Useful as a working reference for how one developer structures plugin-packaged capabilities.
pluginsskillsslash-commandscollection
by danielbodnar Aug 20, 2026 5/10
skill GitHub
Growth marketing playbooks sourced from operators at Cursor, Notion, Linear, Deel, Gamma, and Granola, packaged as an installable agent skill. Turns marketing practice from those companies into something an agent can execute against.
skillsmarketinggrowthplaybooks
by About-Intelligence Aug 20, 2026 6/10
skill GitHub
Eighty-eight installable open-source agent skills spanning research, social intelligence, marketing, and general business workflows. Compatible with Codex, Claude Code, Cursor, Gemini CLI, and the DeepSeek harness.
skillsresearchbusinesscross-agent
by sandbaseai Aug 20, 2026 6/10
skill GitHub
A universal agent skill wiring BrowserOS browser automation plus more than 40 SaaS integrations through a Streamable HTTP MCP endpoint. Works across Claude Code, Antigravity, Gemini CLI, PicoClaw, Nanobot, and Hermes.
skillsbrowser-automationmcpsaas
by psthi Aug 20, 2026 6/10
skill Reddit
A survey of popular skill repos and community threads arguing that durable skills constrain agent behavior rather than add capability — Superpowers works because it stops the model charging ahead, not because it teaches anything new. The counterpoint raised is that generic skills produce technically-fine but unusable output because they know nothing about your conventions. Open discussion on whether a skill scoped to one repo is still worth writing.
skillsdiscussionbest-practices
by WhereasOtherwise4697 Aug 19, 2026 6/10
skill GitHub
Agent skills covering the whole dbt lifecycle — orient, decide, build, prove, ship. Conventions are read from a contract file you own, so the guidance reflects your project's standards rather than generic dbt advice.
dbtdataskillsanalytics-engineering
by yshah-1108 Aug 19, 2026 6/10
skill GitHub
Battle-tested guidelines for getting AI coding agents to emit production-quality TypeScript and React/React Native code. Written to be pasted straight into CLAUDE.md or AGENTS.md with no adaptation.
claude-mdtypescriptreactstandards
by vlkalex Aug 19, 2026 7/10
skill GitHub
Claude Code skills for month-end close, reconciliation, flux analysis, three-statement integrity checks, and SaaS metrics. Includes NetSuite and BigQuery pipelines, financial artifact generation, and measured token economics. Built to run on a managed Enterprise seat.
financeskillsenterpriseaccounting
by Lukehle Aug 19, 2026 6/10
skill GitHub
Agent skills for Kora, a compile-time framework for Java and Kotlin backend development. Gives coding agents framework-specific knowledge instead of falling back on generic JVM guidance.
skillsjavakotlinbackend
by kora-projects Aug 19, 2026 5/10
skill GitHub
A ship gate for AI-written code that enforces four rungs on every response: SAFE (security at trust boundaries), TRUE (errors handled), OBVIOUS (readable code), and ALONE (nothing stale left behind). Output that has not cleared all four does not ship.
quality-gatecode-reviewsecurity
by azrtydxb Aug 19, 2026 7/10
skill GitHub
A Claude Code skill that runs automated smoke tests for Flutter across Android, iOS, and Web. Includes integrity gates specifically designed to stop agents from weakening or deleting tests to make a run go green.
fluttertestingskillsmobile
by ceeyang Aug 19, 2026 6/10
skill GitHub
Drop-in skills for Claude Code and Codex pairing a graph-based working method with a durable context vault. Targeted at agent work spanning many sessions, where context would otherwise be lost between them.
contextskillsmulti-sessiongraph
by AJ-Edelman Aug 19, 2026 6/10
skill GitHub
Audits an agent's installed skills and recommends removing what is no longer needed — things the model already knows, capabilities the harness now provides natively, or work an MCP server has taken over. A deliberate counterweight to skill sprawl. Bilingual Chinese and English.
skillsauditcleanup
by swaylq Aug 19, 2026 7/10
skill GitHub
A Claude Code skill that cross-reviews your uncommitted diff with two competing AI CLIs. They argue over the changes until neither has a blocking objection left, which surfaces disagreements a single reviewer would miss.
code-reviewmulti-agentskilldiff
by MazzaWill Aug 19, 2026 7/10
skill GitHub
Claude Code skills for Altium hardware work, covering library authoring, schematic review and PCB placement. A rare example of agent skills reaching outside software into EDA tooling.
hardwarepcbaltiumskill
by letjsk Aug 19, 2026 7/10
skill GitHub
A penetration testing skill built from official kali.org data, covering 470+ tools, 13 domain references and 3 workflow playbooks. Gives the agent structured knowledge of the Kali toolset instead of guessing at flags.
securitypentestkaliskill
by StanleyChanH Aug 19, 2026 7/10
skill GitHub
An open-format agent skill loadable by Claude Code, Codex or Gemini CLI that answers plain-language rental questions. Collects public reviews across platforms and generates a visual report with maps and links back to the original posts.
researchskillchinareports
by daxueren666 Aug 19, 2026 5/10
skill GitHub
A two-skill suite for writing reports aimed at senior stakeholders. Automatically matches the situation to one of 20+ reporting methodologies, then runs six layers of language polish. Works with Claude Code, Cursor, Trae and CodeBuddy.
reportingwritingskillbusiness
by cvk0524 Aug 19, 2026 5/10
skill GitHub
A high-rigor multi-agent engineering skill combined with a visual production system and a reliability layer for AI coding agents.
multi-agentreliabilityskillvisual
by LUC4N3X Aug 19, 2026 5/10
skill GitHub
A large self-updating local archive of AI tooling: agent skills, MCP servers, Cursor/Cline rules and system prompt collections in one repository. Useful as a reference corpus when you want to see how others wrote a given skill.
archiveskillsmcprules
by HIDORAKAI002 Aug 19, 2026 6/10
skill GitHub
A plugin that treats skills as something you summon on demand rather than keep permanently loaded. Two modes let the agent either stay in the loop with you or code freely. Defaults to the Gaia Skill Tree as its source.
skillsplugincontextmanagement
by gaia-research Aug 19, 2026 6/10
skill GitHub
A personal skills collection covering Google Trends SEO workflows, AI news gathering and autopilot automation. Works with Claude Code, Codex and Cursor.
seoskillstrendsautomation
by yan-labs Aug 19, 2026 5/10
skill GitHub
Agent skills for research where every expert judgement is an explicit checkpoint and every mechanical rule is a script. The first published skill covers binder design campaigns.
researchscienceskillprotocol
by SPYfighting Aug 19, 2026 5/10
skill GitHub
An agent skill that reads your repo, rewrites the description into one tight line, and writes a 1280x640 self-contained HTML social preview card. Four editorial moods, CJK-first typography, deterministic checks and PNG export via the Chrome you already have — no image model involved.
designopengraphgithubskill
by sjh9714 Aug 19, 2026 7/10
skill GitHub
A local linter for Chinese AI-sounding prose, ported from sloptrim with a pattern library rewritten for Chinese internet writing. Only rewrites the sentences it flags, preserving facts and the author's stance instead of flattening the whole piece.
writinglinterchinesestyle
by pakco77 Aug 19, 2026 6/10
skill GitHub
A skill that writes in Russian and cleans out 34 markers of machine-generated text, following the Russian Wikipedia style guide. Written natively rather than translated from English rules.
writingrussianstyleskill
by alexrexby Aug 19, 2026 6/10
skill GitHub
A broad skills collection for Claude Code and compatible agents, spanning workflow, coding, design, Claude Code meta-tasks, media, productivity and writing.
skillscollectionproductivitydesign
by coroboros Aug 19, 2026 5/10
skill GitHub
Skills aimed at engineering work that spans many sessions. One SKILL.md file works across Claude Code, Codex, Gemini CLI and Cursor via the open standard.
skillsengineeringlong-runningopen-standard
by ritmillio Aug 19, 2026 5/10
skill GitHub
A central place for agentic standards, guidelines, skills and bootstrap tooling covering Claude, Codex and Copilot. Useful if you want one source of truth across a team using several agents.
standardsguidelinesbootstrapskills
by me-cedric Aug 19, 2026 5/10
skill GitHub
Generates a compact router skill over a large SKILL.md catalogue, so the agent can find the right skill without loading every description into context.
skillsroutercontextcatalog
by slepox Aug 19, 2026 6/10
skill GitHub
A skill that renders execution maps and session timelines for agent runs across Cursor, Codex, Claude Code, Workbuddy and kimi-code. Helps you see where a long session actually spent its time.
visualizationsessionstimelineskill
by fenfenxu Aug 19, 2026 5/10
skill GitHub
Flutter engineering rules for Codex, Claude Code, Cursor and Devin covering architecture, BLoC, UI, APIs, navigation, quality, security and Git safety. Invoked explicitly rather than always-on, so they do not eat context on unrelated work.
flutterrulesarchitecturemobile
by aswinsubhash Aug 19, 2026 6/10
skill GitHub
An opinionated Claude Code collection of commands, subagents and skills aimed at autonomous software delivery and legacy application modernization.
collectionsubagentsmodernizationcommands
by aiFabricoCom Aug 19, 2026 5/10
skill GitHub
A design skill for Claude Code that starts from real shipped product UI sourced from Mobbin. Researches screens, flows and sections, then holds itself to reference locks and a decision ledger.
designuiresearchmobbin
by notsointresting Aug 19, 2026 7/10
skill GitHub
An agent skill that samples Y Combinator and top-investor job postings and parses out salary and equity, so you can benchmark offers against the market.
jobssalaryycresearch
by johnisanerd Aug 19, 2026 5/10
skill GitHub
Pulls live remote startup jobs from Wellfound into structured rows with salary and equity parsed into numbers, so the results are sortable instead of prose.
jobsremotewellfounddata
by johnisanerd Aug 19, 2026 5/10
skill GitHub
An agent skill that turns a GitHub profile README into an editorial layout with kerned serif mastheads rendered as path-outlined SVGs. Ships light and dark pairs, uses zero external resources, and validates itself with deterministic checks.
designgithubreadmesvg
by sjh9714 Aug 19, 2026 6/10
skill GitHub
A controlled-language skill implementing français rationalisé (GIFAS) and ASD-STE100 for technical French, with benchmark results rather than assertions.
frenchwritingcontrolled-languagebenchmark
by quantumsheep Aug 19, 2026 5/10
skill GitHub
A forkable base for your own agent-skills kit. skill-cleaner merges a bloated registry down to one skill per task, and skill-healer writes back what each session learned.
skillsmaintenanceregistryself-improving
by heyramzi Aug 19, 2026 6/10
skill GitHub
A Claude Code skill that routes summarisation, log triage and bulk-text work to local models instead of burning API tokens. Keeps content on-device and audits which models your hardware can actually run.
local-llmdelegationtokensprivacy
by IsmaelMartinez Aug 19, 2026 7/10
skill GitHub
Converts a talking-head transcript into a tiered keyword timeline, a subtitle plan and a B-roll checklist. Analysis only — it does not render video. Works with Claude Code and Codex CLI on macOS, Linux and Windows.
videotranscriptcontentplanning
by jameswu881102 Aug 19, 2026 5/10
skill GitHub
A Claude Code skill that runs an iterative review-and-fix loop against an external agent — codex, opencode or pi — and keeps going until the reviewer reports NO FINDINGS.
reviewloopcodexmulti-model
by illarion Aug 19, 2026 7/10
skill GitHub
An open-source Claude Code plugin marketplace for Turkish law with 81 plugins and over 1000 skills, covering methodology, citation hygiene, contracts, litigation and legal opinions. Explicitly not legal advice.
legalturkishpluginsskills
by aydincan Aug 19, 2026 6/10
skill GitHub
A Claude Skill that teaches the agent how to build clean, professional terminal UIs and CLIs rather than leaving layout and interaction choices to guesswork. It covers Bubble Tea (Go), Ratatui (Rust), Textual (Python), and Ink (TypeScript), so the same design conventions carry across whichever stack a project uses. Worth installing if your agent keeps producing functional-but-ugly CLI output.
tuiclidesignbubbletearatatuitextualink
by gfargo Aug 19, 2026 8/10
skill GitHub
A skill pack covering go-to-market work — pricing models, customer personas, and launch positioning — for developers who can build a thing but stall at shipping it to users. Extends the gstack skill collection. Narrow in scope, but a rare example of Claude Code skills aimed at the commercial side of a project rather than the code.
gtmpricingmarketingskillspersonas
by Yosei-Lab-ai Aug 19, 2026 5/10
skill GitHub
A skill that routes mechanical, low-judgment work to GLM after a consultant gate decides the task doesn't need the stronger model, passing a structured four-part brief so the cheaper model has enough context to succeed. Part of a small family of orchestration skills built around that gate. Relevant to anyone doing cost-aware multi-model routing.
multi-modeldelegationglmcost-optimizationskills
by dalsoop Aug 19, 2026 5/10
skill GitHub
Guards against a model asserting more confidence than the evidence supports by combining a token budget, an adversarial review pass run through Grok, and prompt scoring. Pairs with an orchestrator-consultant-gate skill that handles the consult decision itself. A concrete implementation of the 'have a second model try to refute it' pattern.
multi-modeladversarial-reviewgrokguardrailsbudget
by dalsoop Aug 19, 2026 5/10
skill GitHub
A French-language skill pack connecting plant biodiversity data to chemistry: WCVP name resolution, documented chemistry from LOTUS, GBIF collection effort, and public spectra from ReDU. Its most transferable idea is the set of methodological controls that stop the agent from publishing a false coverage result. A good template for building rigorous domain-science skills.
sciencechemistrybiodiversityresearchskillsdata-validation
by Oshinsu Aug 19, 2026 5/10
skill GitHub
A design skill that makes the agent think through its own orchestration up front — how many subagents, what topology, what loop bounds, and which harness controls — before autonomous work begins. This front-loads the decisions that usually get improvised mid-run and cause runaway fan-out. Useful for anyone building multi-agent workflows.
multi-agentorchestrationdesignsubagentsskills
by AlveeeRahman Aug 19, 2026 7/10
skill GitHub
A set of Agent Skills written to be portable across harnesses rather than tied to Claude Code, the headline one being multi-LLM peer code review that authenticates via OAuth only — no API keys to provision or leak. Useful if you run more than one agent CLI and want a single skill directory serving all of them.
skillscross-harnesscode-reviewmulti-llmoauth
by marroccofella Aug 19, 2026 6/10
skill GitHub
A small spec plus dependency-free bash tools for teams whose agents keep following stale instructions. It keeps AGENTS.md and CLAUDE.md generated from one source and checks that they stay honest as the project changes. No runtime, no package install — just shell scripts you drop into a repo.
claude-mdagents-mdspecbashconfig-sync
by anmoln7 Aug 18, 2026 6/10
skill GitHub
A skill pack covering cheminformatics, molecular ML, docking and molecular dynamics, protein design platforms, and target-discovery knowledge graphs. It gives Claude Code working knowledge of the standard computational drug-discovery toolchain instead of relying on general recall. Aimed at research teams doing therapeutics work inside an agent loop.
skillsdrug-discoverycheminformaticsprotein-designscience
by K-Dense-AI Aug 18, 2026 7/10
skill GitHub
A published collection of Agent Skills from the PCM stack team, packaged in the standard SKILL.md format. Drop them into Claude Code to give the agent stack-specific expertise without re-explaining conventions each session.
skillscollectionskill-md
by PCMStack Aug 18, 2026 5/10
skill GitHub
A small Agent Skill that reads a text-to-image prompt and returns five short, interpretive title candidates for it. Narrow scope, but a clean example of a single-purpose SKILL.md that does one thing well.
skillnamingtext-to-imagecreative
by aschet Aug 18, 2026 5/10
skill GitHub
A Claude Code skill pack covering the full SaaS build: prevention-first security baked into generation rather than bolted on as an audit pass, real Stripe payment integration rather than a product catalog stub, and 15 skills spanning the product lifecycle. Designed to pair with Superpowers and otherwise stand alone.
skillssaassecuritystripepaymentslifecycle
by MartinOlivero Aug 18, 2026 7/10
skill GitHub
An MIT-licensed Claude Code plugin packaging a 14-phase content pipeline into six Agent Skills, carrying a project from thesis to book, novel, screenplay, AI film, and distribution. Formerly published as content-pipeline-skills. Niche, but a concrete example of chaining long-form creative work through skills.
skillsplugincontent-pipelinewriting
by adammatthewsteinberger Aug 18, 2026 5/10
skill GitHub
A skill aimed at onboarding into unfamiliar code, constraining the agent to answers that are short, plain, and complete rather than sprawling summaries. Meant for joining a project mid-flight and getting an accurate picture quickly.
skillonboardingcode-comprehension
by parhamdavari Aug 18, 2026 7/10
skill GitHub
A set of skills that let a coding agent do substantive security work on a codebase: auditing, remediating vulnerabilities, and executing tasks unattended. Aimed at real repository work rather than advisory output.
skillssecurityauditunattended
by SecurityMindedSolutions Aug 18, 2026 7/10
skill GitHub
A measured communication policy for coding agents that strips filler from responses while preserving the substance. The author reports a 32 percent reduction in output tokens with zero lost facts. Useful if agent verbosity is eating your budget.
prompttoken-usageverbositypolicy
by Maksim-Burtsev Aug 18, 2026 6/10
skill GitHub
A Claude Code skill paired with a zero-dependency CLI that rewrites App Store subscription prices per country according to purchasing power parity. Handles the tedious per-territory price matrix that Apple otherwise makes you fill in by hand.
skillapp-storepricingcli
by harryjmg Aug 18, 2026 6/10
skill GitHub
Skills for automating Lark / Feishu workflows via lark-cli. Works with both Claude Code and Codex. Doc creation (personal + enterprise), team weekly reports from GitHub/GitLab commits, scenario-bas...
skillworkflowgit
by RoboZephyr Aug 18, 2026 8/10
skill GitHub
Skill Vision — the QA skill for Claude skills: see inside your Agent Skills before they ship (spec conformance, script testing, quality scores, security posture, token cost)
skilltesting
by AlveeeRahman Aug 18, 2026 7/10
skill GitHub
A Claude Skill that stops silent corner-cutting: plan before acting, no placeholder code passed off as finished, verify it actually works, no filler in the response. For Claude Code & Claude.ai Rig...
skill
by olimxonuz0-lab Aug 18, 2026 8/10
skill GitHub
Dev skills I use day to day in agentic engineering, focused on multi-agent-driven work modes and long-horizon autonomous tasks.
skill
by keli-wen Aug 18, 2026 6/10
skill GitHub
Ticket-to-PR development workflow skills for Claude Code, with pluggable issue trackers (Jira, Azure DevOps).
skillworkflow
by matheusPavaneli Aug 18, 2026 8/10
skill GitHub
Hive orchestration for Claude Code — model cascade, external memory, self-evolving skills. Native primitives only, subscription-safe.
skill
by Black-coffe Aug 18, 2026 8/10
skill GitHub
0 config AI agent skill for Unity — AI-driven unity control, automate workflow. For UnityEditor/UnityPlayer
skillworkflowconfig
by niqibiao Aug 18, 2026 7/10
skill GitHub
Diagrams as D2 source rendered to PNG, so the picture lives in git next to the code. A skill for Claude Code, Opencode and Codex.
skillgit
by vadbosh Aug 18, 2026 8/10
skill GitHub
An opinionated, testable AI code-review agent for GitLab: review policy as a skill, behavioral regression tests, external benchmark, sandboxed dev container, credential isolation, telemetry, and a ...
skillgitreview
by nathanfhh Aug 18, 2026 6/10
skill GitHub
Claude Code skill: build complete WordPress sites on the Greenshift block builder from a Figma/Paper design, entirely over the REST API — design tokens, pages, header/footer, accessibility, launch ...
skillapi
by thebusinesstoolkitdev Aug 18, 2026 8/10
skill GitHub
Multi-source academic literature search with explainable relevance ranking. A Claude Code skill: OpenAlex, arXiv, Crossref, Semantic Scholar, NBER. No API keys, no dependencies.
skillapi
by Seb-f-Johansson Aug 18, 2026 8/10
skill GitHub
Steve Polito's Agent Skills
skill
by stevepolitodesign Aug 18, 2026 6/10
skill GitHub
Portable, vendor-neutral engineering agent skills (SKILL.md) for AI coding agents: architecture, OWASP security, test strategy, release safety, SRE, compliance. MIT.
skill
by techfleetworks Aug 18, 2026 6/10
skill GitHub
Reasoning suite for coding agents: a scored meta-router plus nine reasoning-pattern skills (ToT, BoT, SRC, HE, AR, DR, AT, RTR, NDF) with parallel-execution and handover infrastructure — gauntlet-v...
skill
by kimasplund Aug 18, 2026 6/10
skill Reddit
Hi everyone, I would like to reduce the size of my context in order to have much better control over my agent and the results from it. How can I do it? Any ideas? ❯ /context ⎿ Context Usage ⛁ ⛁ ⛁ ⛁...
skill
by brunoadam_ Aug 18, 2026 7/10
skill GitHub
Agent Skills for vibe engineering — 71 evidence-grounded practitioner references as a Claude Code plugin marketplace
skill
by adammatthewsteinberger Aug 18, 2026 9/10
skill GitHub
jOOQ conventions for Kotlin/Spring — written as defaults and exceptions, not prohibitions. Every rule ships with its 'why' and 'when not'. Korean. Usable as a Claude Code skill.
skill
by logcat-io Aug 18, 2026 8/10
skill GitHub
亚马逊评论分析 Agent Skill:卖家精灵 Review 表 → 一/二/三级分类树(格子里是买家原话)→ HTML 看板 + 交付 Excel
skillreview
by CoderAndyLee Aug 18, 2026 6/10
skill GitHub
高星 Agent Skill repo 的共同點是「好裝」不是「寫得好」——97 個 repo 的星數梯度分析,附可執行的 skill-reviewer 品質審查工具
skillreview
by astroicers Aug 18, 2026 6/10
skill GitHub
A curated Claude Code plugin marketplace of reusable, self-improving skills and agents — each an independently versioned plugin.
skill
by alexmond Aug 18, 2026 9/10
skill GitHub
个人维护的 Agent / Claude Code Skills,覆盖开发规范、GitHub 工作流、阿里云部署与微信公众号工具。
skillgit
by sdwurg180507280211 Aug 18, 2026 9/10
skill GitHub
Two Claude Code skills for scientific manuscripts: deep pre-submission review and grounded drafting, on the Paper Assistant Tool architecture (arXiv:2606.28277).
skillreview
by whoisraibolt Aug 18, 2026 8/10
skill GitHub
面向电商视觉生产的 Agent 技能库:19 个可组合的 skill.md,覆盖平铺图 → 模特上身 → 换模特换背景 → 裂变套图 → 详情页 → 投前检测,统一通过 dLazy CLI 调用图像/文本模型,不用摄影棚、不约模特。
skill
by dlazyai Aug 18, 2026 6/10
skill Reddit
https://preview.redd.it/ho94ubu852kh1.png?width=1275&format=png&auto=webp&s=0338880ea8be49bdf2758dd63220ce7526e220df Context: this session started at "Task 8", because it filled the context with ta...
skillworkflowreview
by Physical-Average-184 Aug 18, 2026 8/10
skill GitHub
Behavioral-discipline skill turning an AI agent into a methodical, non-robotic bug-bounty & pentest hunter — 42 always-on rules: scope, coverage, no false positives, never quits early.
skill
by sanjarbiy Aug 18, 2026 6/10
skill GitHub
面向中文 Java/Spring 生态的 Agent Skills 套装:编码规范、质量门禁、单元测试、Sa-Token/MyBatis-Plus 框架、敏捷流程。支持 Claude Code 插件与 npx skills 一键安装。
skill
by BaixuanZhu Aug 18, 2026 9/10
skill GitHub
Just Another Agent skill repository.
skill
by n-n-code Aug 18, 2026 6/10
skill GitHub
Simon's personal Claude Code config: rules, hooks, guards, and skills, structured as a reusable template you fork and make your own.
skillhookconfig
by skowalskidev Aug 18, 2026 10/10
skill GitHub
Describe what you want in plain language; rsc installs only the agent skills that fit — one at a time, into 17 coding assistants. 264 skills, zero context bloat.
skill
by ericrisco Aug 18, 2026 6/10
skill GitHub
Claude Code 自定义技能合集 | Personal Claude Code agent skills
skill
by Wonham Aug 18, 2026 9/10
skill GitHub
Replace boring SaaS with a bunch of skills and have them self-update. Skills for Codex/Hermes etc. that marketers and front-end developers can reuse. Built by https://apnatva.dev and built with htt...
skill
by apnatvar Aug 18, 2026 5/10
skill GitHub
Agent-first Asana CLI with complete API coverage, read-only guards, Claude plugin, and Agent Skills
skillapi
by leighton-tidwell Aug 18, 2026 7/10
skill GitHub
Autonomous Agent Skill Creator & AST Security Evaluator (Agent Skills Spec 1.0 + NVIDIA SkillSpector). Zero-dependency bundle for Claude Code, Cursor, Antigravity, & Windsurf.
skill
by sarveshtalele Aug 18, 2026 9/10
skill GitHub
Signed GitLawb mirror next to GitHub. Unofficial companion CLI, Action, and Claude/Cursor skill.
skillgit
by DevOps21133 Aug 18, 2026 6/10
skill GitHub
Claude Code skill that explains things with one self-contained HTML page — requirement mockups for review, or full change reports of what a task actually changed. Python 3 stdlib only. 一页自包含 HTML 讲...
skillpythonreview
by ZonEaseTech Aug 18, 2026 8/10
skill GitHub
开源 AI 口播视频剪辑导演 Skill | Bilingual AI video director for talking-head editing, B-roll, captions and delivery.
skill
by yomage-ai Aug 18, 2026 5/10
skill GitHub
78 GTM skills for Claude Code — 7 GTM roles, 8 store loops, one shared setup skill. Lifecycle segmentation, deal scoring, creative direction, and more. Built by Intempt.
skill
by sidchaudhary Aug 18, 2026 9/10
skill GitHub
「快点下班」工作系统——面向脑力工作者的 35 个职场 Agent Skills(沟通汇报、会议、职业选择;非游戏/魔兽)。Workplace skills for Claude Code / Codex / ZCode / Kimi-CLI. Install: npx skills add dennydkt/xbskill -g --all
skill
by dennydkt Aug 18, 2026 9/10
skill GitHub
Open-source adversarial verification Agent Skill for Claude Code, OpenAI Codex, and Cursor. Make AI coding agents prove bug fixes, CI, logs, and deployments.
skill
by Pablo-aps Aug 18, 2026 9/10
skill GitHub
Claude Code skill that removes AI-generated writing tells from Slovak text and fixes typical Slovak language errors (bohemisms, anglicisms, diacritics, calques, AI clichés). Install via skills.sh.
skill
by kuzmany Aug 18, 2026 8/10
skill GitHub
Skills for apes like us, so we can do our jobs better and make our lives easier.
skill
by arpitbbhayani Aug 18, 2026 5/10
skill GitHub
Agent skill (Claude Code + Codex): generates self-contained interactive HTML docs for any project — infrastructure topology, AI/LLM workflow diagrams, and a usage guide.
skillworkflow
by bhargavaganti Aug 18, 2026 9/10
skill GitHub
Skill 开源就绪校验器:发布前检查 SKILL.md 结构、跨 agent 可移植性、隐私与许可证 | agent-agnostic, zero-dependency
skill
by TongyiDai Aug 18, 2026 6/10
skill GitHub
AI agent skills for IELTS Writing Task 1 & Task 2 review with DOCX comments, customizable target bands, and model answers.
skillreview
by AaronL725 Aug 18, 2026 6/10
skill GitHub
如来 · rulai — 让任何 AI Agent 用佛学作透镜,看清任何一件事的本质。A Buddhist-framework Agent Skill.
skill
by TongyiDai Aug 18, 2026 6/10
skill Reddit
I have 4 Claude accounts all on the Max 20 plan. Over the last 4 weeks I have noticed a slow and steady reduction in quality to the point they are no longer usable. I have a lot of experience in De...
skillapireview
by Appropriate-Fox-2347 Aug 18, 2026 7/10
skill GitHub
Portable Agent Skill for safe Stream Deck profile customization.
skill
by TomGranot Aug 18, 2026 6/10
skill GitHub
Software adoption engineering tools for Claude Code. Audit whether your API, SDK, and docs are usable by developers and AI agents.
skillapi
by agentrel Aug 18, 2026 9/10
skill GitHub
λ — Learner-Adaptive, Marks-Bound Drilling Agent. Agent skills that probe, teach, and drill from your own course PDFs.
skill
by abaj8494 Aug 18, 2026 6/10
skill GitHub
AI agent skill (Claude Code) for Riftbound: deckbuilding + gameplay methodology, a generalized regional-legality model, and a bundled English card dataset. Unofficial fan project.
skill
by Zaious Aug 18, 2026 9/10
skill GitHub
Agent skill that turns a repo into a multi-model agent team: cheap models implement, strong models plan and review, a human approves the plan. Works with jcode, Claude Code, opencode, codex, pi and...
skillreview
by Bilel-Gharbi Aug 18, 2026 10/10
skill GitHub
The skill layer for AI agents: npm for AI Agent Skills.
skill
by Leon-Drq Aug 18, 2026 6/10
skill GitHub
High-reliability prompt engineering skill for Manus AI engineering and release workflows.
skillworkflow
by JesseRaber Aug 18, 2026 5/10
skill Reddit
They finally added the ability to compact and bring up custom skills on remote control. Does anyone have any idea what took so long? For compacting in particular, it’s something I reach for all the...
skill
by Odd_Antelope9098 Aug 18, 2026 5/10
skill GitHub
General-purpose AI agent definitions, reusable skills, and registry tooling
skill
by stevencarpenter Aug 18, 2026 6/10
skill GitHub
An agent skill that rewrites text to remove the giveaways of AI-generated writing. Drops into a Claude Code project as a skill so editing passes can be invoked mid-session rather than through a separate tool. One of several humanizer skills in circulation, so worth comparing against alternatives before adopting.
skillwritinghumanizerediting
by blader Aug 18, 2026 6/10
skill GitHub
A Claude Code skill that generates and verifies book source JSON files for the Legado (阅读) reader app. It handles the schema and validation loop so you do not hand-write and debug the config. Also works with Codex and other agents; niche, but a clean example of a schema-generation skill.
skilljsonlegadovalidation
by Narylr350 Aug 18, 2026 5/10
skill GitHub
A Claude Code plugin bundling "walk" Skills, walk-observer audit hooks, and an accompanying guide MCP server. The three pieces together let the agent follow a documented procedure while the hooks record whether it actually did. Packaged as one installable plugin rather than loose files.
pluginskillshooksmcpaudit
by agentguides Aug 18, 2026 6/10
skill GitHub
The skill set behind the Odin agent harness: decision scoring, roadmap planning, blueprint decomposition, mistake-to-gate hardening, and interface polish. Each is a discrete planning-oriented skill rather than a code-writing one. Worth a look if your agent is fine at coding but weak at deciding what to build.
skillsplanningdecision-makingroadmap
by RubyEyedReaper Aug 18, 2026 5/10
skill GitHub
A collection of Agent Skills covering product research, market intelligence, and content production for AI-native teams. They point Claude Code at business-side work instead of the usual engineering tasks. Handy if you want the same agent handling competitive research and drafting.
skillsresearchmarket-intelligencecontent
by Studio-Moser Aug 18, 2026 5/10
skill GitHub
A Claude Code skill plus a zero-key CLI for querying patent landscapes, assignee leaderboards, and filing trends in plain language. It returns measured answers backed by real data rather than model recollection. No API key needed to run the CLI.
skillpatentsresearchcli
by kevin9327 Aug 18, 2026 6/10
skill GitHub
A Claude Code and Codex skill that picks a destination before building an itinerary: it hard-filters candidates, then scores them. Every fare, timetable, and entry rule is checked against a live source rather than recalled from the model. Output is a self-contained booking-ready HTML plan with per-segment maps and a sourced per-person budget, all stored locally.
skilltravelresearchhtml-output
by dong845 Aug 17, 2026 6/10
skill GitHub
A collection of 124 specialist agents aligned to the Anthropic Agent Skills spec, working across Claude Code, Codex CLI, and Antigravity CLI. Coverage spans development, security, design, testing, FinOps, compliance, observability, and AI/ML. Agents are wired for hub-and-spoke orchestration through a Nexus dispatcher rather than being invoked one at a time.
skillssubagentsorchestrationcollection
by simota Aug 17, 2026 7/10
skill GitHub
Two Agent Skills built around a launch-line metaphor: one generates the test cases that prove a change is ready, including mutation self-checks, and the other runs a pre-deploy smoke test and blocks deployment when it fails. Browser capability is detected automatically with four levels of graceful degradation. Documentation is in Chinese.
skilltestingsmoke-testdeployment
by ai798-Lab Aug 17, 2026 5/10
skill GitHub
A set of Agent Skills covering documentation generation, fleet orchestration, and parallel task execution. It targets a broad compatibility surface — Claude Code, Cursor, Copilot, Gemini CLI, Codex, and 25 or more other agents. Useful if you want orchestration primitives that are not locked to one vendor.
skillsorchestrationdocumentationcross-tool
by quickcall-dev Aug 17, 2026 6/10
skill GitHub
A coding skill that reduces token usage by pushing the agent to write less code, less prose, and denser agent-to-agent handoffs. The authors report a 53% reduction that was lossless in their benchmarks. It works across Claude Code, Cursor, GitHub Copilot, Codex, Gemini CLI, Windsurf, Cline, and Kiro.
skilltokenscostcross-tool
by Green-PT Aug 17, 2026 7/10
skill GitHub
A frontend and web design skill that walks an agent from research through art direction, architecture, and design tokens to a verified build. The target problem is the sameness of AI-generated interfaces, which it attacks by forcing explicit art direction before any code. Works with AI coding agents generally, not just Claude Code.
skillfrontenddesignart-direction
by AviOfLagos Aug 17, 2026 7/10
skill GitHub
Packages the Apple Human Interface Guidelines and Apple Design System into a skill any AI coding agent can load. Supports Claude Code, Cursor, Copilot, Antigravity, and Windsurf. Gives the agent concrete platform conventions instead of a generic idea of what an Apple app looks like.
skilldesignapplehig
by billythekidz Aug 17, 2026 7/10
skill GitHub
Two Agent Skills that push back before work starts: Requirement Zero challenges whether a requirement should be built at all, and Codebase Zero audits whether existing code still deserves to exist. Both are Markdown-only with no runtime dependencies. The repo publishes its evaluation runs so you can judge the skills before installing them.
skillrequirementsauditcode-review
by Chisanan232 Aug 17, 2026 7/10
skill GitHub
A plugin for building, validating, securing, and maintaining Claude Skills that positions itself as superseding the shipped skill-creator. It emphasizes spec compliance and security-hardened tooling rather than just scaffolding a directory. Relevant if you author skills often enough that correctness of the skill itself matters.
skilltoolingvalidationsecurity
by EONRaider Aug 17, 2026 8/10
skill GitHub
Agent Skills that carry you from "I want to contribute to open source" through to a submitted pull request. The distinguishing piece is that it measures whether a repo actually merges outside PRs before recommending you spend effort there. Avoids the common failure of contributing to projects that never merge external work.
skillopen-sourcepull-requestcontribution
by chjnett Aug 17, 2026 7/10
skill GitHub
An Agent Skill for organizing local folders where every action is reversible and gated behind explicit approval. It works with Codex, Claude Code, and Google Antigravity. The safety framing is the point — letting an agent move your files is otherwise hard to undo.
skillfilessafetyautomation
by Evan645test Aug 17, 2026 5/10
skill GitHub
A set of Claude Code skills for autonomous development: task loops, testing, and deployment automation. It targets the case where you want the agent to keep working through a queue rather than stopping after each step. Fairly broad in scope, so expect to tune it to your project.
skillautomationtestingdeployment
by djnsty23 Aug 17, 2026 5/10
skill Reddit
A short, fully published skill file that reworks a change as if the intended UX and architecture had existed from day one, deleting compatibility cruft and accidental complexity. It counters the agent default of patching instead of redesigning, keeping dead "for compatibility" code, and duplicating logic across files. The author runs it right after fixing a bug or shipping a feature, while the agent still has full context.
skillrefactoringtech-debtclaude-md
by Electrical_Pea_943 Aug 17, 2026 7/10
skill GitHub
A portable marketing strategy skill pack with 12 council roles and 13 focused skills, plus evidence challenge gates that force claims to be backed. It also includes deterministic utilities so the numeric parts do not depend on model recall. An example of a domain skill pack structured as a debate among roles rather than one prompt.
skillmarketingstrategyskill-pack
by imMamdouhaboammar Aug 17, 2026 5/10
skill GitHub
A Claude Code skill that treats your code lifecycles as systems and looks for structural faults: states the code can reach but cannot represent, operators that have no inverse, and rules the README declares that the code breaks. This is a different lens from ordinary code review, which mostly checks lines rather than reachable states. Good fit for state machines and long-lived entities.
skillauditstate-machinesarchitecture
by gdavidpb Aug 17, 2026 7/10
skill GitHub
Two AI skills for French law — an accountant and a lawyer — covering both business and personal matters. The design rule is that no figure is ever written from memory: everything is sourced and dated. A useful pattern for any domain skill where stale numbers are worse than no numbers.
skilllegalaccountingfrench
by Sjrazaviebra Aug 17, 2026 5/10
skill GitHub
A frontend Agent Skill for planning, building, and reviewing production Next.js and TypeScript frontends against a typed Django/DRF backend contract. Accessibility, security, and performance checks are blocking gates rather than advisory notes. Opinionated about the stack, which is what makes the gates concrete.
skillfrontendnextjsaccessibilitydjango
by n-shadloo Aug 17, 2026 6/10
skill GitHub
An Agent Skill that converts AI-generated video into 2D game sprite sheets, using the Mortal Kombat approach of filming an actor — here MiniMax H3 plays the actor. It bridges video generation and usable game assets, which normally requires manual frame extraction. Novel enough to be worth a look even outside game development.
skillgamedevspritesvideo
by gary149 Aug 17, 2026 6/10
skill Reddit
Both Opus 5 and Sonnet 5 tend to document what changed rather than what the code now is, which rots instantly on a fast-moving codebase. The author addresses it with a CLAUDE.md section banning version-comparison framing — "used to", "no longer", "previously", "before this change", "renamed from" — and requiring present-state description in markdown, docstrings, code comments, and test docstrings alike. A concrete, copyable convention for anyone with the same complaint.
claude-mddocumentationpromptingconventions
by Stonemanner Aug 17, 2026 7/10
skill Reddit
A pnpm workspace case where a schema package generates a file a worker imports, but the root test command never rebuilds the schema — so the broken import only shows up in one specific command pair. Since the rule belongs to the package rather than to one person workflow, the author puts the two commands in a package-level CLAUDE.md next to the reason. A small but useful pattern for scoping instructions in a monorepo.
claude-mdmonorepopnpmconventions
by Aggravating-Dot4839 Aug 17, 2026 5/10
skill GitHub
A Claude Code skill that acts as a pre-handoff QA gate on ecommerce design files, checking state coverage for product detail pages, cart, and checkout. It catches the states designers routinely omit — empty, error, loading — before files reach engineering. Narrow in scope but a clear example of a skill as a review gate.
skillqadesignecommerce
by llizell Aug 17, 2026 5/10
skill GitHub
A router for setups with too many installed agent skills, built to answer "which skill applies here" deterministically. Instead of returning a list of plausible skill names for the model to pick from, it returns an ordered chain with the arbitration between overlapping skills already resolved. Worth a look if skill collisions and inconsistent skill selection have become a problem in your setup.
skillsrouterskill-selectionarbitration
by whichskill Aug 16, 2026 7/10
skill GitHub
A Claude Code skill that lets the model actually digest a local video file by transcribing its audio and exporting keyframes for reading. That turns an opaque media file into text and images the model can reason over, without any external video-understanding service. Handy for reviewing screen recordings, QA captures, and demo footage in-session.
skillvideotranscriptionkeyframesmultimodalqa
by ShreddyKrueger75 Aug 16, 2026 7/10
skill GitHub
A skill that walks you through producing your own personal brand identity manual, covering positioning, voice, and visual guidelines. Works in both Spanish and English. Aimed at people who want a structured interview-style process rather than a blank document.
brandingskillspanishbilingualwriting
by Carlos-Padilla-Bravo Aug 16, 2026 5/10
skill GitHub
A Claude Code skill that scrapes a Telegram channel into SQLite, then answers analytics questions over that local database and schedules future posts. Turns channel history into something you can query conversationally instead of scrolling. Useful pattern for anyone wanting agent-driven analytics over a social feed.
telegramsqliteanalyticsschedulingskill
by Lancetnik Aug 16, 2026 6/10
skill GitHub
A set of skills covering the day-to-day of a French RSSI/CISO: asset mapping, EBIOS RM risk analysis, compliance work, and review of deliverables. Design constraints are explicit — sources are mandated, facts are kept separate from claims, and the final decision stays with a human. A good example of a domain skill pack with built-in epistemic guardrails.
securitycomplianceebios-rmfrenchciso
by maogouste Aug 16, 2026 5/10
skill GitHub
A Claude Code skill that reads an Excel workbook and produces a Word report containing charts plus a factual written description of each one. Documentation is in Portuguese. Handy for recurring reporting work where the analysis is routine but the formatting is tedious.
excelwordreportingchartsportuguese
by Vascobranco2509 Aug 16, 2026 5/10
skill GitHub
A Claude Agent Skill for differential diagnosis, GRADE evidence appraisal, a 13-perspective clinical board review, and treatment planning. Every citation is resolved and checked for retraction, and output carries calibrated confidence with a traceable chain. Bilingual EN/ES and explicitly scoped to decision-support drafts, never a diagnosis.
clinicalmedicalevidencecitationsbilingual
by makidav Aug 16, 2026 7/10
skill GitHub
A CLI and companion skill that reads whole books and documents, then writes a SKILL.md targeting Claude Code, Codex, Gemini CLI, Cursor, or opencode. Handles PDF, EPUB, DOCX, and slide decks. A practical answer to having reference material you want an agent to internalize rather than re-read every session.
skillspdfepubdocumentscross-tool
by asale-ai Aug 16, 2026 8/10
skill Reddit
Three open-source skills covering backend setup, security hardening, and frontend/UI, installable with npx skills add. The stated rule is no fake credentials, placeholder content, or 'fixed' reports: if the skill cannot do something for real it stops. MIT licensed.
skillmitsecuritybackend
by MonitorFlat4465 Aug 15, 2026 5/10
skill GitHub
A Claude Code skill bundling 16 source-verified reference files for the s&box game engine API, alongside an 11-tool MCP toolset for driving the editor. The stated goal is to stop agents from writing Unity-style code into Source 2 projects. Niche, but a good template for pinning an agent to one engine's real API.
skillmcpgamedevsbox
by fobiat Aug 15, 2026 5/10
skill GitHub
A Claude Code skill that inspects your other installed skills and reports which ones are stale, overlapping, or contradicting each other. Useful once a skills directory grows past the point where you remember what is in it. Addresses a maintenance problem most skill collections ignore.
skillauditmaintenancemeta
by shimo4228 Aug 15, 2026 7/10
skill GitHub
A set of nine ready-to-use Agent Skills addressing recurring agent behaviors: claiming false completion, deflecting blame, over-engineering small tasks, and writing documentation nobody can read. Bilingual Chinese/English. Behavioral corrections rather than new capabilities.
skillbehaviorqualitychinese
by zhaiby-web Aug 15, 2026 6/10
skill GitHub
An agent skill plus CLI that measures vocabulary level and sentence length, then points at the specific words and sentences to fix. Zero dependencies. Useful against the dense, abstract prose recent models tend to produce.
skillwritingreadabilitycli
by zhangxiangliang Aug 15, 2026 5/10
skill GitHub
A reusable CLAUDE.md template of 11 operational rules meant to carry across projects. Written in Chinese and focused on hard constraints rather than style guidance. Worth skimming if you are still tuning your own baseline instructions.
claude-mdtemplateruleschinese
by evan966890 Aug 15, 2026 5/10
skill GitHub
A Claude Code skill that interviews you about your repo or team and recommends which AI skills to install, then installs them in one prompt. Aimed at the discovery problem now that skill collections number in the thousands. Complements audit tools like skill-stocktake.
skilldiscoveryrecommendationonboarding
by lindblomstefan Aug 15, 2026 5/10
skill GitHub
A Russian-language set of Claude Code skills covering orchestration, motion, quality, and SEO for building websites. Splits the work into distinct specialist roles rather than one generic build prompt. Useful reference even if you do not read Russian.
skillweb-designseorussian
by Yelpin Aug 15, 2026 5/10
skill GitHub
Context-aware marketing skills for Claude Code, with separate playbooks for B2B, industrial, regulated, and consumer markets. The segmentation matters because generic marketing prompts produce generic copy. Handy for solo builders doing their own go-to-market.
skillmarketingplaybooksb2b
by marcus-at-localhost Aug 15, 2026 5/10
skill GitHub
Portable Agent Skills covering web experience design and software engineering, written to cite evidence rather than assert preferences. Works across Agent-Skills-compatible tools. Worth a look if you want design guidance your agent can justify.
skilldesignengineeringportable
by makiaveli1 Aug 15, 2026 5/10
skill GitHub
Pushes agents toward the best real result with the least code, fewest tokens, and lowest risk. A counterweight to agents that answer a small request with a large refactor. Fits alongside rules that constrain scope creep.
skilldisciplineminimalismtokens
by tuamah Aug 15, 2026 5/10
skill GitHub
A Claude Code skill enforcing a read-before-write discipline, and when the agent does clobber something it pays the debt back in work rather than apologies. Targets the destructive-overwrite failure mode directly. Small in scope but addresses a genuinely costly behavior.
skillsafetyoverwritediscipline
by OFFERSHAHAR Aug 15, 2026 5/10
skill GitHub
Puts coding agents into a Go performance mindset, steering generated code toward faster idioms. Language-specific tuning of agent behavior rather than general guidance. Relevant if your agent writes correct but slow Go.
skillgolangperformanceoptimization
by hendriknielaender Aug 15, 2026 5/10
skill GitHub
A comprehensive skill for beads (bd), the Dolt-backed dependency-aware issue tracker built for AI coding agents. Version-pinned, so the skill will not drift out of sync with the tool. Good example of pinning a skill to a specific tool release.
skillissue-trackerbeadsversion-pinned
by mikezupper Aug 15, 2026 6/10
skill Reddit
A reported finding that renaming a CLAUDE.md section from 'STRICT RULES - MUST FOLLOW' with NEVER/ALWAYS caps to a conversational 'House rules' list improved adherence deep into long sessions. The author's take is that shouted constraints drift once context fills, while normal prose does not read as noise. Anecdotal but cheap to test on your own config.
claude-mdpromptingrulescontext
by Necessary_Abroad6632 Aug 15, 2026 6/10
skill GitHub
A cross-agent skill for Claude Code and Codex that authors, converts, and validates Markdown in Open Knowledge Format. Validation is the useful half, catching format drift before it spreads. Relevant if you maintain structured knowledge bases agents read from.
skillmarkdownvalidationknowledge
by parkscloud Aug 15, 2026 5/10
skill GitHub
An open-standard skill plus CLI that lets Claude Code, Cursor, Codex, and other agent sessions communicate, on one machine or across machines. Turns separate sessions into something closer to a group. The open-standard framing is what makes it interesting beyond a single-vendor hack.
skillinter-agentcommunicationcli
by 1gr14 Aug 15, 2026 6/10
skill GitHub
A daily-refreshed index of over 1,600 GitHub skill sources ranked by stars, with verified SKILL.md files and 40 directly installable skills for Codex and Claude Code. The verification step separates it from a plain awesome-list. A reasonable first stop when hunting for an existing skill.
skillindexdirectorydiscovery
by userInner Aug 15, 2026 6/10
skill GitHub
A Claude Code output style borrowing two habits from Martha Wells' SecUnit: no scope creep, and verify before you assert. Delivers action first with no ceremony in a dry voice. The personality is the hook, but the two constraints are the substance.
output-styleverificationscopepersonality
by stepnovmi Aug 15, 2026 6/10
skill Reddit
Reviews error messages, toasts, alerts, 404s, offline screens, empty states, and permission errors against five questions: clarity, reassurance, empathy, action, and escape route. Built because agents default to 'Something went wrong' and move on. A concrete rubric rather than vague guidance about tone.
skilluxerror-handlingcopy
by Nervous_Comparison84 Aug 15, 2026 7/10
skill GitHub
A personal set of process-oriented skills, installable with npx skills add or as a Claude Code plugin. Focuses on changing agent working method rather than adding domain knowledge. The dual install path makes them easy to try.
skillprocesspluginnpx
by maxgfr Aug 15, 2026 5/10
skill GitHub
A Claude Code skill, API, and MCP server acting as a mentor for embedded and IoT hardware projects, covering MCU selection, cost and time estimates, MVP-first build plans, and PCB transition guidance. Hardware domain knowledge is thin on the ground in agent skills. Useful if your software agent has to reason about physical constraints.
skillembeddediothardware
by mh-mansouri Aug 15, 2026 5/10
skill GitHub
Spec-first skills for Claude Code that refine a vague idea into a technical specification precise enough to implement from. Front-loads the ambiguity instead of discovering it mid-build. A lighter alternative to full spec-driven frameworks.
skillspecsplanningspec-first
by DahanItamar Aug 15, 2026 6/10
skill GitHub
Drives iterative reverse engineering sessions in Ghidra from Claude Code. Reverse engineering suits agents well because it is repetitive analysis over a large binary. One of the few security-research skills in this space.
skillreverse-engineeringghidrasecurity
by GeReV Aug 15, 2026 7/10
skill GitHub
A Claude Code skill for working with Apache NiFi 2.x, MiNiFi, and EFM data flows. Covers building, deploying, and debugging flows rather than only generating config snippets. Niche, but a clean example of packaging domain-specific ops knowledge as a skill.
nifidata-engineeringdevopsskill
by cldr-steven-matison Aug 15, 2026 6/10
skill GitHub
Twenty-four open-source agent skills that translate design taste into explicit instructions, organized as ten genre identities. Each identity ships a before/after demo built from the same brief, so you can see exactly what the skill changes. A concrete answer to the complaint that agent-generated UI all looks the same.
designuiskillsfrontend
by madebymustafa Aug 15, 2026 7/10
skill GitHub
A /test-audit slash command that reviews the tests covering AI-written code and returns a verdict in plain language instead of a coverage percentage. Aimed at people shipping code they did not hand-write and cannot easily judge. Low ceremony: one command, one answer.
testingslash-commandcode-qualityvibe-coding
by gtskevin Aug 15, 2026 6/10
skill GitHub
A personal collection of agent skills, slash commands, design examples, and project templates written to work with Claude Code and most other harnesses. Useful as a reference for structuring your own dotfiles-style agent config. Note that two unrelated projects also use the dotagents name.
skillscommandstemplatesdotfiles
by thefilesareinthecomputer Aug 15, 2026 6/10
skill Reddit
Claude Code auto-loads skills only from ~/.claude/skills/, which breaks when shared skills live in ~/.agents/skills/ for other agents. Rather than copying, symlinking, or running an rsync daemon to keep both in sync, the post notes that a skill is just a folder with a SKILL.md — so you can tell Claude to read it at its absolute path mid-conversation. Avoids duplicate copies and the ambiguity of which one actually loads.
skillstechniqueno-installmulti-agent
by Annual_Variation_916 Aug 15, 2026 6/10
skill GitHub
A skill that takes a start and end point and generates a self-contained HTML file letting you walk the route across Tokyo's PLATEAU 3D city model. No routing API and no tile server needed — everything ships inside the one file. Documentation is in Japanese; a strong demo of how much a single skill can carry.
3dmapshtmlplateaujapanese
by kofujimura Aug 15, 2026 6/10
skill GitHub
An agent skill for Claude Code and Codex that copy-edits open-source prose — READMEs, docs, announcements — under the constraint of preserving factual claims and the author's voice. Includes zh-Hant-TW support. Targets the common failure where an LLM rewrite flattens tone and quietly changes facts.
documentationwritingreadmei18n
by ting-hong-shieh Aug 15, 2026 6/10
skill Reddit
Ranked remedies for over-long Claude Code replies, from weakest to strongest. The key insight is that abstract instructions like 'be concise' barely register, while rules that specify output shape do: lead with the answer, carry multi-item results in tables or bullets, cap unbroken prose at two paragraphs. Output styles beat CLAUDE.md because they modify the system prompt directly instead of riding in as a user message.
claude-mdoutput-styleverbositypromptingopus-5
by cleverhoods Aug 14, 2026 7/10
skill GitHub
When an agent has eight clarifying questions, it normally asks them one at a time across a long chat. This renders them together in a local, dependency-free web form with the tradeoffs shown next to each choice, so you answer once with full context. Includes a Claude Code skill for wiring it in.
clarificationuxformsskill
by avanrossum Aug 14, 2026 7/10
skill Reddit
A dependency-free SKILL.md run at the end of every session. It demands an honest review citing specific corrections from the actual conversation, then routes at most three lessons by type: context gaps go to the memory file, recurring procedures become skills, and hard always/never constraints become rule files or deterministic hooks. The routing is the point, since enforcement beats instructions.
retrospectiveskillruleshookslearning
by Anti17 Aug 14, 2026 7/10
skill GitHub
Addresses Claude Code rebuilding code that already exists and retrying approaches that already failed. Anchor writes down only claims it can verify, drops a note the moment the code it describes changes, and retires instruction files superseded by newer ones. The self-invalidation is what separates it from a memory file that quietly rots into misinformation.
memorycontextsession-continuitystaleness
by alrox360 Aug 14, 2026 7/10
skill GitHub
Runs a codebase audit before every deploy across 14 categories: leaked secrets, XSS, SQL injection, rate limiting, test coverage, bundle size, WCAG accessibility, SEO, Stripe webhooks, and GDPR among them. Works entirely from source, so no staging URL is needed. A reasonable last gate for solo developers shipping without a review process.
securityauditpre-deployaccessibilityskill
by Capta1nRaj Aug 14, 2026 7/10
skill GitHub
A skill for Claude Code and Codex that governs where a change should land in a large full-stack codebase. It helps the agent find the correct capability boundary, avoid re-implementing something that already exists, and respect write constraints on protected areas. Useful if your agent keeps creating duplicate helpers instead of extending existing ones.
skillmonorepocode-reusecodexgovernance
by WeirdSky924 Aug 14, 2026 6/10
skill GitHub
A large plug-and-play skill pack covering product management: 30 Triple Diamond phase skills, 11 foundation, 12 utility, and 15 tool skills including Foundation Sprint and Design Sprint. Ships with 6 sub-agents, workflows, 200+ sample outputs, and CI-enforced contracts so the skills stay consistent. Apache 2.0.
skillproduct-managementsubagentsworkflowapache-2.0
by product-on-purpose Aug 14, 2026 7/10
skill GitHub
A collection of reusable agent resources meant to be shared across both Codex and Claude Code, with an emphasis on safety-conscious defaults. Useful as a starting point if you work in both tools and want one set of conventions instead of two. Generic in scope — worth a skim rather than a wholesale adoption.
skillcodexsafetyshared-configportable
by kimgea Aug 14, 2026 5/10
skill GitHub
A linter and Claude skill that works on the text on both sides of the model. On input it flags the ambiguity a model will quietly guess its way through; on output it catches invisible watermark characters, machine rhythm, and other AI tells. Supports English and Chinese.
skilllinterprompt-engineeringwritingwatermark
by ryvn-dev Aug 14, 2026 7/10
skill GitHub
A copywriting workflow that requires every factual claim in marketing copy to be traced back to a fetched source before publishing, with adversarial checks to catch unsupported statements. Aimed at teams who want agent-written copy that will not invent specs, numbers, or customer results.
copywritingmarketingverificationfact-checkingskill
by mucinous-riposte867 Aug 14, 2026 6/10
skill GitHub
A Korean-language bundle of four Claude Code skills covering the whole AI short-drama pipeline: script, per-cut prompts, video generation, then QC and assembly. Distributed through the Hamlog marketplace. Worth a look as a template for chaining several skills across a multi-stage creative workflow.
skillvideopipelinekorean
by uyuni0217sh-design Aug 14, 2026 5/10
skill GitHub
A Chinese-language writing skill that packages influencer strategy, natural-sounding phrasing, and systematic headline A/B testing into one Claude Code skill. Aimed at content creators rather than developers. A concrete example of encoding an editorial methodology as a skill.
skillwritingcontentchinese
by tanchunzhuo Aug 14, 2026 5/10
skill GitHub
A memory skill for AI agents that grounds recall in actual sources via an LWC Wiki, document graphs, and CodeGraph. The goal is durable project memory that does not drift from the code. Pairs with the author's llm-wiki-cli for the CLI side.
skillmemoryknowledge-graphcontext
by JanYork Aug 14, 2026 6/10
skill Reddit
A practitioner writeup on skill authoring after building fifteen of them. Key findings: the description field does nearly all the triggering work, vague descriptions never fire, and happy-path instructions in the body are wasted since the model would do that anyway. Includes the mistakes the author had to unlearn.
skillauthoringlessonsreddit
by Wilddocofficial Aug 14, 2026 8/10
skill GitHub
A small but growing Claude Code plugin marketplace where each plugin is self-contained and versioned on its own. Install only what you need rather than a monolithic bundle. Good example of the modular end of the marketplace spectrum.
marketplacepluginsskillsmodular
by nthansen Aug 14, 2026 6/10
skill GitHub
A curated skill collection covering a code-review loop, local chat-history search, session end and resume, Gemini image generation, and transcript retrospectives. Everything runs machine-wide with only Python and Node as prerequisites. A solid starting set if you are building a personal skill library.
skillscode-reviewsessionscollection
by BryceEWatson Aug 14, 2026 7/10
skill GitHub
Puts Claude Code into plain-language mode so people without a dev background can still ship real products. Strips jargon out of explanations and prompts. Aimed squarely at the vibe-coding crowd.
skillaccessibilityplain-languagebeginners
by mkt-henry Aug 14, 2026 6/10
skill GitHub
Turns official writing frameworks (plain language, business writing, GOV.UK, AP style, STE-100, developer docs) into procedural agent skills, plus a set of character voices. Ships as Agent Plugins 1.0.0 and works in opencode, Claude Code, and Codex. Better than pasting a style guide into every prompt.
skillwritingstyle-guidedocs
by surendranb Aug 14, 2026 6/10
skill GitHub
An evidence-first research-report skill for Claude Code and Codex that works under a bounded search budget and verifies citations deterministically. Stops the agent from spending unbounded time searching or fabricating sources. Good fit for reports that need to survive scrutiny.
skillresearchcitationsevidence
by royalskynet Aug 14, 2026 6/10
skill GitHub
Runs code through a multi-agent pass to reconstruct the specification it implements. Works with Claude Code, Codex, OpenCode, Copilot, and Cursor. Useful for inherited codebases where no written spec ever existed.
skillspecreverse-engineeringmulti-agent
by nekolife1984 Aug 14, 2026 6/10
skill GitHub
A general-purpose collection of Claude Code skills aimed at everyday software development tasks. No single specialty, just a working set to borrow from. Worth browsing when assembling your own library.
skillscollectiondevelopment
by WahyuS002 Aug 14, 2026 5/10
skill GitHub
Agent skills built from the workflows the author ran often enough that re-explaining them became the bottleneck. That origin story is the strongest signal for which workflows are worth packaging. A practical reference for choosing what to turn into a skill.
skillsworkflowautomationcollection
by shiarauzo Aug 14, 2026 5/10
skill GitHub
A Claude Agent Skill that converts any dataset into a self-contained HTML dashboard or report with interactive SVG charts. Zero dependencies and works offline, so the output is a single shareable file. Ships as a Claude Code plugin.
skilldashboardchartsvisualization
by raghuramsirigiri Aug 14, 2026 7/10
skill GitHub
Repackages the WorkBuddy expert-team skills as a DeepSeek Harness plugin: 44 multi-role SKILL.md bundles installable to ~/.dsh/skills with Cordis plugin registration. Shows how a Claude-style skill collection ports to another harness. Bilingual documentation.
skillsdshportmulti-role
by darker2016 Aug 14, 2026 5/10
skill GitHub
A curated list of useful Agent Skills for Claude Code, Codex, Gemini CLI, OpenClaw, Hermes, and other agents. Useful as a discovery index rather than something you install. Handy when you want to see what already exists before writing your own.
awesome-listskillsdiscoverycurated
by zients Aug 14, 2026 6/10
skill GitHub
AI skills that encode Laravel conventions and standards so agents write framework-idiomatic code. Narrow by design. Useful template if you want to do the same for another framework.
skilllaravelphpstandards
by jotafurtado Aug 14, 2026 5/10
skill GitHub
A research and writing assistant for long-form deep research reports that runs the whole pipeline from a single prompt and emits a formatted PDF. Chinese-language. Useful if your deliverable is a document rather than code.
skillresearchpdfchinese
by Jiaranbb Aug 14, 2026 5/10
skill Reddit
Two Claude Code skills in one: redesign-studio produces three or four distinct design directions, and impeccable checks each output against real design standards. Both ask whether the pattern already exists or a native element would do before generating anything. Outputs HTML files, a compare page, and notes -- an ideation tool, not a production pipeline.
skilldesignuiideation
by for_blues_ Aug 14, 2026 7/10
skill GitHub
A bilingual skill suite for Twitter/X automation powered by ThreadWave, with a review gate before anything is published. The gate matters: unattended posting is how accounts get flagged. Relevant if you run social automation from an agent.
skilltwitterautomationreview-gate
by ohmyskyhigh Aug 14, 2026 5/10
skill GitHub
Packages PaddleOCR text recognition and document parsing as agent skills. Lets an agent read scanned documents without you wiring the OCR pipeline yourself. Bilingual documentation.
skillocrdocumentspaddleocr
by Aidenwu0209 Aug 14, 2026 6/10
skill GitHub
A working Claude Code configuration published whole: 156 skills, 6 hooks, a conductor routing pattern, and an auto-dedupe watcher. Value is in seeing how the pieces fit at scale rather than installing all of it. The routing pattern is the most transferable part.
configskillshooksrouting
by bertbertov Aug 14, 2026 7/10
skill GitHub
All 101 skills behind the author's Claude Code second brain, plus a working CRM engine, vault templates, and a handover map. Ships the method rather than the personal data. Substantial starting point if you want agent-managed personal knowledge.
skillssecond-brainknowledgecrm
by tonydzi Aug 14, 2026 6/10
skill GitHub
A Claude Code plugin that plans a gated milestone ladder for your own project idea, then drafts atomic step files explaining every action at the point it happens. Aimed at learning while building rather than getting handed a finished repo. Good for onboarding onto unfamiliar stacks.
pluginlearningmilestonesguide
by tomthebearded Aug 14, 2026 6/10
skill GitHub
Claude Code plugins where cue-dev writes the requirement, design, rejected alternatives, and outcome next to the code they produced, so any line traces back to its reasoning. Attacks the biggest gap in agent-written code: nobody remembers why. Lightweight compared to full ADR processes.
plugindocumentationtraceabilitydecisions
by FrogBaek Aug 14, 2026 6/10
skill GitHub
An agent skill that plays the role of a junior lab mate: literature research, experiment design, figure production, and paper reading, delivering files rather than chat. Results are meant to be cross-verifiable and it has no dependencies. Aimed at academic workflows.
skillresearchacademicfigures
by IcyCreamDAS Aug 14, 2026 5/10
skill GitHub
A Claude Code plugin marketplace for discovering and installing skills, commands, and agent configurations. Another entry in a crowded category. Browse before installing to see whether the catalog overlaps what you already run.
marketplacepluginsskillscommands
by epicsagas Aug 14, 2026 5/10
skill GitHub
Shared agent skills for Reoclo tooling, written as reference guides that Claude Code and other skill-aware agents load on demand. Vendor-specific but a clean example of the load-when-needed pattern. Small footprint until invoked.
skillsreferenceon-demandshared
by reoclo Aug 14, 2026 5/10
skill GitHub
A distributable skill collection for Codex, Claude Code, and similar agents: screenshot to Markdown, video and audio transcription, pre-publish risk checks for Xiaohongshu, and evidence-based gift selection. An unusually eclectic mix. Chinese-language documentation.
skillsocrtranscriptionchinese
by BambooXiu Aug 14, 2026 5/10
skill GitHub
Converts arbitrary content into a visual explanation: whiteboard, infographic, presentation, diagram, mind map, or UI mockup. Installs as a skill into AI coding assistants. Useful when the deliverable is a picture rather than prose.
skillvisualizationdiagramsinfographics
by dapih Aug 14, 2026 6/10
skill GitHub
A retrospective skill that asks seven questions after you ship, built around confidence, blind spots, and decay. Structured enough to run every time without becoming a chore. Pairs well with the same author's other review skills.
skillretrospectivereviewreflection
by robcsaszar Aug 14, 2026 6/10
skill GitHub
Drafts new content in the right voice for each channel, or scans existing text for AI tells and rewrites it in an authentic human voice. Two directions in one skill: generate and remediate. Useful for anyone publishing agent-assisted writing.
skillwritingvoiceediting
by robcsaszar Aug 14, 2026 6/10
skill GitHub
Runs a parallel-agent audit over a codebase, then has agents adversarially try to refute each finding before it is reported. The verification step is what keeps plausible-but-wrong findings out of the output. A good pattern to copy even if you do not use the skill.
skillauditparallel-agentsverification
by robcsaszar Aug 14, 2026 7/10
skill GitHub
Claude Code skills that write the three files agents rely on most: AGENTS.md, CONTEXT.md, and DESIGN.md. Removes the blank-page problem when setting up a new repo for agent work. Small and focused.
skillagents-mddocumentationscaffolding
by robcsaszar Aug 14, 2026 6/10
skill GitHub
Claude Code skills covering the whole skill-authoring lifecycle: create, judge, eval with persisted regression suites, audit for ecosystem-wide coherence, review, and update. The persisted regression suites are the standout, since most skill authoring has no test loop at all. For people maintaining many skills rather than a handful.
skillauthoringevalregression
by robcsaszar Aug 14, 2026 7/10
skill GitHub
A DeepSeek Harness skill pack with parallel-dispatch scheduling rules and an archmap agent that computes deterministic diff impact surfaces without calling an LLM, saving tokens. The zero-LLM impact analysis is the interesting idea. Chinese-language documentation.
skillsdshparallelarchitecture
by xu-jin-cs Aug 14, 2026 5/10
skill GitHub
A self-contained Claude Code and GitHub Copilot plugin that assesses team AI readiness against the Agentic Habitat Maturity Model and the Sovereign Engineer framework, producing a gap-anchored maturity report. Aimed at engineering leads rather than individual developers. Opinionated about which frameworks matter.
pluginassessmentmaturityteam
by techtalk Aug 14, 2026 5/10
skill GitHub
A framework for building, maintaining, and improving AI assistants with Claude, combining guides, runnable setup tasks, installable skills, and copy-paste templates. Broad rather than deep. Useful as a structured starting point if you are new to assembling assistants.
frameworktemplatesskillsguides
by KalastajaM Aug 14, 2026 5/10
skill GitHub
A skill that scans a repo, asks only what it cannot infer, then generates README, LICENSE, contributing, security, changelog, CI, and a launch playbook. The ask-what-you-cannot-infer step keeps the output from being generic filler. Useful right before making a repo public.
skillopen-sourcereadmelicensing
by AnayDhawan Aug 14, 2026 6/10
skill GitHub
Decides which documents a repo owes, flags the existing ones that now contradict the code, and writes the ones the code can prove, with citations. Portable across Claude Code, Codex, Cursor, and Windsurf. The citation requirement is what separates it from generic doc generators.
skilldocumentationcitationsbackfill
by hannsxpeter Aug 14, 2026 7/10
skill GitHub
An unofficial DSH port of mattpocock/skills, bundling 18 engineering and 7 productivity skills as a DeepSeek Harness plugin. MIT licensed with credit to the original author. Shows how portable well-written skills are across harnesses.
skillsdshportengineering
by xiaoxiaosrm Aug 14, 2026 5/10
skill GitHub
Reusable skills published by PlayCanvas for agents working with their products. First-party skills are worth noting as a trend: the vendor encodes its own API conventions rather than leaving agents to guess. Useful if you build with PlayCanvas.
skillsplaycanvasgamedevfirst-party
by playcanvas Aug 14, 2026 6/10
skill GitHub
A complete ruleset for removing AI phrasing, lecture tone, and collaboration filler from model responses, usable with Claude, ChatGPT, and other conversational AI. Bilingual documentation. Broader than a coding skill but directly applicable to agent-written prose.
skillwritingtoneprompting
by chengzhi-c Aug 14, 2026 6/10
skill GitHub
A complete extraction of Claude Code's system prompt, its 27 builtin tool descriptions, subagent prompts for Plan/Explore/Task, and utility prompts for CLAUDE.md, compaction, statusline, WebFetch, Bash, security review, and agent creation. Updated for each Claude Code release. Essential reference if you write skills or subagents and want to match the house style.
referencesystem-prompttoolsinternals
by Piebald-AI Aug 14, 2026 8/10
skill GitHub
Skills for working with Google Cloud Spanner, published under the gemini-cli-extensions org. Another first-party vendor skill set, portable to any skill-aware agent. Narrow but authoritative for Spanner work.
skillsspannergcpdatabase
by gemini-cli-extensions Aug 14, 2026 5/10
skill GitHub
Shared skills, prompts, and tooling for Picsart's gen-ai CLI and generative AI workflows. A company-internal skill library published openly. Mostly of interest as an example of how an organization structures shared skills.
skillsgenerative-aipicsartprompts
by PicsArt Aug 14, 2026 5/10
skill GitHub
A continually expanding professional agent skill library aimed at research writing, data analysis, and professional report delivery. Chinese-language. Relevant if your agent work is document-heavy rather than code-heavy.
skillsresearchreportschinese
by SoMic520 Aug 14, 2026 5/10
skill GitHub
An Obsidian second-brain template driven by Claude Code, shipping skills, auto-linking, and note conventions. Lighter than the 101-skill kits in the same space. A reasonable entry point if you already use Obsidian.
skillobsidiansecond-brainnotes
by michaeljauk Aug 14, 2026 6/10
skill GitHub
Brings Claude Code outputStyles to DeepSeek Harness as session-scoped, durable, runtime-switchable styles, with a /style command, an output_style storage domain, and systemPrompt injection. Runtime switching without restarting the session is the useful bit. A clear reference for how output styles are wired.
output-stylesdshportprompting
by PerryLink Aug 14, 2026 5/10
skill GitHub
Two skills with teeth: root-cause forbids a causal claim without evidence, and sitrep puts the finding first, bad news above good, and names every gap. It ships clarity.py so the rules run as a check rather than sitting in the prompt as advice. Directly aimed at agents that overstate confidence.
skillhonestyreportingverification
by openhonest Aug 14, 2026 7/10
skill GitHub
A community-driven library of reusable agent skills covering Claude Code, Cursor, Codex, Cline, and others. Community-maintained means variable quality, so read before installing. Useful as a discovery surface.
skillscommunitylibrarymulti-agent
by Notysoty Aug 14, 2026 6/10
skill GitHub
An Agent Skill that encodes Anthropic's documented best practices for building with Claude. It advises on model and effort selection, prompt construction, subagent delegation, tool design, evaluation, and guardrails. A convenient way to keep official guidance in the loop while designing agent systems.
skillbest-practicespromptingsubagentstool-design
by starsinc1708 Aug 14, 2026 6/10
skill GitHub
A directory that indexes 321 Claude skills spread across eleven category repositories. You browse the full list in one place and then clone only the category you need, instead of pulling down everything. Handy for finding an existing skill before writing your own.
skillsdirectoryindexcatalog
by prvthmpcypher Aug 14, 2026 6/10
skill GitHub
A collection of 29 skills covering non-engineering work — project management, OKRs, SOPs, meeting summaries, proposals, and negotiation. Useful if you want Claude Code handling the operational paperwork around a project rather than just the code.
skillsbusinessokrsopproject-management
by prvthmpcypher Aug 14, 2026 5/10
skill GitHub
An official NEXPACE catalog of agent skills for building on MapleStory Universe. It is distributed as plain SKILL.md files, so it works with Claude Code, Codex CLI, Gemini CLI, Kimi CLI, or any agent that reads the format. A good example of a vendor shipping first-party skills for their platform.
skillsgamedevmaplestoryvendorskill-md
by NEXPACE-Limited Aug 14, 2026 5/10
skill GitHub
A free set of Claude skills for real estate agents, covering listing copy and MLS remarks. The more interesting piece is compliance screening against Fair Housing and state advertising rules, which turns the skill into a check on generated marketing text rather than just a generator.
skillsreal-estatecompliancecopywriting
by trevormchaffie Aug 14, 2026 5/10
skill GitHub
A documentation and catalog site for the IncredAgents collection of SKILL.md skills for Claude Code and compatible agents. Every skill gets its own page with real output demos, so you can see what it produces before installing. Useful for browsing skills without cloning repos first.
skillscatalogdocsskill-md
by MyAiFreedomSystems Aug 13, 2026 5/10
skill GitHub
A free set of five Claude Code skills covering invoice chasing, proposals, client onboarding, status updates, and renewals. The focus is the admin side of freelancing rather than writing code. MIT licensed and drop-in for anyone running a solo practice.
skillsfreelanceinvoicingproposalsbusiness
by simoabdelmoumen10-sys Aug 13, 2026 6/10
skill GitHub
A Claude Code plugin that interrupts the usual fix-it-immediately loop by quizzing you on root cause and intended fix first. The goal is to keep your understanding of the codebase from decaying while the agent does the typing. A deliberate inversion of the normal agent workflow, aimed at learning.
pluginlearningdebuggingroot-cause
by schwann2402 Aug 13, 2026 7/10
skill GitHub
A design skill for Claude Code, Cursor, and Codex that enforces computed WCAG contrast gates, a 22-shape catalog with rotation memory, and a ship scan blocking generic output and invented statistics. Covers web, print, brand identity, packaging, and apparel. Aimed at stopping agents from emitting the same slop layout every time.
designwcagaccessibilitybrandingskill
by iamAlvinV Aug 13, 2026 6/10
skill Reddit
A portable Agent Skills suite for Claude Code, Cursor and other coding agents that covers a website end to end in two prompts instead of fifty. The first prompt produces a blueprint — product goals, users, top tasks, content, visual direction, risks and acceptance criteria — before any code is written. The second builds and releases against that approved blueprint, with accessibility, SEO, privacy and QA treated as gates rather than afterthoughts.
skillsweb-designaccessibilityseoworkflow
by Both_Animator_1120 Aug 13, 2026 7/10
skill Reddit
An open-source set of Agent Skills that adds a second pass over architecture work: ask Claude Code to propose or modify an architecture, then review the resulting RFC, ADR or diagram before implementation begins. The gate returns evidence gaps, adversarial findings, blockers with a score, and a verdict with explicit approval conditions. It also ships a general production-architecture skill and a separate one for AI-agent system architecture, both instruction-first and portable.
skillsarchitecturecode-reviewadrrfc
by FunNewspaper5161 Aug 13, 2026 7/10
skill GitHub
A set of Claude Code skills for recording infrastructure decisions as architecture decision records, aimed at AWS and DevOps work. Each decision is evaluated against the AWS Well-Architected Framework and CALMS/DORA rather than captured as free-form prose, which gives the agent an explicit rubric to argue against. Handy if your team already keeps ADRs but writes them inconsistently.
skillsadrawsdevopswell-architecteddora
by eenlpe1 Aug 13, 2026 6/10
skill GitHub
An open Agent Skills library that turns a coding agent into a clinical pharmacology and pharmacometrics assistant. It reviews, reconciles and prepares evidence, with hard boundaries stated up front: it never selects a dose, signs off, or submits. The repo also tracks honest built-versus-released status per skill, which is unusual and worth copying for any regulated-domain skill pack.
skillsclinical-pharmacologypharmacometricshealthcareregulated
by malekokour Aug 13, 2026 6/10
skill GitHub
A one-install bundle of five audit skills that form a complete pipeline for finding bugs in Swift and SwiftUI apps before shipping. Each skill covers a distinct audit dimension rather than running a single generic review, which tends to surface more than one broad pass does. Aimed squarely at iOS and macOS developers using Claude Code.
skillsswiftswiftuiiosauditcode-review
by Terryc21 Aug 13, 2026 7/10
skill GitHub
A skills bundle combining an ECC base with original Portuguese-language skills — engenharia-de-grafos for graph engineering, doctor for diagnostics, grills, and score-loop for iterative scoring. One of relatively few skill packs authored natively in Portuguese rather than translated, which matters for prompt phrasing quality.
skillsportuguesebundlegraphsscoring
by majinmagros Aug 13, 2026 5/10
skill Reddit
Deferred work usually ends up spread across a Deferred.md, inline TODOs, plan files, and memory files that disagree with each other. The Unforget skill sweeps the codebase and consolidates everything into a single UNFORGET.md, sorted into four categories: plan deferrals, spillovers, audit findings, and bugs. Each item gets a target column tied to your release cycle, so a ship-blocker flag means something concrete.
skilltodo-trackingrelease-managementcontext
by BullfrogRoyal7422 Aug 13, 2026 7/10
skill GitHub
Scriptorium is a French-language writing studio for Claude Code and Cowork, covering 26 source genres with a strict house style. Guardrails are deterministic and written in pure Python rather than left to the model. It exports finished work to Word, PDF, HTML, and LaTeX against a defined visual identity.
writingfrenchdocument-generationguardrails
by MariusYvard Aug 13, 2026 5/10
skill GitHub
Banka is a protocol plus skills kit for scoping, generating, and building Claude Code projects without over- or under-engineering them. It sorts work into complexity tiers and matches the build approach to the tier. It stays agnostic about your stack while being deliberately opinionated about quality.
skillsscopingproject-setupquality
by partikularwaters Aug 13, 2026 6/10
skill GitHub
autonomous-engineer is a meta-skill aimed at pushing coding agents toward staff-level autonomy across Claude Code, Cursor, Zed, OpenHands, and Codex. It combines context engineering, spec-driven development, and three-layer evaluator loops with an explicit graph topology for task decomposition. Evaluation-driven development against golden datasets and rigid workspace sandboxing round it out.
meta-skillspec-drivenevaluationsandboxing
by johngbl Aug 13, 2026 6/10
skill GitHub
This skill audits a GitHub repository for risk before you pull it into your stack, which matters more as agents install third-party plugins and skills on your behalf. It scores across seven weighted dimensions covering maintenance, provenance, and code quality signals. The output is a single ADOPT, EVALUATE, CAUTION, or AVOID verdict rather than a wall of raw findings.
securitysupply-chainauditdependency-review
by Consultora-AMDT Aug 13, 2026 7/10
skill GitHub
A Claude Code project pack built for Japanese contract software development, aligned with the IPA Common Frame 2013 process model. It ships 23 subagents and 21 skills alongside QCD and security governance standards. The pack assumes you will tailor it to each engagement rather than adopt it wholesale.
subagentsskillsjapanesegovernance
by CT-masato-hino Aug 13, 2026 6/10
skill GitHub
second-reader is a knowledge vault skill for AI agents built around one rule: a note is not believed until it has been checked against its source. That verification step guards against the compounding errors you get when agents summarize their own summaries. It gives agents a store of notes with provenance rather than free-floating claims.
knowledge-baseverificationprovenancenotes
by mplind Aug 13, 2026 6/10
skill GitHub
competency-check is a diagnostic skill that probes what you do not know in professional areas next to your own. It surfaces blind spots rather than testing depth in your existing specialty. Useful for solo builders whose agent output now spans design, ops, and legal territory they never trained in.
skilldiagnosticlearningself-assessment
by wheeleny-design Aug 13, 2026 5/10
skill GitHub
A skill pack that gives your agent the persona and habits of a traditional Mexican mother. It is a light take on persona skills, trading the usual neutral assistant tone for something with opinions. Worth a look mainly as a compact example of how far persona instructions can shift agent behavior.
personafunskilltone
by mcasillas17 Aug 13, 2026 5/10
skill GitHub
reSanity is a single-file Chinese-language skill that applies research discipline to retail investing decisions. It covers fact-checking claims, avoiding known traps, retaining what you learned, and reviewing past calls. One SKILL.md with zero dependencies, which makes it a clean example of packing a full workflow into one file.
skillchineseresearchzero-deps
by Thhoho Aug 13, 2026 5/10
skill Reddit
A single-file Claude Code plugin skill that audits the current change against an AUDIT_PROTOCOL.md and reports the tier it picked, the phases it ran, and the phases it skipped with reasons. Because it is just markdown it also works with Cursor, Codex, and other file-reading agents. The value is the explicit skipped-checks report rather than a silent pass.
auditcode-reviewpluginverification
by sturec5 Aug 13, 2026 7/10
skill GitHub
Turns system design work into a runnable skill: design docs, architecture audits, capacity estimation, and mock interview drills. Works across Claude Code and Codex. Useful both for real architecture work and for interview prep.
system-designarchitecturecodexdocs
by SeuPut0705 Aug 13, 2026 6/10
skill GitHub
A library of frameworks, templates and rubrics wrapped as 23 Claude Code skills covering problem framing, value hypothesis, MVP scoping, prioritization, metrics, launch, PMF and AI integration. Aimed at daily PM workflows rather than one-off strategy documents.
product-managementtemplatesrubricsskills
by kalyvask Aug 13, 2026 6/10
skill GitHub
A Claude Code plugin that enforces 1C:Enterprise (BSL) code standards — SOLID, design patterns, metadata XML rules — through blocking session gates. Produces a machine-readable evidence trail of what was checked. Very niche platform, but a solid template for domain-specific quality gating.
1cquality-gatestandardsplugin
by Romandredan Aug 13, 2026 5/10
skill GitHub
Agent skills that go beyond researching competitor apps and actually generate mobile screens following the UI patterns that top-grossing apps use. Framed as a builder rather than a research assistant. Useful starting point for mobile UI work driven by an agent.
mobileuidesignskills
by Appllama Aug 13, 2026 5/10
skill GitHub
Claude Code skills for prod-local agent development: pull real traces and logs out of your local stack, plan before building, and review more deeply than a diff-scoped bot can. The observability angle is the differentiator — the agent reasons over actual runtime data instead of source alone.
observabilitytraceslogscode-review
by LunarCommand Aug 13, 2026 6/10
skill GitHub
A general-purpose skill pack for long-horizon tasks: clarify what was actually asked, plan against the machine's real capabilities, and require evidence before claiming completion. Chinese-language documentation. Targets the ask-first, verify-after failure modes that bite on multi-hour tasks.
clarificationplanningverificationchinese
by haxudev Aug 13, 2026 5/10
skill GitHub
A complete pipeline from trending topic to published article for Chinese WeChat official accounts, packaged as 14 Claude Skills installable with two commands. Domain-specific, but a good example of chaining skills into one editorial workflow.
publishingwechatcontentchinese
by ma2ong Aug 13, 2026 5/10
skill Reddit
Extracts actual frames and captions so Claude answers from the video instead of guessing from the title. The clever part is frame selection: it reads your question first, scores moments against it using the transcript and on-screen text, then spends its frame budget there (5 of 55 candidates on one lecture). Downloads only the requested section, OCRs a larger copy locally, and transcribes with whisper.cpp — no API key.
videoffmpegwhispermultimodal
by krazybionic Aug 13, 2026 7/10
skill GitHub
A portable Agent Skill that identifies the actual limiting constraint in an idea, product, codebase, architecture, workflow or agent setup, rather than listing every possible improvement. Theory-of-constraints thinking packaged for agents. Works anywhere markdown skills work.
analysisconstraintsarchitectureportable
by Antonod1988 Aug 13, 2026 5/10
skill GitHub
A CLI and Agent Skill for Codex and Claude Code that diagnoses exited, restarting and unhealthy containers plus ports, mounts, DNS, logs and OOM kills. Deliberately read-only, so the agent can investigate without changing your stack. Good pattern for giving agents diagnostic power without write access.
dockerdiagnosticsread-onlytroubleshooting
by bigu1 Aug 13, 2026 6/10
skill GitHub
Does senior media-buyer analysis on your ad accounts, working from either a connected account or a CSV export. Read-only by design, so it recommends rather than spends. Seven skills covering the usual optimization passes.
advertisingmarketingread-onlyanalytics
by riz1k9 Aug 13, 2026 6/10
skill GitHub
A Claude Code skill that rewrites a resume against a specific job posting with recruiter-grade positioning and evidence scoring for each claim, producing a one-page .docx. Requires no code changes to use. Practical example of a document-producing skill.
resumedocxjob-searchwriting
by sakshi-gupta-1 Aug 13, 2026 5/10
skill GitHub
One command to push reports, decks and dashboards to a private Cloudflare Pages site protected by Cloudflare Access. Ships as both a CLI and a Claude Code skill. Solves the awkward last step where an agent generates a nice HTML report and you need to share it with someone.
cloudflarepublishingartifactssharing
by hsongra11 Aug 13, 2026 6/10
skill GitHub
An AI research skill that synthesizes job postings, analyst reports, product docs, forums and reviews into buyer personas grounded in sources rather than invented. Compresses work that normally takes weeks into hours. Marketing-side use of an agent, but the source-synthesis pattern generalizes.
researchpersonasmarketingsynthesis
by LaureBrosseau Aug 13, 2026 5/10
skill GitHub
A generic vision core with pluggable scene skills — OCR, table-to-markdown, chart reading, UI review — so text-only models like DeepSeek and GLM can handle image tasks. A fork of Anionex/agent-vision-toolkit. Practical if you run a cheaper text-only model as your main driver.
visionocrdeepseekmultimodal
by awslew Aug 13, 2026 6/10
skill GitHub
Design and build skills for Claude Code, paired with hooks that catch the slow drift away from your design system across a long session. MIT licensed with clear authorship and beginner-friendly docs. The anti-drift hooks are the differentiator over yet another design skill pack.
designhooksdesign-systemui
by emcquesten Aug 13, 2026 6/10
skill GitHub
A working set rather than a demo collection: adversarial code review, shipping rituals, marketing asset pipelines, iPhone and desktop control, and multi-agent orchestration. The adversarial review and shipping-ritual skills are the ones worth reading first.
skillscode-revieworchestrationautomation
by ucsandman Aug 13, 2026 6/10
skill GitHub
Coordinates article writing, editing, essay review and fact checking with an explicit AI-slop banned-word list in Japanese and English, voice rules, and title conventions. Role boundaries keep the editor from rewriting as the author. Designed to pair with an llms-txt writer for machine audiences.
writingeditingjapaneseorchestration
by shimo4228 Aug 13, 2026 5/10
skill GitHub
A read-only Claude Code skill that wraps the OpenAI Codex CLI to review a diff, so the reviewer is a different model than the author. Cross-model review catches the blind spots a model shares with itself. Read-only, so it cannot quietly fix what it flags.
code-reviewcodexcross-modelread-only
by shimo4228 Aug 13, 2026 7/10
skill Reddit
JetBrains independently benchmarked the Caveman token-saving skill and found 8.5% output-token savings on long coding tasks, not the ~65% the author had been quoting from chat-style conversations. The author accepts the correction, notes JetBrains also found no quality loss, and rebuilds around the bigger source of waste the benchmark exposed. A rare public post-mortem on one's own numbers.
token-savingsbenchmarkoutput-stylepost-mortem
by VeryVexxy Aug 13, 2026 7/10
skill GitHub
A modular AI coding skills repository spanning development tools, automation, Obsidian workflows and video processing. Chinese-language docs. Grab-bag by design, but the Obsidian and video pieces are less commonly covered.
skillsobsidianautomationvideo
by wangjs-jacky Aug 13, 2026 5/10
skill GitHub
An agent skill that runs a full web-app security cycle: define scope, audit for issues, apply hardening, then retest to confirm. Each pass leaves reproducible evidence so findings can be re-verified rather than taken on the agent's word.
securityauditwebskillhardening
by parousia8888 Aug 13, 2026 7/10
skill GitHub
A portable Agent Skill implementing the worker/critic loop with an explicit bound, so review cycles terminate instead of spiraling. Portable across skill hosts, making it a drop-in way to add adversarial review to any task.
criticreview-looporchestrationskill
by kamtS Aug 13, 2026 7/10
skill GitHub
An extensible flat-file registry for sharing AI skills across Claude Code, OpenCode, Codex, and Copilot. Ships pre-configured with Magento 2 and Govard workflows, so it doubles as a working example of packaging domain-specific skills.
registryskillscross-agentmagento
by ddtcorex Aug 13, 2026 6/10
skill GitHub
A bilingual (EN/ZH) collection of agent skills packaged for reuse across projects. Useful mainly as a browsing source for skill patterns worth copying into your own setup.
skillscollectionchinesereusable
by manchan4869 Aug 13, 2026 5/10
skill GitHub
A public Agent Skills marketplace focused on two niches: competitive-programming C++ style enforcement and K-12 teaching workflows. Narrow, but a concrete example of shipping domain skills as an installable marketplace.
skillsmarketplacecppeducation
by ShanireZ Aug 13, 2026 5/10
skill GitHub
A skill that fixes awkward machine-translated Korean, targeting the unnatural 해요체 register that LLM output tends to produce. Useful for anyone shipping Korean-facing docs, UI copy, or commit messages written with an agent.
koreanwritingproofreadinglocalizationskill
by JellyBrick Aug 13, 2026 6/10
skill GitHub
A rewriting skill that detects 38 distinct AI writing tells in Traditional Chinese and rewrites them into natural prose, while correcting mainland-Chinese vocabulary and half-width punctuation. Works with Claude Code, Codex, and Cursor.
chinesewritingrewritinglocalizationskill
by Raymondhou0917 Aug 13, 2026 6/10
skill GitHub
A presentation skill with 31 curated themes, automated color-theory validation, and Pyramid Principle storytelling structure, exporting to PPTX and PDF with brand import. Host-agnostic across Claude Code, Cursor, Codex CLI, and Windsurf.
slidespresentationhtmlpptxdesignskill
by a692570 Aug 13, 2026 8/10
skill GitHub
A skill that routes questions by mode and depth and enforces truth-source discipline, so answers cite where they came from instead of confabulating. Backed by 48 offline contract tests, bilingual ZH/EN, works across Claude Code, Cursor, and Codex.
researchrigorcitationstestingskill
by Yuuqq Aug 13, 2026 6/10
skill GitHub
Lets Claude Code shell out to Google's Antigravity CLI (agy) to review code or hand off tasks. A lightweight way to get a genuinely different model's opinion in-loop without leaving your Claude session.
antigravitycode-reviewdelegationcross-modelskill
by unlikelyzero Aug 13, 2026 7/10
skill GitHub
A public Claude Code skills marketplace you add once, then install individual skills from — headliners include agent-army and claude-continuation. Hosted browsing available at claude-skills.amjad1233.com.
marketplaceskillsagent-armycontinuation
by amjad1233 Aug 13, 2026 6/10
skill GitHub
An agent skill for working directly against Figma files, including visual QA of the rendered result rather than just reading layer metadata. Host-agnostic across Agent Skills implementations; requires the Figma Console MCP.
figmadesignvisual-qamcpskill
by 1955m Aug 13, 2026 6/10
skill GitHub
A testing toolkit that writes E2E specs from scratch, audits existing ones against 24 anti-patterns graded P0/P1/P2 with a focus on silent always-pass smells, and debugs flaky runs straight from playwright-report/ or cypress/reports/. The anti-pattern audit is the standout — agent-written E2E tests frequently pass without asserting anything.
e2eplaywrightcypresstestinganti-patternsflaky
by voidmatcha Aug 13, 2026 8/10
skill GitHub
Discovers and indexes over 150 scraping and collection tools on GitHub, then progressively narrows to the right one for your target and kicks off the crawl. Saves the usual half hour of comparing scrapers before any data gets collected.
scrapingcrawlingdiscoverytoolingskill
by Yuuqq Aug 13, 2026 6/10
skill GitHub
A skill pack that turns Claude Code into a go-to-market engineering assistant. Covers lead list building, email finding and verification, waterfall enrichment, lead scoring, CRM sync, and buying-signal monitoring for job changes, funding, and tech intent. Backed by the Cargo CLI with 138 integrations and 50 data providers; also works with Codex and Cursor.
skillsgtmsalesenrichmentcrm
by getcargohq Aug 13, 2026 6/10
skill GitHub
A shareable global Claude Code configuration bundled with a portable harness plugin that enforces spec-driven development. Aims to keep agent work anchored to written specs and governance rules rather than ad-hoc prompting, and travels between machines and projects as one package.
configurationspec-drivenplugingovernanceclaude-md
by kaiohenricunha Aug 13, 2026 6/10
skill GitHub
An official plugin from Tray Tecnologia giving AI agents full integration with the Tray e-commerce platform APIs. It ships skills, agents, and slash commands covering more than 150 endpoints, so an agent can work the storefront API without you hand-writing request code. Documentation is in Portuguese; relevant mainly to Brazilian e-commerce developers.
pluginskillsapiecommercetray
by tray-tecnologia Aug 12, 2026 5/10
skill Reddit
An MIT-licensed Claude Code skill where a parent orchestrator decomposes a goal into a dependency graph persisted as JSONL, and backend and frontend agents implement scoped nodes with attached evidence and commits. Security and UI auditors are separate roles that cannot modify the code they judge. Loops stay inside nodes while the graph controls dependencies and handoffs, so a fresh agent can resume without reconstructing history.
skillorchestrationmulti-agentdependency-graphaudit
by BaXRS1988 Aug 12, 2026 7/10
skill GitHub
A set of Claude Code skills covering the full job-search lifecycle: sourcing roles, tailoring resumes, chasing referrals, interview prep, and offer negotiation. Everything runs locally with a human in the loop at each stage, and it is MIT licensed.
job-searchcareerskillshuman-in-the-loop
by guerrilla2799 Aug 12, 2026 6/10
skill GitHub
A Claude Code skill that acts as a chief of staff for product people, building a second brain that starts from a conversation and adapts to how you work. Documentation is in Portuguese.
product-managementsecond-brainportuguese
by pe-menezes Aug 12, 2026 5/10
skill GitHub
Takes a plan or rough idea and produces an agent-ready documentation set: AGENTS.md plus linked architecture, decisions, roadmap, product, and design docs. It interviews you with grounded recommendations instead of filling a fixed template, and works with any AGENTS.md-compatible agent.
agents-mddocumentationplanningscaffolding
by melconcoast Aug 12, 2026 6/10
skill GitHub
An agent skill that produces authentic Malaysian Chinese voice, covering Manglish particles, Hokkien/Cantonese/Malay code-switching, and kopitiam cultural register. Useful for localized copy that generic models get wrong.
localizationwritingmalaysianvoice
by jotterhans Aug 12, 2026 5/10
skill GitHub
An open-source agent skill for HCI research writing that diagnoses whether a paper's contribution is real, traces each claim back to its supporting evidence, and red-teams the argument before peer reviewers get to it.
academicwritingresearchpeer-review
by RobbieRao Aug 12, 2026 6/10
skill GitHub
A decision tree for choosing between a skill, subagent, hook, MCP server, plugin, routine, web page, app — or nothing at all — plus the file skeleton for whichever piece the tree lands on. Documented in Spanish and English; not affiliated with Anthropic.
decision-treeskillshooksplugins
by Hainrixz Aug 12, 2026 7/10
skill GitHub
An agent skill that quizzes you on the code you just shipped, right after an AI-assisted merge. The premise is that the review step catches defects but nothing checks whether you actually understand what landed. Works with Claude Code, Codex, and Goose.
code-reviewlearningquizmerge
by thierrypdamiba Aug 12, 2026 7/10
skill GitHub
Hands a business system to an AI with no prior explanation and measures where a first-time user would get stuck. Ships as a single Claude Code subagent definition; documentation is in Japanese.
uxtestingsubagentusability
by kishii-py Aug 12, 2026 6/10
skill GitHub
Gives coding agents fast file discovery on Windows by shelling out to the Voidtools Everything CLI instead of walking directories. Works with Claude Code, Codex, and other compatible agents.
windowssearchfilesperformance
by DerrickZeng33 Aug 12, 2026 6/10
skill GitHub
A research skill for CS and AI papers that runs an eight-agent pipeline to produce survey-quality literature reviews complete with comparison and SOTA tables. Search is arXiv-first, every citation is verified individually, and output passes through seven quality gates.
researcharxivmulti-agentliterature-review
by Yang-Shihui Aug 12, 2026 7/10
skill GitHub
A Claude Code skill for writing openings and prose that keep a reader engaged, built on classical rhetoric plus research that contradicts a lot of conventional hook advice.
writingrhetoricprosecopywriting
by Pr1m4lc0d3 Aug 12, 2026 5/10
skill GitHub
Open-source skills that let any agent produce complete marketing campaigns, including UGC video, ad video, and product photography. Works across Claude, Cursor, and other skill-compatible agents.
marketingvideougccampaigns
by SupercmoHQ Aug 12, 2026 5/10
skill GitHub
An open-source marketing system covering strategy, SEO, AEO/GEO, paid media, content, CRM, and analytics. Outputs are grounded in explicit brand context and gated behind human approval, with verifiability as a design goal.
marketingseoanalyticscrm
by indranilbanerjee Aug 12, 2026 5/10
skill GitHub
A free collection of portable agent skills and plugins for Codex, Claude Code, and other Agent Skills clients. Centred on the MSW Kernel, which pushes agents toward the minimum sufficient work for a task rather than sprawling output.
skillsportablecodexplugins
by transcendr Aug 12, 2026 5/10
skill GitHub
Official ComPDF skills that give coding agents real PDF processing: conversion, editing, splitting, insertion, comparison, and compression. Compatible with Claude Code, Cursor, Copilot, OpenCode, and dozens of other agents.
pdfdocument-processingskillsconversion
by ComPDFKit Aug 12, 2026 6/10
skill GitHub
Agent skills for creating video with Framia, structured storyboard-first with model routing, editor assembly, local ffmpeg finishing, and audit gates between stages. A companion repo holds reproducible example videos.
videostoryboardffmpegmedia
by convergeai-labs Aug 12, 2026 5/10
skill GitHub
A Claude Code skill that converts an article into an immersive one-screen-per-frame presentation page with page-flip or autoplay, in warm-dark or off-white themes. Chinese fonts are self-hosted and subsetted, with one-command publishing to Cloudflare Pages.
presentationwebcloudflare-pageschinese
by huiyonghkw Aug 12, 2026 5/10
skill GitHub
A trio of Claude Code skills aimed at team practice: writing PRs, issues, and commits your teammates will actually read; a procedure for reviewing a teammate's PR; and a check on how much AI-written code you don't yet understand.
koreanpull-requestcode-reviewwriting
by iceberggymnast Aug 12, 2026 5/10
skill GitHub
A free skill giving Claude Code and Codex access to Microsoft 365 mail and calendar via Graph, plus conversion of PST archives into searchable Markdown.
microsoft-365outlookcalendaremail
by dbhq-uk Aug 12, 2026 6/10
skill GitHub
An agent skill that produces original icons matching Lucide's visual style, emitting both the SVG and Lucide-format metadata JSON. Works with Claude Code, Codex, Cursor, Gemini CLI, and other Agent Skills tools.
iconssvglucidedesign
by S6U5 Aug 12, 2026 6/10
skill GitHub
A unified Claude Code plugin packing 33 skills spanning the whole SDLC — product, research, design, develop, tune, test, verify, ship, operate — with a shared set of engineering principles injected at session start so every skill inherits the same standards.
sdlcpluginengineeringskills
by int2t05 Aug 12, 2026 6/10
skill GitHub
A self-audit toolkit that mines your Claude chat history for the corrections you've had to repeat and the approaches that worked, arbitrates the findings into a compact rule set, and keeps the resulting memory tidy rather than ever-growing.
memoryself-auditclaude-mdrules
by coltonbearden Aug 12, 2026 7/10
skill GitHub
A free guide plus Claude Code skill that walks someone who has never deployed anything through getting their project online: a domain, HTTPS, a GitHub repo, and automatic deploys.
deploymenthttpsgithubbeginners
by jhammant Aug 12, 2026 6/10
skill GitHub
Agent skills wiring WhatsApp into agent workflows through HookMyApp, installable in one command via npx skills add.
whatsappintegrationmessagingskills
by hookmyapp Aug 12, 2026 5/10
skill GitHub
An agent skill that audits Ruby on Rails applications for security issues, code quality problems, and the misconfigurations that commonly slip through in Rails projects.
railsrubysecurityaudit
by rubyroidlabs Aug 12, 2026 6/10
skill GitHub
A skill that raises the quality of Bulgarian text produced by AI assistants and editor workflows, targeting the specific errors models make in the language.
bulgarianwritinglocalizationtext-quality
by AcTePuKc Aug 12, 2026 5/10
skill Reddit
A Claude Code plugin keeping output in plain language per the ISO 24495 international standards. Five skills cover core rules, legal writing, technical writing, organisational rollout, and document design, with Claude picking the right one per task. An advisory hook audits every markdown file it writes and reports sentence length, paragraph density, and legalese counts in a single line.
plain-languageiso-24495writinghooks
by gazmagik Aug 12, 2026 7/10
skill GitHub
Ten Claude Code skills for data quality work against any SQL database: profiling, quality metrics, audit reporting, standardization, imputation, deduplication, and defect prevention.
data-qualitysqlprofilingdeduplication
by koprjaa Aug 12, 2026 7/10
skill GitHub
Covers the whole light-novel production pipeline: project setup, ranking-based topic selection, teardown analysis of successful works, outlining and the crucial opening chapters, drafting, de-AI-ifying the prose, multi-perspective review, and foreshadowing and timeline tracking. Integrates with Syosetu, Kakuyomu, and other Japanese and Chinese publishing platforms.
writinglight-noveljapanesepublishing
by MSKmrc Aug 12, 2026 5/10
skill Reddit
A release note worth reading for the trigger-scoping lesson: adding C and C++ skills that both claimed **/*.h meant every C header edit force-loaded 24 KB of skill bodies, most of it irrelevant to the task. whetstone itself is a Claude Code plugin of 19 agents, 22 commands, and 32 skills pushing agents toward planning, verification, and review before editing.
pluginskillstriggersrelease-notes
by Ilia0001 Aug 12, 2026 6/10
skill GitHub
The official set of agent skills for Oxylabs products, giving coding agents direct access to their web scraping and data collection APIs.
scrapingweb-dataoxylabsskills
by oxylabs Aug 12, 2026 5/10
skill GitHub
Claude Code skills for running AI video generation demo activations: choose a generation model based on evidence rather than vibes, then build a booth experience people can actually operate.
videodemoevaluationskills
by thepandanlabs Aug 12, 2026 5/10
skill GitHub
A Claude Code advisor for communication, people management, sales, and negotiation, distilled from 275 principles and 1,019 recorded negotiations across 157 live classes in Vladimir Tarasov's social-technology tradition. Answers in Spanish.
managementnegotiationcommunicationspanish
by arturgaliev3099-ux Aug 12, 2026 5/10
skill GitHub
An agent skill that rewrites AI-sounding drafts into human prose, or audits them and reports the problems without touching the text. It targets the tells that persist after ordinary prompt tuning.
writingeditingai-detectionprose
by chernistry Aug 12, 2026 6/10
skill GitHub
An agent skill for building scroll-driven landing pages structured around a transformation arc — night to morning, winter to spring, draft to launch.
landing-pagescrolldesignweb
by seongyeop1 Aug 12, 2026 5/10
skill GitHub
Converts any public GitHub repository into a repository-native Agent Skill for ChatGPT and Claude. Browser-first and free, with no AI API key required to do the conversion.
skillsgithubgenerationbrowser
by Hhhkarimi Aug 12, 2026 7/10
skill GitHub
A Russian-language text quality skill covering neuroslop cleanup, typography, information style, editorial standards, UX writing, and business correspondence. Scores text on a 0-10 scale using more than 2,000 linguistic atoms.
russianwritingtext-qualityediting
by talkstream Aug 12, 2026 6/10
skill GitHub
An agent skill reviewing Italian public administration codebases against national guidelines and CAD obligations, checking what the official validators cannot see. It explicitly does not issue formal compliance judgements.
italypublic-sectorcompliancecode-review
by engineering87 Aug 12, 2026 5/10
skill GitHub
Delivers one well-timed third-party nudge into a long-running Claude Code session, evaluated through six distinct engineering lenses — a check from outside the session's own reasoning.
reviewlong-sessionsengineeringnudge
by shihchengwei-lab Aug 12, 2026 6/10
skill GitHub
A Claude Code skill for academic manuscript writing, covering IMRAD-structured workflows, literature matrices, and table and figure preparation, with tested utility scripts included.
academicimradwritingresearch
by kgraph57 Aug 12, 2026 6/10
skill GitHub
A battle-tested personal skill collection covering quality-gated feature delivery, senior-level review, issue and merge-request workflow, branch wrap-up, book distillation, context saving, human-sounding technical writing, and a learning mentor.
skillscode-reviewquality-gatesworkflow
by ohugonnot Aug 12, 2026 6/10
skill GitHub
A Claude Code skill, with an optional hook, that suppresses Claude's tendency to suggest it needs to pause or rest partway through a long session.
long-sessionshooksbehaviorskill
by mikegall13 Aug 12, 2026 6/10
skill GitHub
A design system for documents — analytical reports, diagrams, charts, decks, and long-form specs — output as self-contained HTML. Five Claude Code skills share a single semantic token contract so everything they produce looks like one system.
documentsdesign-systemhtmlreports
by Avinava Aug 12, 2026 7/10
skill GitHub
A free skill for debugging a machine you cannot log into, through an operator who cannot debug it — aimed at air-gapped, client-owned, and change-controlled estates. Git serves as the transport in both directions.
air-gappeddebugginggitoperations
by dbhq-uk Aug 12, 2026 7/10
skill GitHub
A Claude Code skill running a nine-phase web application security audit and hardening program covering API, LLM, OAuth, database, supply chain, and detection concerns. Also includes a crawl-boundary policy for AI crawlers, AWS hardening guidance, and read-only audit scripts.
securityaudithardeningweb
by parousia8888 Aug 12, 2026 7/10
skill GitHub
A skill for Codex or Claude Code that walks through building a Uniswap v4 hook, testing it, and preparing a Programmable launch submission.
uniswapsoliditydefiweb3
by 0xprogrammable Aug 12, 2026 5/10
skill GitHub
A Claude Code skill that forces the agent to present a seven-part plan in plain English before writing any code. Released into the public domain.
planningtransparencypublic-domainskill
by CraniusMaximus Aug 12, 2026 6/10
skill GitHub
Claude Code skills for academic research support: paper review, bibliography verification, literature surveying, head-to-head paper comparison, and managing HPC experiment campaigns.
academicresearchbibliographyhpc
by chgagne Aug 12, 2026 6/10
skill GitHub
A pure-Markdown system prompt kit built to cut generic AI output. It composes a universal core with per-domain modules across 16 categories and 92 sub-fields, is bilingual EN/ID, and ships an eval harness to verify the prompts do what they claim. Worth a look if you maintain CLAUDE.md files for work outside software.
prompt-engineeringmarkdownanti-slopevalclaude-md
by TegarTheGreat Aug 12, 2026 7/10
skill GitHub
A public dump of one engineer's working Claude Code configuration — settings.json, hooks, permission allowlists, plugins, and custom skills. The value is in seeing which permissions and hooks someone actually keeps after daily use, rather than a curated demo. Good starting point for tuning your own setup.
confighookspermissionssettingsdotfiles
by slogsdon Aug 12, 2026 6/10
skill GitHub
A personal but curated collection of Claude Code plugins grouped around research, productivity, and development workflows. Installable as a marketplace, so you can pull just the pieces you want. One of many such collections — skim it for the research-oriented plugins in particular.
pluginsmarketplaceresearchproductivity
by jontsai Aug 12, 2026 6/10
skill GitHub
A German-language skill set that turns arbitrary source material into printable study cards — A4 pages, 8 cards per sheet, laid out for duplex printing. Handles the layout details that usually make DIY flashcard generation annoying. Useful template even if you adapt it to another language.
skillflashcardslearningprintinggerman
by mhabedank Aug 12, 2026 6/10
skill GitHub
An Agent Skill that runs GCA and ICA style coding assessments in your terminal with a deterministic timer and hidden-test grading. Questions are original rather than scraped from question banks. A neat demonstration of a skill that enforces constraints on you rather than helping you write code.
skillinterviewassessmentpracticeterminal
by chrisjacksonn Aug 12, 2026 7/10
skill GitHub
Agent skills that push coding assistants toward production-grade robotics software, covering ROS1, ROS2, design patterns, SOLID principles, and testing. Written as SKILL.md files, so they work with Claude Code, Cursor, Copilot, or anything else that reads the format. Narrow domain, but robotics code is exactly where unguided agent output tends to go wrong.
skillroboticsrostestingdesign-patterns
by arpitg1304 Aug 12, 2026 7/10
skill Reddit
A planning skill and CLI built on the premise that most agent-generated plans are never read because they are an unreadable wall of text. PlanX splits plans into collapsible sections, versions them, diffs revisions while hiding unchanged parts, and lets you leave line-level feedback or edit directly before sending it back for another pass. Once approved, the plan can be executed by any agent.
planningskillclireviewversioning
by Yellow-Minion-0 Aug 12, 2026 8/10
skill GitHub
A skill that intercepts loose requests and turns them into a structured brief before Claude Code starts working: goal, done-check, assumption, and scope fence. The done-check and scope fence are the useful parts — they give you something to verify the result against and a boundary the agent is told not to cross.
promptingscopingplanningbriefs
by sernoxxx Aug 11, 2026 6/10
skill GitHub
Ten skills aimed at the failure modes that quietly ruin LLM-assisted quant research: lookahead bias, at-the-money detection, survivorship bias, and transaction-cost realism. Notably it ships 11 reproducible evals showing 8 of the skills measurably improve Haiku's output, which is more evidence than most skill collections offer. MIT, works with Claude Code and Cursor.
quantfinanceevalsresearch
by jefrnc Aug 11, 2026 7/10
skill GitHub
A knowledge framework for AI-assisted single-cell RNA-seq analysis, packaged as reusable computational workflows. Aimed at bioinformaticians who want an agent to follow established scRNA-seq practice rather than improvising an analysis pipeline.
bioinformaticsrna-seqresearchgenomics
by Ryannachmand Aug 11, 2026 5/10
skill GitHub
Agent skills for the php-opcua ecosystem, with a SKILL.md automatically kept in sync for each package in the family. Works across Claude Code, Laravel Boost, Cursor and Copilot. A reasonable pattern to copy if you maintain a multi-package library and want agent guidance to track releases.
phpopcuaskillsindustrial
by php-opcua Aug 11, 2026 5/10
skill GitHub
A content-only collection of Claude Code skills — TypeScript audits, legal policy writing, SEO, agent memory — plus CLAUDE.md rule snippets. Nothing to compile: symlink a skill into .claude/skills and @-import the rule files into your own CLAUDE.md.
skillsclaude-mdtypescriptseo
by daanvandenbergh Aug 11, 2026 6/10
skill GitHub
Claude Code skills plus a zero-dependency CLI for planning an AWS re:Invent week. It scores sessions against your profile, builds conflict-free schedules that account for travel time between Las Vegas venues, and can produce team coverage plans so a group does not all attend the same talks.
awsconferenceplanningcli
by connor-tyndall Aug 11, 2026 6/10
skill GitHub
A single vault for collecting Claude Code skills so they can be found and reused across projects instead of being scattered per repo. Adds organization and a security review step on top of plain file storage.
skillsorganizationreusesecurity
by Synchronic-leafbud824 Aug 11, 2026 5/10
skill GitHub
A Claude Code skill that audits your UI before you ship and, rather than dumping one flat list, classifies every finding as a layout, interaction, copy or engineering problem. The routing is the useful part: it turns a design review into work items that already belong to someone.
uidesign-reviewauditqa
by PawlakCamille Aug 11, 2026 7/10
skill GitHub
A playbook that makes your coding agent run a website build like a foreman: it interviews you, forces the design and scope decisions up front, locks a visual system, writes the build brief, then verifies, ships and indexes the site. Available as a Claude Code plugin and Agent Skill, and it is markdown only — no scripts to install or trust.
websitescopingdesign-systemplaybook
by Turki-Sh Aug 11, 2026 7/10
skill GitHub
A collection of SDLC skills deliberately isolated by phase, so an autonomous agent handles requirements, design, implementation and verification as separate disciplined steps rather than blurring them. The isolation is the mechanism — it prevents the agent from jumping to code while requirements are still open.
sdlcprocessengineeringphases
by augments-labs Aug 11, 2026 6/10
skill GitHub
A three-mode SEO and GEO skill — audit, plan, execute — covering full site audits with scored findings, optimization for Google AI Overviews, ChatGPT and Perplexity, schema generation and E-E-A-T assessment. Ships 20 diagnostic scripts, so the audit findings come from real checks rather than model opinion.
seogeoauditschema
by mykpono Aug 11, 2026 5/10
skill GitHub
A Claude skill for writing human-sounding English, Russian, and Ukrainian, paired with a zero-dependency detector that flags common AI writing patterns. Useful if you draft docs, posts, or copy with Claude and want the output to stop reading like a model wrote it.
skillwritingmultilingualai-detection
by GitVoytenko Aug 11, 2026 6/10
skill GitHub
A published set of SKILL.md files from FullEnrich, packaged so the same definitions work as Claude skills, through MCP, or as a plugin. Worth a look mainly as a reference for how one team structures and distributes skills across all three delivery formats.
skillcollectionmcpplugin
by FullEnrich Aug 11, 2026 5/10
skill GitHub
A Claude Code skill for security testing focused on OS command injection and argument injection. Packages the methodology so the agent probes for these specific classes systematically instead of relying on whatever it recalls about them.
skillsecuritycommand-injectiontestingappsec
by snowflakeovo Aug 11, 2026 7/10
skill GitHub
Generates a single charter file per repository that every coding agent reads, instead of maintaining separate CLAUDE.md, AGENTS.md, and tool-specific config. Aims for lean prompts plus guardrails that are actually verified rather than just stated. Useful if your team switches between agents or runs more than one against the same codebase.
claude-mdagents-mdcontextmulti-agentconfiguration
by 7fromheaven Aug 11, 2026 7/10
skill GitHub
A multi-skill plugin for the case where several CC sessions share a single repository. Covers an issue-pickup claim protocol so two agents do not grab the same work, worktree isolation pitfalls, recovering from conflicting parallel PRs, subagent integrity checks, and squash/merge mechanics. The most detailed treatment of parallel-session collisions posted so far.
parallel-sessionsworktreesgitskillsplugincoordination
by wan-huiyan Aug 11, 2026 8/10
skill GitHub
A skill that lets an agent search and book flights, auto-installing the atlas-flight CLI on first use. Demonstrates the pattern of a skill that bootstraps its own binary dependency. Niche, but a clean template for wrapping any CLI as a skill.
skilltravelclibooking
by atlas-doc Aug 11, 2026 5/10
skill GitHub
A set of Claude Code skills that interrogate the premise of a change before it gets built, rather than checking the code after. The argument is that code review, linters, and security scanners are all structurally downstream of the scoping decision. Sits at planning time, not review time.
skillscopeplanningreview
by Snowfly0709 Aug 11, 2026 7/10
skill GitHub
An open collection of Agent Skills spanning frontend engineering, secure coding practices, research, automation, and Meta Ads workflows. Follows the open Agent Skills standard so it works beyond Claude Code. Breadth over depth, but the secure-coding entries are worth a look.
skillsfrontendsecuritycollection
by sergeyizmailov Aug 11, 2026 5/10
skill GitHub
Open-source skills that separate the creative image-generation handoff from deterministic asset processing like resizing and format conversion. The deterministic half runs as real code rather than model output. Useful pattern for anything where you want the model to decide but not to compute.
skillimagesassetspipeline
by x0c Aug 11, 2026 5/10
skill GitHub
A Human Maintainability Assessment skill that evaluates whether a codebase remains workable by people, not just by agents. Produces a structured assessment rather than a lint report. Relevant as AI-generated code accumulates in projects humans still have to own.
skillmaintainabilitycode-qualityassessment
by hmr-BH Aug 11, 2026 5/10
skill GitHub
A skill that fetches, analyzes, and categorizes AI news on a daily schedule into a digest. Runs entirely through Claude Code rather than a separate service. Chinese-language documentation and output.
skillnewsautomationdigest
by geekjourneyx Aug 11, 2026 5/10
skill GitHub
A skill that reshapes Claude into a careful project partner: it plans in plain language, keeps durable state across sessions, and refuses to call work done without a passing check. Aimed at non-expert users who cannot easily audit the model's claims. The completion gate is the substantive part.
skillplanningverificationstate
by khalilmaaouni Aug 11, 2026 5/10
skill GitHub
Turns a loose requirements document into structured Jira stories alongside an HTML portal with architecture, UI flow, and customer journey diagrams. Runs as a Claude Skill or as ChatGPT custom instructions. The diagram portal is the differentiator over plain ticket generation.
skilljirarequirementsdiagrams
by kirti Aug 11, 2026 6/10
skill Reddit
A skill set adapted from Karpathy's research repo that freezes the success metric, changes one thing, re-measures, then keeps or discards. Applied to prompts, copy, and configuration rather than model training. Guards against the common failure of agents shipping changes that quietly make things worse.
skillexperimentsevaluationresearch
by Free_Tennis7754 Aug 11, 2026 6/10
skill GitHub
A bundle of 23 curated Agent Skills for Claude Code, installable as a single plugin instead of one-by-one. Once installed the skills are available across projects. Worth skimming for individual skills to lift even if you do not want the whole set.
skillsplugincollection
by Drizzy07x Aug 11, 2026 6/10
skill Reddit
Not a runtime — markdown skills, slash commands, and model-pinned subagent definitions dropped into .claude/ that Claude Code reads as a disciplined pipeline: intake, analyze, plan, score, parallel subagents, review, verify, ship. The orchestrator never writes code itself; it scores each task 0-100 and routes accordingly. Installs via npm.
skillsorchestrationsubagentspipelineslash-commands
by JoR0th Aug 11, 2026 7/10
skill GitHub
Independent Agent Skills covering repository analysis, planning, implementation, review, delivery, design, and runtime verification. Each is usable on its own rather than as a mandatory pipeline. Reasonable starting point for assembling a per-phase skill set.
skillsreviewverificationplanning
by idaibin Aug 11, 2026 5/10
skill GitHub
A Claude Code skill implementing buyer's-agent CMA methodology for Australian units and apartments using only free data sources. Open-sourced by Avocado Wealth. Domain-specific, but a solid example of encoding professional methodology into a skill.
skillreal-estateaustraliaanalysis
by mra2898 Aug 11, 2026 5/10
skill GitHub
A skill that guides Claude through building MCP servers, encoding protocol conventions and structure so you do not re-explain them each time. Minimal, focused scope. Useful if you write MCP servers regularly.
skillmcpdevelopment
by cyberreinxy Aug 11, 2026 5/10
skill GitHub
Checks writing and interface copy for the telltale patterns of AI-generated text, applies your own voice, then runs a final review pass. Includes safe update handling and an optional hook to run it automatically. Addresses the tone problem rather than the correctness problem.
skillwritingstylehook
by Rlegaspi562 Aug 11, 2026 6/10
skill GitHub
Three general-purpose skills validated on real projects: new-convo-handoff for carrying long projects across sessions, first-principles for reasoning from fundamentals, and clarify-until-clear for forcing disambiguation before work starts. Follows the open SKILL.md standard. Chinese-language documentation.
skillshandoffplanningclarification
by sichenai Aug 11, 2026 5/10
skill GitHub
A Claude Code skill encoding an architecture and code-quality standard for Unity and C# game code. Covers game programming patterns, Gang of Four patterns, code smells and refactorings, SOLID, and Unity-specific pitfalls. Substantial domain depth for a single skill.
skillunitycsharparchitecturegamedev
by alpershin Aug 11, 2026 6/10
skill GitHub
A Claude Code skill that shells out to OpenAI's Codex CLI for a second opinion, to hand off a task, for analysis, or to generate an image. Makes cross-model consultation a single invocation instead of a manual context copy. Russian-language documentation.
skillcodexcross-modelsecond-opinion
by warodan Aug 11, 2026 6/10
skill GitHub
Turns PhD weekly notes, papers, results, and figures into evidence-grounded lab meeting reports. Ships adapters for Feishu, Notion, and slide output. Grounding claims in the supplied evidence is the explicit design goal.
skillresearchreportsnotionacademia
by LikC1606 Aug 11, 2026 5/10
skill Reddit
An open-source framework that makes an AI behave like an experienced research mentor — clarify the question before picking methods, prefer established solutions, avoid unnecessary complexity, and check whether claims are actually supported by evidence. Can review ideas, study designs, manuscripts, references, and methodological choices. The author is explicitly asking for critical feedback.
skillresearchmethodologyreview
by Ashamed_Charity_7063 Aug 11, 2026 5/10
skill GitHub
Official Sequence skills for automating money movement from Claude Code. Encodes the platform's operations as agent-callable steps. Vendor-specific but officially maintained.
skillfintechpaymentsofficial
by getsequence Aug 11, 2026 5/10
skill GitHub
A collection of 121 Dutch-language skills for Claude and any agent following the open Agent Skills standard. Published free by theseo.nl. Notable mainly for its scale and for serving a non-English audience.
skillsdutchcollectionlocalization
by GianlucaNaarden Aug 11, 2026 5/10
skill GitHub
A set of reusable Laravel-focused skills usable from Claude Code, Codex, and other AI coding assistants. Encodes framework conventions so they do not have to be re-explained per project. Straightforward but useful for Laravel shops.
skilllaravelphpframework
by soden46 Aug 11, 2026 5/10
skill GitHub
Twenty-two skills aimed at game developers across Unity, Unreal, Godot, and Roblox, plus level design, narrative design, and shader authoring. Covers design disciplines and not only code. One of the broader domain-specific skill sets published so far.
skillsgamedevunityunrealgodot
by prvthmpcypher Aug 11, 2026 6/10
skill GitHub
A Claude Code skill for driving Spring Boot features, bug fixes, and refactors test-first using JUnit, Mockito, MockMvc, and Testcontainers. Enforces the test-before-code ordering rather than suggesting it. Built on the affaan skill framework.
skillspringjavatestingtdd
by agenticluke Aug 11, 2026 6/10
skill GitHub
SQD's officially maintained collection of agent skills for working with their indexing platform. First-party, so it tracks the current API. Relevant for Web3 data indexing work.
skillsweb3officialindexing
by subsquid-labs Aug 11, 2026 5/10
skill GitHub
Paymob's official skill covering the Intention API, HMAC verification, mobile wallets, BNPL, and Apple Pay across Node.js, Python, PHP, Flutter, and more. Being first-party means the integration details stay current. A good example of a payment provider shipping agent-ready docs.
skillpaymentsofficialapiintegration
by PaymobAccept Aug 11, 2026 6/10
skill GitHub
A curated set of modular skills intended to be mixed and matched across LLM-based agents. Each skill is self-contained rather than part of a fixed pipeline. General-purpose collection.
skillscollectionmodular
by oliverb-io1902e8 Aug 11, 2026 5/10
skill GitHub
Ten Claude skills that generate structured video prompts for Seedance 2.0 on Higgsfield, spanning viral hooks, SaaS demos, personal brand, faceless content, and luxury aesthetic. Encodes prompt structure per format rather than leaving it freeform. Marketing-oriented rather than engineering-oriented.
skillsvideopromptscontentmarketing
by rediumvex Aug 11, 2026 5/10
skill GitHub
A skill that turns text, a script, or a screenshot into ready-to-post captions for Instagram Reels and Carousels, TikTok, Threads, Facebook, and YouTube Shorts. Tuned toward shares, saves, and completion rate per platform. Built by a creator with a large Instagram following.
skillsocial-mediacontentmarketing
by rediumvex Aug 11, 2026 5/10
skill GitHub
Three skills encoding Alex Hormozi's frameworks: building offers, running a 0-to-$10M business playbook, and writing cold outreach. Turns a well-known business methodology into agent-callable steps. Business-oriented rather than technical.
skillsalesoutreachbusiness
by rediumvex Aug 11, 2026 5/10
skill GitHub
A Claude Code skill plus watchdog runner that delegates tasks to OpenAI Codex (GPT models) as a subagent, with no background daemon required. Claude dispatches the work and the watchdog supervises the run and returns the result. Useful for cross-model second opinions or offloading work to a different model without leaving your session.
codexsubagentskillmulti-model
by caesay Aug 11, 2026 7/10
skill GitHub
An opinionated bundle of Claude Code configuration — CLAUDE.md baselines, skills, slash commands, and hooks that enforce the stated rules. It is meant to be copied into any project as a starting point rather than assembled piece by piece. A useful reference if you are standardizing setup across several repos.
claude-mdskillsslash-commandshooks
by Cristhianzl Aug 11, 2026 6/10
skill GitHub
An Agent Skill that applies systems-engineering discipline to prototype agent workflows, pushing them toward defined structure and explicit validation. It targets the stage where a working hack needs to become something maintainable. Installs as a skill rather than requiring a framework migration.
skillsystems-engineeringvalidationrefactoring
by Odinary-AI Aug 11, 2026 6/10
skill GitHub
Eight Claude Code skills targeting enterprise customer success work: health scoring, QBR preparation, onboarding diagnostics, and punchout troubleshooting. A useful example of packaging non-engineering business processes as skills. Niche unless you work in enterprise CS.
skillscustomer-successenterpriseqbronboarding
by Prashanthvara Aug 10, 2026 5/10
skill GitHub
A set of skills for Claude Code and Codex that drives automated testing from a PRD or prototype rather than from ad hoc prompts. Covers requirement clarification, test planning, execution gating, evidence collection, XMind mind maps, and regression runs. Documentation is in Chinese.
testingprdqaregressionchinese
by dszblackmagic Aug 10, 2026 6/10
skill Reddit
Report that when two instructions in CLAUDE.md conflict, Opus 5 silently commits to whichever appears later in the file and drops the earlier one, instead of wavering or raising the conflict. Older models tended to split the difference, which at least made the contradiction visible in the output. Practical takeaway: audit your instruction file for conflicts and put the rule you actually want lower in the file.
claude-mdopus-5instructionscontext-engineering
by cleverhoods Aug 10, 2026 7/10
skill GitHub
An open, freely licensed collection of Agent Skills that work in both Claude Code and Claude Desktop. Useful as a starting library if you want working skill examples to copy and adapt rather than authoring from scratch.
skillscollectionclaude-desktopopen-source
by jmadden Aug 10, 2026 6/10
skill GitHub
Seven methodology skills aimed at the failure modes where an agent invents data, reports work as done when it is not, or loses context when a session hands off. Each skill pushes the agent toward claims that can be verified and traced back to evidence. Bilingual Chinese and English documentation.
verificationhallucinationskillstraceabilitychinese
by billyzhou0-0 Aug 10, 2026 6/10
skill GitHub
A Claude Code plugin that produces presentations as one self-contained .html file you can double-click and view with the network off. It enforces a 163-rule design system, runs a build check that names every rule it could not satisfy, and finishes with a deliberately blunt critique pass. Targets the problem of slides that visibly look machine-generated.
presentationshtmldesign-systempluginoffline
by uchimata2 Aug 10, 2026 7/10
skill GitHub
A Claude Code plugin for building NestJS bounded contexts using hexagonal architecture, DDD, CQRS, and event-driven patterns. Bundles 10 skills and 8 agents split across Opus and Sonnet, with a TDD workflow and GSD compatibility. Opinionated but concrete if you already work this way.
nestjsdddcqrshexagonaltddplugin
by Softtor Aug 10, 2026 6/10
skill GitHub
A Claude Code skill that generates HTML email using MJML so the output survives real mail clients. Output is Outlook-safe, Gmail-optimized, and meets WCAG 2.1 AA accessibility. Removes most of the trial and error from hand-writing table-based email markup.
emailmjmlhtmlaccessibilityskill
by framix-team Aug 10, 2026 6/10
skill GitHub
A Claude skill that reviews and rewrites text to remove the stylistic tells of AI generation while preserving the author voice. Rather than a generic humanizer, it works from your existing writing as the reference point. Useful for anyone drafting with Claude but publishing under their own name.
writingstyleeditingskillvoice
by smartwatermelon Aug 10, 2026 7/10
skill GitHub
A collection of skills that give AI agents domain knowledge of French administrative processes, with specialized roles such as accountant and notary. Narrow in scope but a good template for how to package regional or regulatory expertise as agent skills. Documentation is in French.
skillsfrancebureaucracydomain-expertisefrench
by romainsimon Aug 10, 2026 5/10
skill Reddit
A plugin of nine Claude Code skills for job hunting that scores you against the other applicants in a req's queue rather than against the job description itself. An onboarding interview writes four files you keep (profile, preferences, stories, search state), and subsequent commands search job boards and tailor material against them. The argument is that a 91% JD match is a rejection if the queue's 75th percentile sits at 94%.
job-searchskillsresumeplugin
by aaddrick Aug 10, 2026 7/10
skill GitHub
A Claude skill that takes a single character illustration and produces a full hand-drawn-style deck around it, including research with cited sources plus charts, tables, and flow diagrams. Supports Korean and English.
slidesdesignkoreanresearch
by moongiadventures-dev Aug 10, 2026 5/10
skill GitHub
Consolidates a project's accumulated agent memory in passes: a read-only 'dream' pass that only proposes, a checkbox and validator gate before anything is written, and a full-auto mode once you trust it. Every run snapshots first and rolls back with one command, and the tooling never calls rm.
memoryconsolidationsafetyrollback
by timoncool Aug 10, 2026 7/10
skill GitHub
A focused skill that rewrites text to remove the recognizable markers of LLM-generated writing. Small and single-purpose, which makes it easy to chain into any writing workflow.
writingeditingprose
by nickali Aug 10, 2026 6/10
skill GitHub
An agent skill for content strategy work: ranks the questions your audience actually asks, then maps them to topics, formats, channels, and where to invest. Business-side rather than engineering, but it is a real skill you can install.
content-strategymarketingplanning
by klinkoai Aug 10, 2026 5/10
skill GitHub
A product positioning skill that works from audience evidence, customer needs, alternatives, and market gaps toward messaging you can actually test. Companion to the same author's content strategy and idea validation skills.
positioningmarketingproduct
by klinkoai Aug 10, 2026 5/10
skill GitHub
Walks through market validation for a startup idea: which assumptions are load-bearing, whether demand exists, what the alternatives are, and whether anyone is willing to change behavior. Meant to run before you write code, not after.
validationstartupproduct
by klinkoai Aug 10, 2026 5/10
skill GitHub
A toolkit for authoring agent skills for Claude Code, Codex, and OpenCode that pairs every skill with a baseline eval, so you can measure whether the skill actually changed behavior versus the model doing it anyway. That baseline comparison is the part most skill repos skip.
skillsevalstestingcodexopencode
by ecoma-io Aug 10, 2026 8/10
skill GitHub
A persistent memory store plus a Claude Code skill that teaches the agent how to boot from it, recall relevant pieces, and consolidate new material at the end of a session. The skill half is what distinguishes it from a plain memory database.
memorypersistencecontext
by ChrisZhangJin Aug 10, 2026 6/10
skill GitHub
A Korean-language polishing and translation-verification skill that identifies and reduces telltale AI style markers, with justification for each change rather than blanket rewriting.
koreanwritingtranslation
by dillettante Aug 10, 2026 5/10
skill GitHub
A skill and subagent pair for production architecture work, auditing and designing for scalability, security, performance, and reliability. Its stated constraint is that it never fabricates a configuration number, which is the usual failure mode of architecture advice from LLMs.
architectureauditsubagentproduction
by dankofly Aug 10, 2026 6/10
skill GitHub
Probes a SKILL.md, AGENTS.md, or CLAUDE.md to find out whether a change to it actually altered agent behavior, applies fixes that three independent skeptic passes agree on, and re-checks that the description still routes correctly. Treats agent-consumed documents as things you test, not things you hope about.
skillsevalsclaude-mdtesting
by StartupBros-com Aug 10, 2026 8/10
skill GitHub
Turns a finished agent session into a structured handoff document containing what was decided and what remains, so the next session can act without re-diagnosing the problem. A cheaper alternative to dragging a long transcript forward.
handoffcontextsessioncontinuity
by Xuepoo Aug 10, 2026 6/10
skill GitHub
A Claude Code skill that finds hardcoded UI strings that never made it into a translation catalog, and keeps catalogs in sync across seven different i18n frameworks. Exactly the tedious, mechanical check that agents are good at and humans skip.
i18ntranslationlintingfrontend
by omerfarukorc Aug 10, 2026 7/10
skill GitHub
Takes a single content brief and produces publish-ready vertical video for TikTok and Douyin using AI agents for the intermediate steps. Aimed at people running content pipelines rather than one-off edits.
videotiktokcontentautomation
by Trudiemisanthropic314 Aug 10, 2026 5/10
skill GitHub
Scaffolds a new Angular project on the latest stable release together with a .agents/ documentation tree that maintains itself, or retrofits that tree onto an existing project. Works with Claude Code and Codex.
angularscaffoldingdocstypescript
by kikita-labs Aug 10, 2026 5/10
skill GitHub
A working repository for experimenting with Claude Code skills, agents, and commands, with an emphasis on iterating and measuring them rather than just collecting them. Chinese-language docs.
skillsexperimentschineseagents
by fongzhizhi Aug 10, 2026 5/10
skill GitHub
Twelve independent agent skills covering patent search, document-to-skill conversion, web scraping, local OCR, project migration, Obsidian and OneNote note handling, remote deployment, and multi-machine sync. Each is self-contained, so you can take one without the rest.
skillsocrresearchobsidian
by Linearl Aug 10, 2026 6/10
skill GitHub
A design skill that refuses to show you its work until the output passes an eight-point quality gate, shipping alongside a maintained catalog of other design skills worth installing next to it.
designfrontendquality-gateui
by Zealotic-spec Aug 10, 2026 6/10
skill GitHub
Seven skills designed to work together: prompt polishing, an engineering workflow, web research, knowledge ingestion, an advisory board, and focus group simulation. The interconnection is the pitch, since output from one feeds naturally into the next.
skillsresearchpromptsworkflow
by Abed-Zahed Aug 10, 2026 6/10
skill GitHub
A CLI and skill for producing short-form video locally, wiring together Seedance 2.0, Gemini Omni Flash, ElevenLabs, and ffmpeg. No web UI, so it drops into scripted pipelines.
videoffmpegttscli
by karamusluk Aug 10, 2026 6/10
skill GitHub
A Claude Code skill that identifies your target role, compares your LinkedIn profile against actual current postings for it, and hands you the replacement text. Concrete output rather than general advice.
careerlinkedinjob-search
by iverunamok Aug 10, 2026 5/10
skill GitHub
Scaffolds a NestJS project on the latest stable release, as a REST API, a bot, or both, alongside a .agents/ documentation tree that keeps itself current. Companion to the same author's Angular skill.
nestjsscaffoldingdocstypescript
by kikita-labs Aug 10, 2026 5/10
skill GitHub
A requirements framework pairing BRD, NFR, and ADR templates with explicit quality rules, plus agent skills that both draft documents and review them against those rules. Templates and prompts are structured to stay in sync rather than drifting apart.
requirementstemplatesanalysisadr
by YuliaMelekhova Aug 10, 2026 6/10
skill GitHub
Captures your coding preferences from real signals during sessions and stores them as plain markdown you can read, edit, and delete, shared across a team over git. The readability and the delete path are what separate it from opaque memory systems.
preferencesmemorymarkdowngit
by toshon-jennings Aug 10, 2026 7/10
skill GitHub
A Claude Code plugin marketplace of evidence-based security auditing skills, including constant-time crypto review, checks for whether mitigations survived compilation into the binary, and zero-trust codebase audits. Considerably more specialized than generic 'find vulnerabilities' skills.
securityauditcryptographymarketplace
by Quant-Off Aug 10, 2026 7/10
skill GitHub
An agent skill encoding Diátaxis documentation practice for Kaltura's docs, installable via Claude Code, GitHub Copilot, and Claude Desktop. Vendor-specific in its content, but a usable reference for how to encode a documentation framework as a skill.
documentationdiataxiswriting
by kaltura Aug 10, 2026 5/10
skill GitHub
A pre-ship audit skill for SaaS products that take money, targeting the billing and tenant data-isolation gaps that generic scanners miss on Next.js, Supabase, and Stripe stacks. Narrow stack focus is what lets it check things a general scanner cannot.
securitysaasstripesupabaseaudit
by Comoco235 Aug 10, 2026 7/10
skill GitHub
A Claude Code skill that sweeps up scattered web clippings, deduplicates and archives them, then distills each into two layers: source excerpts and your own commentary. Bilingual Chinese and English.
notesknowledge-baseclippingchinese
by logog782-cmyk Aug 10, 2026 5/10
skill GitHub
A note-taking skill for a personal knowledge base built around one-sentence capture, verified recall rather than hallucinated retrieval, and tags that grow out of your own notes instead of a fixed taxonomy. Bilingual Chinese and English.
notesknowledge-basememorychinese
by logog782-cmyk Aug 10, 2026 5/10
skill GitHub
Catalogs ten ways agents claim work is done when it is not, provides a taxonomy for classifying those claims, and defines a protocol for catching them before the change ships. Directly targets the most expensive agent failure mode.
verificationqualityprotocoltesting
by Nagacash Aug 10, 2026 7/10
skill GitHub
A small set of output styles pushing Claude toward plain, readable writing accessible to a general audience. Minimal in scope, which makes it easy to combine with other styles.
output-styleswritingreadability
by stefanobaghino Aug 10, 2026 5/10
skill GitHub
A multi-agent skill that reads a sprint from Jira or Azure DevOps and then verifies the work against how the repository is actually structured, rather than taking the ticket description at face value. Works with Claude, Codex, Hermes, Openclaw, and Copilot.
jiraazure-devopssprintmulti-agent
by wesleysimplicio Aug 10, 2026 6/10
skill GitHub
A Claude Code skill toolkit for teams modernizing SDLC under regulatory constraints, covering research digests, Copilot and GHAS governance, and an Obsidian-backed knowledge vault. Specific to regulated contexts, which most agent tooling ignores.
researchgovernanceobsidiancompliance
by themarmack Aug 10, 2026 5/10
skill GitHub
Output styles that make agent responses easier to actually read: shorter, more human, structured for attention rather than completeness. Reduces token spend as a side effect of reducing verbosity.
output-stylesaccessibilityreadability
by alexgreensh Aug 10, 2026 6/10
skill GitHub
A project-agnostic skill pack for product and technical program management: PRD generation, roadmap prioritization, build-versus-buy analysis, and TPM program mechanisms. Reusable across projects rather than tied to one codebase.
productprdroadmapprogram-management
by pavani-aiml-space Aug 10, 2026 5/10
skill GitHub
A Claude Code skill that reshapes responses into ASCII status boards, flow chains, and case matrices rather than long paragraphs. The goal is faster scanning of agent output when you want state and branching at a glance. A small, focused output-formatting skill.
skilloutput-formatasciireadability
by faridjaff Aug 10, 2026 6/10
skill GitHub
A Claude Code skill that wraps PaddleOCR so non-multimodal models can extract text from images. It fills the gap when you are running a text-only model but still need to read screenshots, scans, or diagrams. Documentation is bilingual (Chinese/English).
skillocrpaddleocrimagesvision
by BFRKQSB7 Aug 10, 2026 6/10
skill GitHub
A curated aggregation of AI engineering workflow skills, collected into one installable repo. It serves as a starting pack for people who want established workflow patterns rather than authoring skills from scratch. Sourced from the maintainer's broader skills collection.
skillscollectionai-engineeringworkflow
by wakqasahmed Aug 10, 2026 5/10
skill GitHub
A collection of 103 ready-to-use agent skills that ship as full SKILL.md workflows rather than pointers to other repos. The skills work across Claude Code, OpenAI Codex, Gemini CLI, Cursor, Copilot, Windsurf, and other Agent Skills-compatible tools. Useful as a browsable library when you want a working skill immediately.
skillscollectioncross-toolskill-md
by seb1n Aug 10, 2026 7/10
skill GitHub
A set of Claude Code skills that rewrite AI-drafted prose through structural rewrite, tell removal, and cross-model diction passes, scored against the Pangram detector. It also includes reference management and citation auditing skills for research writing. Worth noting the detector-evasion framing is contentious in academic and publishing contexts.
skillswritingeditingcitationsprose
by petar-djukic Aug 10, 2026 5/10
skill GitHub
A set of twenty Claude Code skills for knowledge work in an Obsidian vault, including connect, contradict, emerge, trace, ghost, and weekly-learnings. They target synthesis over retrieval, surfacing contradictions and emergent themes across notes rather than just searching them. Useful if your notes live in Obsidian and you want an agent working the vault.
skillsobsidiannotesknowledge-worksynthesis
by slogsdon Aug 10, 2026 6/10
skill Reddit
A plugin that removes instruction patterns written for weaker models, which the Claude 5 family now follows too literally: CRITICAL/YOU MUST shouting, verify-your-work charms, and Stop hooks that re-fire on unchanged state. The author's argument is that compensation written for an older model becomes a curse on a stronger one, producing death spirals and off-task behavior. Packaged so you can apply the cleanup to your own repo's memory files, hooks, and agent definitions.
pluginpromptingopus-5claude-mdhooks
by MickQn Aug 10, 2026 7/10
skill Reddit
A Claude Code skill that automates the manual copy-paste dance of writing with one model and reviewing with another. Claude drives the loop while Codex handles writing, review, and fixes. Requires the Codex plugin to be installed, and the author notes it is early-stage.
skillcodexreview-loopcross-model
by Ranteck Aug 10, 2026 6/10
skill GitHub
An experimental markdown-based instruction layer for AI coding tools that pushes sharp defaults, explicit decisions, and verification before declaring work done. It targets Claude Code, Cursor, and Codex from one shared source, and is designed to refine itself over time as you use it. Flagged experimental by the author.
claude-mdpromptingcross-toolverification
by mehrad-dm Aug 10, 2026 5/10
skill GitHub
An agent skill for Codex and Claude Code that decomposes complex coding work into a requirements matrix, then checks invariants and runs independent reviews before completion. The structure is meant to stop partial implementations from being reported as done. Works across both CLIs from the same skill definition.
skillrequirementsverificationreviewcodex
by JoeMarsh Aug 10, 2026 6/10
skill GitHub
A domain-intelligence skill pack for agents operating in the Indonesian business environment, covering compliance, tax, legal, and operational workflows. It is a useful example of encoding jurisdiction-specific knowledge into agent skills rather than relying on model recall. Niche by design, but a good template for other regions.
skillscompliancetaxlegalindonesia
by adamriofc Aug 10, 2026 5/10
skill Reddit
An open-source Claude Code skill that forces a research pass before implementation: it searches arXiv for relevant papers, reads related work, and picks an architectural approach before any code is written. The author's argument is that agents default to building every service from scratch, which produces slow and fragile projects. Aimed at people who want design decisions grounded in prior art rather than improvised.
system-designarxivresearcharchitecture
by Uditakhourii Aug 9, 2026 6/10
skill GitHub
A starter pack bundling twelve slash commands, four subagent definitions, and three CLAUDE.md templates aimed at real engineering workflows rather than demos. Good pick if you want a working baseline configuration to adapt rather than assembling one command at a time.
slash-commandssubagentsclaude-mdtemplates
by dacode-dev Aug 9, 2026 6/10
skill GitHub
A skill and plugin distribution designed to install cleanly on both OpenAI Codex and Claude Code from one source. Useful if you switch harnesses and do not want to maintain two divergent copies of the same skills.
skillscross-platformcodexplugins
by ValentinNikolaev Aug 9, 2026 5/10
skill GitHub
A Claude Code skill for laying out multi-agent work as a dependency graph rather than a linear pipeline, so independent branches can run concurrently and only genuine dependencies serialize. One of several projects converging on graph engineering as a term.
multi-agentgraphorchestrationparallelism
by HM-Li Aug 9, 2026 7/10
skill GitHub
A Chinese-language open-source skill collection covering goal definition (leader), code tidiness (neat-freak), analysis, and writing. Packaged to work across Claude Code, Codex, and a broad set of other agents.
skillscollectionchinesecross-platform
by KKKKhazix Aug 9, 2026 5/10
skill GitHub
A set of methodology skills for Claude Code agents covering planning, test-driven development, diagnosis, and architecture. Encodes engineering process as skills rather than hoping the model brings the discipline itself.
methodologytddplanningarchitecture
by ninthhousestudios Aug 9, 2026 6/10
skill GitHub
A curated set of Claude Code plugins covering general productivity and development workflows, published as one installable collection.
pluginscollectionproductivity
by fakoli Aug 9, 2026 5/10
skill GitHub
A Claude Code skill and guided pathway for developing PaperMC (Minecraft server) plugins. Narrow domain, but the kind of API-specific grounding that stops an agent inventing method signatures.
minecraftpapermcplugin-devskill
by Y2Kwastaken Aug 9, 2026 5/10
skill GitHub
A Claude Code plugin bundling six skills aimed at producing landing pages at the visual quality bar of Awwwards submissions. For people who find agent-generated marketing pages competent but generic.
designlanding-pagesfrontendplugin
by alanvaa06 Aug 9, 2026 6/10
skill GitHub
A Claude Code skill that reviews a screen or feature for the product and UX details people routinely forget — empty states, error paths, loading, edge cases — before it ships. A checklist pass that costs one prompt.
uxreviewchecklistproduct
by LunkiBR Aug 9, 2026 6/10
skill GitHub
A single-purpose Claude and agent skill for tracking Google Flights prices, installable with npx skills add. One of a small family of narrow Google API skills from the same author.
flightsgoogleskillnpx
by johnisanerd Aug 9, 2026 5/10
skill GitHub
A companion skill to the flights tracker, focused on surfacing Google Flights deals rather than watching a specific route. Installs via npx skills add.
flightsgoogleskillnpx
by johnisanerd Aug 9, 2026 5/10
skill GitHub
A Claude and agent skill wrapping the Google Maps Street View API so an agent can pull street-level imagery for a location. Installs via npx skills add.
google-mapsstreet-viewskillnpx
by johnisanerd Aug 9, 2026 5/10
skill GitHub
A Claude and agent skill for downloading photos from Google Maps places. Narrow by design; installs via npx skills add.
google-mapsphotosskillnpx
by johnisanerd Aug 9, 2026 5/10
skill GitHub
Agent skills for Australian public-practice accounting covering BAS, FBT, Division 7A, Single Touch Payroll, month-end close, and workpapers. A clear example of encoding jurisdiction-specific professional rules as skills rather than trusting the model's recall.
accountingaustraliacomplianceskills
by ryanduguid Aug 9, 2026 5/10
skill GitHub
A safety-hardened fork of the widely used obra/superpowers skill library, keeping the same skills but adding a mandatory preflight with five hard gates before any skill runs. Defends the machine, hardware, budget, and data — relevant given how much superpowers can do unattended.
superpowerssafetygatesfork
by JFWaskin Aug 9, 2026 7/10
skill GitHub
A Claude and Codex skill that forces an agent to research comparable projects, tradeoffs, costs, and failure conditions before it recommends how to build something. Counters the tendency to answer architecture questions from priors alone.
researcharchitectureadviceskill
by AaravKashyap12 Aug 9, 2026 6/10
skill GitHub
A skill for staging long-running tasks so they can resume across sessions, with automatic chat archiving. Aimed at work that outlives a single context window.
long-tasksresumearchiveskill
by minioutman Aug 9, 2026 5/10
skill GitHub
A free OSINT source-verification subagent written by a former intelligence analyst: it grades every source with the Admiralty system, flags single-source and uncited claims, catches circular reporting, and returns a calibrated verification note. Applies well beyond OSINT to any research an agent does.
osintverificationresearchsubagent
by beeswaxpat Aug 9, 2026 7/10
skill GitHub
A skill that audits a web application for mobile issues and applies the adaptations. Narrow and practical for the common case of a desktop-first build that needs to work on phones.
mobileresponsiveauditfrontend
by lovstudio Aug 9, 2026 5/10
skill GitHub
A single-purpose skill that installs and configures TanStack Query in a React project. The value of skills like this is getting current, correct setup rather than whatever version the model remembers.
reacttanstack-querysetupskill
by lovstudio Aug 9, 2026 5/10
skill GitHub
A Claude Code and Cowork skill that routes batch and grunt work to local LLMs via Ollama or LM Studio, to Codex CLI, or to Claude subagents, keeping your quota for work that needs it. Routing is per-task rather than per-session.
routingollamalocal-llmquota
by scottconverse Aug 9, 2026 6/10
skill GitHub
A skill that takes product requirements and generates a production-oriented application from them. Broad in scope, so expect to review the output, but useful as a structured starting point.
scaffoldingcodegenrequirementsskill
by lovstudio Aug 9, 2026 5/10
skill GitHub
A skill that audits and optimizes the Rust backend of a Tauri application. Narrow, but Tauri backends are exactly the kind of code where a model needs framework-specific grounding.
taurirustoptimizationaudit
by lovstudio Aug 9, 2026 5/10
skill GitHub
A complete Traditional Chinese translation of obra/superpowers — fourteen coding-agent skills — published with a GitHub Pages site offering paragraph-by-paragraph bilingual reading. Useful both as a translation and as a way to study the originals closely.
superpowerstranslationchineseskills
by shumingyang-opencode Aug 9, 2026 5/10
skill GitHub
A Claude skill for web scraping and page analysis through the Cloudflare Browser Rendering API, returning rendered HTML, screenshots, PDFs, Markdown, structured data, and crawls. No browser infrastructure to run yourself.
scrapingcloudflarebrowserskill
by TempoRoyale Aug 9, 2026 6/10
skill GitHub
A Claude skill and playbook for migrating a full Wix site to Astro on Cloudflare Workers, aiming for pixel-faithful output with measured results and stronger SEO than the original. Specific enough to be genuinely reusable if you have that migration ahead of you.
migrationastrowixcloudflare
by marian-kamenistak Aug 9, 2026 6/10
skill GitHub
A bilingual Claude skill that turns a rough one-sentence idea into a detailed build prompt intended to get near-finished quality on the first attempt. Front-loads the specification work you would otherwise do through several rounds of correction.
promptingspecificationskillchinese
by dittowang Aug 9, 2026 6/10
skill Reddit
An Agent Skill in the open SKILL.md format that provisions real backend services — Stripe, Postgres and similar — via their CLIs instead of hallucinating commands or quietly setting up a sandbox and calling it done. It asks for existing credentials first, looks up current official docs with the actual date, writes secrets only to .env, checks or creates .gitignore, and never prints keys back to the terminal.
backendprovisioningsecretsskill
by MonitorFlat4465 Aug 9, 2026 7/10
skill GitHub
A Claude Code skill for interfaces with a visual identity of their own: derive the concept from the subject matter, write it to disk as an artifact, then audit the built UI against it. Writing the concept down first is what makes the audit step meaningful.
designart-directionuiaudit
by audient-id4 Aug 9, 2026 6/10
skill GitHub
Makes coding-agent QA auditable with an ISTQB-aligned skill, traceable evidence, and deterministic verdicts, working across Codex, Claude Code, OpenCode, and other harnesses. The ISTQB grounding gives the verdicts a standard to point at in a regulated setting.
qatestingistqbaudit
by Jin-Doh Aug 9, 2026 6/10
skill GitHub
A set of AI skills covering social media strategy, content creation, and analysis across text-first platforms. General-purpose marketing tooling rather than developer workflow.
social-mediacontentmarketingskills
by Abwor9658 Aug 9, 2026 5/10
skill GitHub
A Japanese-language Claude Code plugin for generating diagram-heavy Google Slides decks that inspects coordinates offline before generation, catching overflow, overlap, text spill, and disconnected connectors without calling the API. The offline check is the clever part — layout bugs get caught before you burn API calls.
slidesgoogle-slideslayoutjapanese
by wfukatsu Aug 9, 2026 6/10
skill GitHub
A Claude Code skill for product design engineering that builds, redesigns, reviews, and repairs production UI with actual design judgement, adapting to your codebase rather than imposing a template. Covers web, Android, Apple, desktop, and cross-platform targets.
uidesignfrontendcross-platform
by aliimrankhan86 Aug 9, 2026 7/10
skill GitHub
The official AShareHub agent skill for querying Chinese A-share and ETF market data. Domain-specific data access rather than developer tooling.
financemarket-datachinaskill
by ChuYiCui1 Aug 9, 2026 5/10
skill GitHub
A portable agent skill running multi-model adversarial code review and producing a deterministic, machine-computed release verdict rather than a prose opinion. Works with Claude Code, OpenAI Codex, and any SKILL.md-compatible platform.
code-reviewmulti-modeladversarialrelease
by SathiaAI Aug 9, 2026 7/10
skill GitHub
A free Czech-language Claude Code skill for property valuation and price negotiation: three valuation methods, a guide to the land registry, and a negotiation playbook. A good example of local, jurisdiction-specific domain knowledge packaged as a skill.
real-estatevaluationczechskill
by konecny-lukas Aug 9, 2026 5/10
skill GitHub
Generates Apple-style bento grid cards as self-contained HTML files, built for AI coding agents to produce pixel-accurate output with no design tools involved. Narrow but effective for a layout pattern models routinely get slightly wrong.
designhtmlbento-gridlayout
by NxProxyStudios Aug 9, 2026 5/10
skill GitHub
A Claude Code skill for crafting high-quality AI image, video, and music prompts and executing them through the browser across more than fourteen generative platforms. Packages director-level prompt craft so you do not need it yourself.
mediapromptingvideoimage-generation
by Hao0321 Aug 9, 2026 5/10
skill GitHub
A Chinese-language Claude Code skill that converts content into self-contained, interactive, printable HTML guides — tutorials, explainers, comparisons, cheat sheets — with structure that adapts to the material.
htmldocumentationchinesetutorials
by BFRKQSB7 Aug 9, 2026 5/10
skill Reddit
A skill that tests each dependency update individually against your CI gates and then opens a single consolidated PR. Written out of frustration with Dependabot opening several PRs a week, each triggering a full pipeline run and, with continuous deployment, a separate deploy. The per-update testing is what keeps the single PR trustworthy.
dependenciescipull-requestsautomation
by Anaq42 Aug 9, 2026 7/10
skill GitHub
An open protocol for describing, validating, and rendering information design identically for humans, software, and AI agents on any platform, with 74 chart skills across 16 design languages. Ambitious in scope; the validation step is what would make agent-generated charts consistent.
visualizationchartsprotocoldesign
by babarda Aug 9, 2026 6/10
skill GitHub
An agent skill for identifying trends currently in their acceleration phase and selecting a matching monetization approach. Market-research oriented rather than developer tooling.
trendsresearchmonetizationskill
by mama-sh Aug 9, 2026 5/10
skill GitHub
Lets an AI running on a Mac build, operate, inspect, repair, and retest desktop applications on a real Windows PC. Solves a genuine cross-platform gap where the agent otherwise cannot see the target environment at all.
windowsmacostestingcross-platform
by wimi321 Aug 9, 2026 6/10
skill GitHub
Research-first project scaffolding for Claude Code that mines GitHub Issues for real production failures in comparable projects before writing a single file. Grounds early architecture decisions in what actually broke for other people.
scaffoldingresearchgithub-issuesarchitecture
by maioio Aug 9, 2026 7/10
skill GitHub
A curated skill list where each entry is read in full, trimmed of Claude Code-only dependencies, checked against claude.ai's upload requirements, and labeled by where it actually works, with ready-to-download zips. The vetting is the value — most skill lists are link dumps.
skillscurationvettedclaude-ai
by Zephyrex21 Aug 9, 2026 6/10
skill Reddit
An agent skill for web research and knowledge lookup, alongside a writeup on why default agent browsing is both risky and inefficient. Covers prompt injection from hostile pages — the example given is a site whose robots page instructs agents to delete things — and argues for a dedicated research path over ad-hoc fetching. Originally built for the Pi coding agent, now used mainly in Claude.
researchwebprompt-injectionsecurity
by JaspreD Aug 9, 2026 6/10
skill Reddit
Scans every file in a project — not just source, since secrets and misconfiguration show up in READMEs, CI YAML, Dockerfiles, and old notes — using real scanners like gitleaks, npm audit, and pip-audit plus manual review for injection risks, weak CORS, and missing auth. It then applies the fix directly in code rather than filing a report. Honest about the case it cannot fix: a secret already exposed in git history.
securityauditsecretsremediation
by MonitorFlat4465 Aug 9, 2026 7/10
skill GitHub
A Claude Code skill that generates coding lessons from your own repository across three surfaces (tutorial, vocabulary, status), with six writing-to-learn entries and six venue templates for audience-facing output. Useful for onboarding people onto an unfamiliar codebase.
learningonboardingdocumentationskill
by Terryc21 Aug 9, 2026 6/10
skill GitHub
Evidence-first SEO, AEO, GEO, and AI-search workflows for Codex and Claude Code, structured as one router skill delegating to nineteen specialists. The router pattern keeps context cost down versus loading all nineteen.
seoaeogeoskills
by oegeyilmaz9 Aug 9, 2026 6/10
skill Reddit
A free skill that interviews you about your product, target audience, and competitors, then suggests and generates viral content ideas for posting across socials. The author reports 10M+ views, 80k visits, and 500+ signups in a week at roughly $0.40 per video — self-reported numbers worth treating as such.
marketingcontentugcgrowth
by swaroopmehetar Aug 9, 2026 5/10
skill GitHub
Three Claude Code agent skills that capture which structural decisions you could actually defend and hand them back as a map of your project. Filters for defensible decisions rather than logging everything indiscriminately.
decisionsarchitecturedocumentationskills
by Dupflo Aug 9, 2026 6/10
skill GitHub
A Claude Code skill that reads a repository and writes a course about it: tracks, checklists, flash decks, exams, and code anchors that open your editor at the relevant line, presented as a local-first dashboard that remembers your progress.
learningonboardingdashboardskill
by brickster241 Aug 9, 2026 6/10
skill GitHub
A Claude Code skill that pulls actual React Bits component source from the live registry rather than reconstructing it from model memory. The same pattern — fetch, do not recall — applies to any fast-moving component library.
reactcomponentsregistryskill
by Philotheephilix Aug 9, 2026 6/10
skill GitHub
A Claude Code skill implementing a demand-gated GEO (generative engine optimization) workflow. Every rule in it is evidence-tagged against a corpus of 26,767 measured citations, so recommendations trace back to observed data rather than SEO folklore.
seogeocontentskill
by paultaki Aug 8, 2026 7/10
skill GitHub
Six skills covering audience discovery, market validation, positioning and content strategy, each structured to work from evidence rather than assertion. Works in both Claude Code and Codex.
market-researchskillspositioningcontent-strategy
by klinkoai Aug 8, 2026 6/10
skill GitHub
A collection of the agent skills an engineer reaches for day to day, packaged so each installs with a single 'npx skills add' command. Low-ceremony way to pick up individual skills without cloning a whole repo.
skillscollectionnpx
by nazmulnahid-git Aug 8, 2026 5/10
skill GitHub
Adversarial persona reviewers write test suites against a skill's decision logic, then deterministic Python is generated that must keep passing them - with zero LLM calls at inference time. Try it with 'uvx temper-skills audit <skill.md>'. A rare attempt to make skill behavior verifiable instead of vibes-checked.
testingskillsdeterminismaudit
by CyrilLeMat Aug 8, 2026 8/10
skill GitHub
A bilingual (English/Chinese) skill for searching catalysis literature, usable from Claude Code, OpenClaw, Hermes, Cursor and WorkBuddy. Narrow domain, but a clean example of packaging a research search workflow as a portable skill.
researchchemistryliteraturebilingual
by ANDYPENG09 Aug 8, 2026 5/10
skill GitHub
A multi-disciplinary analysis skill for social, economic, philosophical and systemic questions: 16 lenses, 10 structural tools and an attack-loop protocol that deliberately assaults the analysis's own priors. Bilingual and MIT licensed.
analysisreasoningbilingualskill
by tetckx Aug 8, 2026 5/10
skill GitHub
Pine Script v6 skills plus MCP tooling for coding agents, backed by an actual validator rather than prose guidance - generated scripts get checked instead of assumed correct. Aimed at TradingView indicator and strategy work.
pinescripttradingmcpvalidation
by jpantsjoha Aug 8, 2026 6/10
skill GitHub
An agentic skill that writes high-retention flashcards from your material and then uploads and manages them in Anki directly, closing the loop between study notes and a working deck.
ankiflashcardslearningskill
by moka-co Aug 8, 2026 6/10
skill GitHub
A large open collection of scientific agent skills, tool specifications and prompt protocols for bioinformatics, genomics, drug discovery and multi-omics work. Compatible with Cursor, Claude Code, Antigravity and LangChain.
bioinformaticsgenomicsscienceskills
by YuliaNuzhnenko Aug 8, 2026 6/10
skill GitHub
A focused set of agent skills for cancer biology and multi-omics research, covering the analysis steps a lab actually repeats. Narrower than the general bioinformatics collections and correspondingly more opinionated.
biomedicalcancermulti-omicsskills
by zamushwani Aug 8, 2026 5/10
skill GitHub
A native CLI for managing reusable prompt skills across AI coding agents, with install, list, read, update, sync and remove commands working over both project-local and global skill directories.
cliskillspackage-manager
by kevin-lee Aug 8, 2026 6/10
skill GitHub
A Portuguese-language Claude Code skill that cleans a codebase in three phases - removing dead code, consolidating shallow modules and reorganizing folders - with atomic commits per step and a test gate between phases.
refactoringcleanupskillportuguese
by CRangelP Aug 8, 2026 6/10
skill GitHub
Skills framed as thinking tools rather than task runners, for agents helping make discoveries in the life sciences. Focused on how to reason about a research question, not just how to run the pipeline.
sciencediscoveryskillsresearch
by dekan-aleksandr Aug 8, 2026 5/10
skill GitHub
One developer's reusable kit of skills and commands, written to stay portable across AI coding tools instead of being bound to a single harness.
skillscommandsportable
by manu-kaushik Aug 8, 2026 5/10
skill GitHub
A Superpowers-derived (MIT) spec-driven workflow with one hard rule: every claim the agent makes carries a file:line citation, and verifier steps re-run the search to confirm it. Pitched at non-programmers as well as developers.
spec-drivenverificationcitationsskills
by rodrigopaitach Aug 8, 2026 7/10
skill GitHub
The Databricks adapter for a platform-portable analytics delivery doctrine: 17 Claude Code skills plus a CLI covering Unity Catalog, DLT and Spark SQL. Sibling project to powerbi-agent.
databricksdata-engineeringskillssql
by santoshkanthety Aug 8, 2026 6/10
skill GitHub
The Power BI adapter for the same portable analytics doctrine: 45 Claude Code skills plus a CLI over TOM, TMDL, PBIR and the Fabric REST API, drawn from 20+ years of regulated, high-volume BI delivery.
powerbibiskillsfabric
by santoshkanthety Aug 8, 2026 6/10
skill GitHub
A small Claude Code skill that rates AI-generated images on how convincingly British they look, taking the minimum of two scores and shipping at 8 or above. Silly domain, but a tidy pattern for min-of-two-judges scoring gates.
image-evalscoringskillfun
by Theo7777 Aug 8, 2026 5/10
skill Reddit
Amid the wave of Opus 5 complaints, the author reports no quality drop at all and suspects the difference lies in how project instructions are written. Their approach: don't hand-author CLAUDE.md - have the model produce and maintain it. A useful counterpoint on where perceived model regressions actually come from.
claude-mdconfigurationdiscussion
by minaminonoeru Aug 8, 2026 6/10
skill GitHub
A skill collection covering github-repo-hygiene, test-graphics, reddit-karma, presentation-maker and docs-system, each shipped with a skill.json manifest, CI validation and full documentation rather than a bare markdown file.
skillscollectioncimanifests
by bestdeejay-design Aug 8, 2026 5/10
skill GitHub
An agent skill that scans a Shopify store for WCAG 2.2 AA issues, attributes each finding to the theme or to an installed app, and prioritizes the fixes. The theme-vs-app attribution is the part generic accessibility scanners miss.
accessibilityshopifywcagaudit
by kgelster Aug 8, 2026 6/10
skill GitHub
A jurisdiction layer for Claude covering Latin America: neutral skills plus per-country legal data packs where every line carries its official source and a date. Explicitly not a substitute for a lawyer.
legallatamskillsspanish
by Danielmc09 Aug 8, 2026 5/10
skill GitHub
An unofficial, provider-agnostic agent skill for querying the Rankscale AI brand-visibility REST API from Claude Code, Cursor, Codex or any other agentic tool.
seobrand-visibilityapiskill
by bojan-basrak Aug 8, 2026 5/10
skill GitHub
A large pure-markdown skill library for autonomous research, organized into 9 composable packages across a 4-layer hierarchy (Campaign, Strategy, Tactic, SOP). It supports non-linear orchestration with backtracking and wires in 6 MCP integrations including Semantic Scholar. Aimed at letting the agent drive literature review and hypothesis generation while you set direction.
skillsresearchorchestrationmcpliterature-reviewmarkdown
by yogsoth-ai Aug 8, 2026 8/10
skill GitHub
A Claude Code skill that converts YouTube videos and podcasts into detailed Traditional Chinese articles, running fully local and offline with no API key required. It does chapter-aligned chunking plus a quality self-check pass, and can derive mind maps, highlight cards and self-quiz cards from the same transcript. Useful mainly for zh-TW users doing deep reading of video content.
skillyoutubetranscriptiontraditional-chineseoffline
by final90006-sketch Aug 8, 2026 5/10
skill GitHub
A Claude Code skill that turns written content into finished presentation decks, exporting to PPTX and related slide formats. The pitch is removing the manual parts of deck building — no Keynote, no dragging boxes around, no picking font sizes. Python-based and one of the more popular deck-generation skills at 200+ stars.
skillslidespptxpresentationsdocument-generation
by hiyeshu Aug 8, 2026 7/10
skill GitHub
A ruleset for removing the stylistic markers that give away agent-written text, ordered by how often each marker actually shows up in measured samples — formatting habits first, older paste-era artifacts last. Claims are sourced, and anything unsourced is explicitly labelled as such. Handy as a final editing pass over drafts an agent produced for you.
writingeditingprosestyleacademic
by tae898 Aug 8, 2026 6/10
skill GitHub
A bundle of skills, slash commands, subagents, and hooks aimed at producing WSQ training material — slide decks, lesson plans, learner guides, and assessments — against one academy's house standards. Very domain-specific to Singapore vocational courseware, but it is a concrete worked example of encoding a document house style into a Claude Code plugin.
skillshooksslash-commandscoursewaredocument-generation
by tertiarycourses Aug 8, 2026 5/10
skill GitHub
A personal collection of Claude Code skills, steering rules, and multi-agent workflows. The distinctive pieces are autonomous issue runners that pick up tickets end to end, adversarial review gates, and parallel bug-hunting fan-outs. Worth a look if you are designing your own multi-agent review patterns.
skillsmulti-agentcode-reviewautomation
by roufmlp Aug 8, 2026 5/10
skill GitHub
A skill that removes the giveaways of AI-generated pt-BR prose: filler openers like "e importante ressaltar", forced binary contrasts, and overuse of gerunds. It is calibrated against a corpus of real human writing rather than generic style rules. Niche, but a useful reference if you are building language-specific editing skills.
writingportugueseeditingskill
by ViniciusStanula Aug 8, 2026 5/10
skill GitHub
Turns unstructured architecture input into validated ArchiMate 3.2 models, generated views, and ISO 42010 documentation, all versioned in git. The agent skills sit on top of a deterministic core so the outputs are checkable rather than improvised. Aimed at teams that need living architecture governance instead of stale diagrams.
architecturearchimategovernanceiso-42010skills
by dithiothreitol Aug 8, 2026 6/10
skill GitHub
A Claude skill paired with a CLI pipeline that designs and renders lightweight looping GIF infographics sized for LinkedIn. Rendering is deterministic, so the same input produces the same output rather than a fresh improvisation each run. Includes RTL and Arabic text support.
infographicsgiflinkedinrenderingrtl
by imMamdouhaboammar Aug 8, 2026 6/10
skill GitHub
A plugin that guides Claude Code through building .NET console apps with the ConsolePlus/PromptPlus libraries. It determines the correct layer, checks whether interactive controls can actually run in the target context, and narrows 21 available controls to the right one. Removes a class of API-choice mistakes an agent would otherwise make blind.
dotnetconsolepluginlibrary-guidance
by FRACerqueira Aug 8, 2026 5/10
skill GitHub
Agentic QA for Claude Code that takes a user story and produces an ISTQB-grounded Gherkin test book plus runnable Playwright tests. It is delivered as markdown skills only, with no shipped code and no API key required. Attractive if you want test generation grounded in an actual testing standard.
qatestinggherkinplaywrightistqbskills
by QAIA-Project Aug 8, 2026 7/10
skill GitHub
A set of Claude skills covering the Rockfish synthetic data SDK. It gives the agent working knowledge of the SDK's API so it can generate and manipulate synthetic datasets without guessing at call signatures. Relevant mainly if you already use Rockfish.
skillssynthetic-datasdkvendor
by Rockfish-Data Aug 8, 2026 5/10
skill GitHub
A suite of Claude Code skills for maintaining the project record, roadmap, documentation, and tooling. It deliberately stays out of the coding itself, acting as a secretary to the work rather than doing the work. A good fit if your docs drift out of sync with what was actually built.
documentationroadmapproject-managementskills
by qupunto Aug 8, 2026 6/10
skill GitHub
Builds agent capabilities on demand instead of preloading everything into the system prompt. The idea is to keep startup context small and forge the specific capability when a task actually needs it.
capabilitiescontextjust-in-time
by SuperMarioYL Aug 7, 2026 5/10
skill GitHub
Reads and writes Jira and Confluence through your already-logged-in local browser (Safari, Chrome, or Edge) instead of the API. Built for corporate environments where security policy blocks the Atlassian MCP and API tokens.
jiraconfluencebrowseratlassianenterprise
by baekchangjoon Aug 7, 2026 7/10
skill GitHub
A self-evolving second brain with skills, agents, and a people CRM, built around a closed-loop harness where the worker never grades its own homework. Includes paired anti-slop design skills for marketing and product UI. Works with Claude Code, Cursor, Kiro, Gemini CLI, and Codex.
second-brainskillsverificationcrm
by huytieu Aug 7, 2026 6/10
skill GitHub
Scans your project, ranks relevant agent skills with calibrated weights, removes near-duplicates via content similarity, and installs them with no configuration. Supports Cursor, Claude Code, Copilot, and other agents.
skillsinstallerdiscoveryautomation
by luckdevx Aug 7, 2026 7/10
skill GitHub
A skill covering the full ontology lifecycle: design, construction, review, repair, optimization, refactoring, validation, and governance. Niche, but thorough if you work with knowledge graphs or formal domain models.
ontologyknowledge-graphmodeling
by Moonweave-AI Aug 7, 2026 5/10
skill GitHub
A rule set covering exact execution, defensive testing, debugging, and alignment, aimed at making AI builders more predictable. Mainly a curated set of behavioral constraints you can drop into a project.
rulestestingdebuggingalignment
by jawsublime-byte Aug 7, 2026 5/10
skill GitHub
Packages a 20-year sales veteran's seven-principle framework plus CXO dealmaker insights into a Claude Code skill. Built by KudoMetrics for founders and sales teams working out of the terminal.
salesbusinessframework
by KudoMetrics-Techologies-Private-Limited Aug 7, 2026 5/10
skill GitHub
A Claude Code skill that runs a guided interview over one of your actual experiences and turns the answers into social media content. The interview step is the point, since it keeps the output grounded in something that happened.
contentsocial-mediainterviewwriting
by felixofabio Aug 7, 2026 5/10
skill GitHub
A Claude Code skill that runs Semgrep, gitleaks, TruffleHog, Trivy, osv-scanner, and ZAP, then checks each finding against the actual source before reporting it. Covers SAST, secrets across full git history, SCA, IaC, and Supabase/Firebase RLS, in one report tagged to OWASP Top 10 2025.
securitysastsecretsowaspscanners
by cdmx-in Aug 7, 2026 8/10
skill GitHub
A downloadable skill pack covering landing page replication, WebGL Three.js backgrounds, Doubao TTS and podcasts, video scripts, GEO job hunting, and DESIGN.md visual systems. Unzip and use, MIT licensed.
skillswebglttsdesignmit
by lizliz404 Aug 7, 2026 5/10
skill GitHub
An audit workflow for AI-built software covering requirements, tests, evidence, and stated limitations, ending in a signed release approval. Includes iOS and MASVS coverage for mobile work.
auditevidencereleaseiosmasvs
by goonobu-dot Aug 7, 2026 5/10
skill GitHub
An evidence-driven skill that alternates fresh builder and critic rounds against project context, keeping proof resumable across rounds and enforcing integration gates. Works with both Codex and Claude Code.
builder-criticevidencegatesresumable
by Yash-1511 Aug 7, 2026 6/10
skill GitHub
A free Claude skill that audits WordPress sites for known plugin CVEs, malware, and misconfigurations. Built by Macronimous for people maintaining WordPress installs.
wordpresssecuritycvemalwareaudit
by mwstech Aug 7, 2026 6/10
skill GitHub
Agent skills for applying Feature-Sliced Design v2.1 in frontend projects, published by the Feature-Sliced organization itself. Worth having if your frontend already follows FSD and you want an agent to respect the layer boundaries.
fsdfrontendarchitectureskills
by feature-sliced Aug 7, 2026 7/10
skill GitHub
A large collection of production-grade agent skills and Custom GPT prompts for Claude Code, Codex, and Gemini CLI. Everything conforms to the Agent Skills spec, so the skills port across tools.
skillsagentscollectionspec-compliant
by vasilyu1983 Aug 7, 2026 6/10
skill GitHub
A Claude Code skill that converts a news item into a research briefing: verified facts, historical parallels, and questions arguing the other side. The devil's-advocate step is what keeps it from being a summarizer.
researchnewsbriefingcritical-thinking
by mertcanciy Aug 7, 2026 5/10
skill GitHub
A design system for React, Angular, and Tailwind shipped as two npm packages plus a Claude Code plugin and an Agent Skill. Designed so an agent can drive the tokens directly rather than guessing at your visual language.
design-systemtokensreacttailwindplugin
by dravensoft-dev Aug 7, 2026 6/10
skill GitHub
Claude Code skills for building macOS apps that genuinely look native: pull exact specs from Apple's official Figma UI kits, ship a signed .app from a single Swift file, and obtain password-free root safely.
macosswiftfigmadesignapple
by infinitule Aug 7, 2026 7/10
skill GitHub
A UI quality guardrail that understands which framework you are in and blocks the generic patterns agents fall back on. Aimed at the visual sameness problem rather than at correctness.
uiqualitydesignguardrailanti-slop
by benjaminstelzer Aug 7, 2026 6/10
skill GitHub
A set of 26 Go-focused skills covering production concerns, usable from Claude Code, Gemini CLI, and opencode. Worth a look if your agent keeps writing Go that compiles but does not read like Go.
goskillsproductionbackend
by muratmirgun Aug 7, 2026 7/10
skill GitHub
An AI toolbox for note management with a zero-thought inbox, a whole-vault health check, and a Notion migration path, including a copy-paste beginner version. Documentation is in Chinese.
notesnotionorganizationchinese
by brightac Aug 7, 2026 5/10
skill GitHub
A set of 31 Claude Code skills for prompting image-to-video models, written from production A/B measurements rather than intuition. The measurement provenance is what separates it from the usual prompt-tip lists.
videopromptingklingveoab-testing
by kanno321-create Aug 7, 2026 6/10
skill GitHub
A product management skill that keeps ideas, backlog, sprints, releases, and bug tracking in plain Markdown inside the repo, driven by slash commands. Product management lives next to the code instead of in another tab.
product-managementscrummarkdownslash-commands
by nunoamorim99 Aug 7, 2026 6/10
skill GitHub
A Claude Code plugin that prevents translation-ese, AI slop, and double passives in Korean through rule skills, with a hook that automatically catches the obvious AI patterns.
koreanwritinglintinghooki18n
by HarryJhin Aug 7, 2026 6/10
skill GitHub
Measures what an AI-generated image actually produced and diagnoses from there, rather than the usual loop of tweaking the prompt and hoping. Also covers getting the result onto a real app surface.
image-generationdiagnosticsdesignmeasurement
by wan-huiyan Aug 7, 2026 5/10
skill GitHub
CrowdStrike's own agent skills for building Falcon Fusion workflows: action discovery, YAML authoring, deployment, execution monitoring, and best practices for triggers, conditions, loops, and HTTP Actions. Notable as a vendor-published skill set.
crowdstrikesecuritysoarofficialyaml
by CrowdStrike Aug 7, 2026 7/10
skill GitHub
A library of 116 skill packs, 57 in Chinese and 11 original to the project, all verified as real, plus a directory of 47 AI tools with links tested daily. The verification claim is the differentiator among skill-list repos.
skillschinesecollectioncurated
by sanhuang520-ship-it Aug 7, 2026 5/10
skill GitHub
A Claude Code template with onboarding, a self-auditing health check, builder skills, and a Karpathy-style knowledge wiki. Ships with a bilingual teaching package for running it as a class.
templatestarter-kitonboardingwiki
by GerardoRdz96 Aug 7, 2026 5/10
skill Reddit
A CLAUDE.md block that asks for Simplified Technical English on coding work: sentences under 20 words, active voice, one instruction per sentence, one meaning per word, no idioms, explicit articles. Scoped to chat reports, PR titles and descriptions, and issue comments rather than everything.
claude-mdwritingverbositystyleste100
by henrypoydar Aug 7, 2026 6/10
skill GitHub
Agronomic skills encoding the Brazilian 5a Aproximacao (CFSEMG/MG) and Boletim 100 (IAC/SP) fertilizer recommendation standards. A good example of an agent skill built around a real domain reference rather than general advice.
agronomybrazildomain-skillportuguese
by guilherme-iaparaagronomos Aug 7, 2026 5/10
skill GitHub
Generates text-free image prompts plus overlay specifications for any brand asset, with adapters for Midjourney v7, FLUX, GPT-image, and SDXL. Keeping text out of the render and in the overlay is the useful part.
brandingimage-generationmidjourneyfluxdesign
by ChloeVPin Aug 7, 2026 5/10
skill GitHub
An agent skill plus text-to-image CLI that turns Google's Antigravity CLI into an image generator for hero art, icons, and illustrations, callable from Claude Code or the terminal.
imagesantigravitytext-to-imagecli
by dyrok Aug 7, 2026 6/10
skill GitHub
Agent skills that help founders explain their company and raise money for it, covering positioning, pitch, fundraising, launch, branding, and marketing.
marketingfoundersfundraisingpositioning
by lelephi Aug 7, 2026 5/10
skill GitHub
A large skill collection aimed at full-stack work, positioned as turning Claude Code into an expert pair programmer. Broad coverage rather than deep specialization.
skillsfull-stackcollectionpair-programming
by Jeffallan Aug 7, 2026 6/10
skill GitHub
The official Novoads skill pack for producing AI video ads, UGC-style ads, and image ads, available as both a REST API and an MCP integration.
adsvideomarketingnovoadsmcp
by novoads Aug 7, 2026 5/10
skill GitHub
A set of Claude Code skills that review, improve, animate and systematize UI work. Each critique cites a specific design rule and proposes a numeric fix rather than vague advice. Aimed at developers who ship interfaces without a designer on hand.
designuireviewskills
by AnimaEcho Aug 7, 2026 7/10
skill GitHub
Agent skills aimed at the person who owns the product rather than the codebase. The first skill, 'Context is Queen', focuses on framing product context for agents; three more are in progress. A useful angle if you use Claude Code for product work.
product-managementskillscontext
by hgambas Aug 7, 2026 6/10
skill GitHub
Converts saved links into a structured Markdown bookmark library that AI agents can query. Each entry is normalized so an agent can search and cite sources instead of re-fetching pages. Handy as a lightweight personal knowledge base for agent workflows.
bookmarksknowledge-basemarkdownresearch
by nikkogibler Aug 7, 2026 6/10
skill GitHub
Turns a JSON document of floor bands into a validated low-poly glTF building for Unreal, Unity or three.js. Ships with a three.js blueprint editor and an agent-facing CLI so Claude can generate geometry directly. Useful for anyone prototyping 3D environments with an agent.
3dgltfgamedevthreejsprocedural
by hec-ovi Aug 7, 2026 6/10
skill GitHub
Runs structured discovery on a product idea, scores confidence, dispatches a research swarm, and produces a technical handoff deck. The output is meant to be the input to an actual build rather than a standalone document. Aimed at pre-implementation validation.
productresearchvalidationdiscovery
by cla1redonald Aug 7, 2026 6/10
skill GitHub
A large library covering support QA, compliance, RevOps, forecasting and coaching, installable one at a time via 'npx rulebase-skills install <slug>'. Works with Claude Code, Codex and Cursor. Notable for being a non-engineering skill collection at real scale.
customer-supportskillscxoperations
by rulebase-co Aug 7, 2026 7/10
skill GitHub
Applies the Russian 'infostyle' editing tradition — clarity, factual grounding, cutting filler — to text inside Claude Code. Targets writing quality rather than code. Niche but well-scoped for Russian-language writers.
writingrussianeditingskills
by Julianalost754 Aug 7, 2026 5/10
skill GitHub
Three Claude Code skills — build discipline, review discipline, and an Opus 5 circuit breaker — each written in response to an actual incident where an agent session damaged a repo. The rules are specific rather than generic best practice. Useful if you run agents with broad write access.
guardrailssafetyreviewskills
by LilyCTM Aug 7, 2026 7/10
skill GitHub
A vision toolkit and skill providing image Q&A, OCR, screenshot understanding, visual grounding and image-to-SVG for agents that have no native vision. Drops into Claude Code, Codex, OpenCode and Pi. Bilingual docs (Chinese/English).
visionocrscreenshotsmultimodalskills
by Anionex Aug 7, 2026 8/10
skill GitHub
A Portuguese-language agent for Claude Code and Codex that plans, analyzes and optimizes Meta Ads campaigns with an audit trail for every recommendation. Every change is traceable back to the data that motivated it. Domain-specific but a good template for auditable marketing agents.
adsmarketingmetaanalytics
by davigraeff-v4 Aug 7, 2026 6/10
skill GitHub
Defines a constitution and working method covering both multi-agent and solo-agent workflows — what agents may decide, what needs escalation, how work is recorded. Aimed at teams that need agent output to be defensible. More policy than tooling.
governancemulti-agentprocessskills
by Ezra144israel Aug 7, 2026 6/10
skill GitHub
A workstation baseline with 48+ skill packs, sub-agents, MCP templates and loop-engineering primitives, targeting Claude Code, opencode, Cursor, Copilot and Gemini CLI. Meant as a starting configuration rather than a single tool. Large surface area — expect to prune.
skillsmcpsubagentsworkstationmulti-cli
by ulises-jeremias Aug 7, 2026 7/10
skill GitHub
Claude Code skills built around runnable exit criteria, honest evals, and guards that are demonstrated firing rather than merely declared. The premise is that a skill claiming success should show the check that passed. A useful pattern even if you don't adopt the pack.
skillsevalsverificationguards
by AaravChadha Aug 7, 2026 7/10
skill GitHub
Packages engineering judgment into governed skills and executes them on a durable Kotlin runtime so agents follow the process consistently, resume after interruption, and stay within a bounded context. The durability angle is what separates it from prompt-only skill packs. Heavier setup than a Markdown skill.
skillskotlindurable-executiongovernance
by oila-gmbh Aug 7, 2026 6/10
skill GitHub
Feeds a tutorial video in and produces a skill a coding agent can actually execute, reading the screen rather than the transcript. Captures the steps that narration skips over. A neat way to convert tribal knowledge in recordings into agent instructions.
skillsvideoscreen-readingautomation
by obeskay Aug 7, 2026 7/10
skill GitHub
A Claude Code skill that manages tasks, scheduling and time tracking in Super Productivity through the app's local REST API. Everything stays on your machine. Good example of wrapping an existing local API as a skill.
taskstime-trackingrest-apiskills
by rokokol Aug 7, 2026 6/10
skill GitHub
Agent skills in SKILL.md format for Claude, OpenClaw and Codex, including BPMN-aware Mermaid diagramming, a voice-to-LinkedIn-post pipeline, and meta-skills that turn recurring work into new reusable skills. The meta-skill angle is the interesting part. Standards-conformant SKILL.md files.
skillsbpmnmermaidmeta-skills
by OKHP3 Aug 7, 2026 6/10
skill Reddit
Argues that skills are the wrong mechanism for always-on communication style: they're built to encode workflows and domain know-how for specific tasks, not to shape user-facing tone. Explains why the popular 'be concise' skills underdeliver and where that instruction actually belongs. Useful framing before you write another behavioural skill.
skillsverbosityoutput-stylediscussion
by ibn_larry Aug 7, 2026 7/10
skill GitHub
A one-call skill for Claude Code and Grok Build that opens your most recent Windows screenshot without a directory hunt. Deliberately token-cheap. Small but removes a repetitive step in visual debugging.
screenshotswindowsskillsutility
by yoobrain Aug 7, 2026 5/10
skill GitHub
A Claude skill that turns a complex decision into a self-contained interactive HTML canvas with evidence states, editable assumptions and a portable decision record. The artifact outlives the conversation. Useful for architecture choices you'll need to justify later.
decisionshtmldocumentationskills
by nicolas-diez Aug 7, 2026 6/10
skill GitHub
Two Claude Code skills that capture your writing voice, audit text against it, and rewrite only the passages that fail. Selective rather than a wholesale rewrite, so your original phrasing survives. Aimed squarely at the AI-tell problem.
writingvoiceeditingskills
by aixarizzo Aug 7, 2026 7/10
skill Reddit
A short communication-style section for CLAUDE.md asking for direct, plain British English, no consultant-speak, and radical candour including admitting uncertainty. The author reports a large improvement over default Opus 5 verbosity. Copy-pasteable in a few lines.
claude-mdverbositypromptingopus-5
by Schpickles Aug 7, 2026 6/10
skill GitHub
Skills for the artifacts knowledge workers actually ship — ADRs, design docs, PRDs, runbooks, decks, threat models, adversarial reviews — plus three reviewer subagents and six role-based packs. Conforms to the Agent Skills open standard and installs into Claude Code, Cursor, Codex, Copilot, Kiro and Antigravity. Broad coverage with a consistent format.
skillsdocumentationadrprdportable
by sananthanarayan Aug 7, 2026 7/10
skill GitHub
A CLI that interviews you about your writing, captures the answers, and emits a Claude Code skill encoding your voice. Getting the style from an interview avoids needing a large corpus of prior writing. Complements the audit-based approach of other voice tools.
writingvoiceskillscli
by substantialityinhibition972 Aug 7, 2026 6/10
skill GitHub
Composable skills covering risk register maintenance and translating security posture for a board audience, aligned to NIST frameworks. Targets the CISO's writing and reporting load rather than technical scanning. Composable, so you can take just the pieces you need.
securitycisonistriskskills
by cyberaware-creations Aug 7, 2026 6/10
skill GitHub
Provides memory and guardrail templates built on cue placement, plus a self-tested CI kit and the white paper explaining the approach. The CI kit tests the guardrails themselves, which is rarer than it should be. Good if you want the reasoning as well as the artifacts.
memoryguardrailscitemplates
by The-825 Aug 7, 2026 6/10
skill GitHub
Walks you through a PR an agent wrote in layers rather than as one wall of diff, collecting your comments as it goes. Built for the case where you didn't write the code and need to build understanding before judging it. Works in Claude Code, Codex and Cursor.
code-reviewpull-requestsskills
by thekie Aug 7, 2026 7/10
skill GitHub
Generates GitHub READMEs with real visual craft while scanning for secrets that shouldn't ship in documentation. Combines presentation with a safety check most README generators skip. Small scope, done properly.
readmedocumentationsecretsskills
by thatdudealso Aug 7, 2026 5/10
skill GitHub
An agent skill that checks existing repo structure and conventions before naming a file or project, instead of inventing a fresh style each time. Prevents the naming drift that accumulates across many agent sessions. Very small scope.
namingconventionsskills
by thatdudealso Aug 7, 2026 5/10
skill GitHub
A triage layer built on mattpocock/skills that judges how heavy a task is: trivial work gets done directly, substantial work is routed through the full process. Avoids paying full-ceremony cost on one-line changes. Chinese-language documentation.
triageroutingskillsworkflow
by Number-2222 Aug 7, 2026 5/10
skill GitHub
Two Claude Code skills for VMware infrastructure: vmware-monitor is read-only and safe to point at production, while vmware-aiops enables full operations. Splitting them lets you grant an agent visibility without granting it the ability to change anything.
vmwareinfrastructuredevopsread-only
by vmware-skills Aug 6, 2026 6/10
skill GitHub
A 3 MB plugin that ships metadata only and fetches official Claude documentation from Anthropic's servers on demand, so nothing is redistributed or goes stale. Adds an auto-discovery skill, instant search, interactive HTML courses, and doc changelog reports.
documentationpluginsearchreference
by costiash Aug 6, 2026 7/10
skill GitHub
An ongoing collection of Claude Code skills the author writes, uses long-term, and keeps refining, published in Chinese. Framed as a starting point rather than a finished library - the stated goal is that you build your own from it.
skillscollectionchinese
by zxc7563598 Aug 6, 2026 5/10
skill GitHub
A large local-first ComfyUI skill for Claude Code bundling 80 model prompt recipes and 662 workflow templates, with hardware-aware model selection so it picks something your GPU can actually run. Includes a self-updating knowledge base and an end-to-end manga pipeline.
comfyuiimage-generationtemplateslocal-first
by cxin21 Aug 6, 2026 7/10
skill GitHub
An MIT-licensed starter kit that adds four commands to Claude Code: /onboard to get oriented in a repo, /audit to review it, /level-up to improve it, and /grill to interrogate your own assumptions. A reasonable opinionated default for a fresh setup.
starter-kitcommandsonboardingaudit
by sameerch1b Aug 6, 2026 6/10
skill GitHub
A personal skills repository organised for version control, paired with installers that work across platforms. The value is the packaging pattern - treating skills as versioned artifacts with a real install path rather than files you copy by hand.
skillsversioninginstaller
by dm1681 Aug 6, 2026 5/10
skill GitHub
One skill that structures agent workflows so they survive crashes, never redo completed work, and stay grounded rather than inventing results. Portable across Claude Code, Codex, Gemini CLI, Cursor, Windsurf/Devin, Hermes, and Copilot.
workflowdurabilityidempotencyportable
by SathiaAI Aug 6, 2026 7/10
skill GitHub
A Chinese-language skill suite for running a local AI short-film pipeline - LTX, Wan, and MiniMax H3 - on a single 12GB card. Includes 1600+ lines of documented failure modes and a mechanism to keep generated shots from converging on the same look.
videolocal-inferencegpuchinese
by L-Trunks Aug 6, 2026 6/10
skill GitHub
A 197-skill library covering RNA-seq, single-cell analysis, drug discovery, and proteomics, reporting 92.0% accuracy on BixBench. It powers OmicsHorizon and is one of the more substantial domain-specific skill collections published for Claude Code.
bioinformaticsscienceskillsbenchmarks
by jaechang-hits Aug 6, 2026 8/10
skill GitHub
A research-backed agent skill covering fluid motion, the Human Interface Guidelines, colour systems, dark mode, SF Symbols, layout, and accessibility - all mapped onto web implementation. A revamp of Emil Kowalski's MIT-licensed apple-design skill.
designapplehigaccessibility
by ChloeVPin Aug 6, 2026 7/10
skill GitHub
Two portable skill sets: an advisory board that puts a hard decision to several models and reconciles their answers, and a five-skill pack for tracked, multi-session, agent-assisted development on a team.
multi-modeldecision-makingteamworkskills
by timharris707 Aug 6, 2026 6/10
skill GitHub
Five checks to run against your coding agent's pull request before a human maintainer sees it, derived from analysing 2,204 real merged agent PRs. The empirical grounding is what distinguishes this from generic review checklists.
code-reviewpull-requestsqualityempirical
by sjh9714 Aug 6, 2026 8/10
skill GitHub
A lean documentation skeleton for Laravel projects using Claude Code, built on one memorable rule: CLAUDE.md holds what must always be in context, docs/ holds everything the agent can page in on demand.
laravelphpclaude-mddocumentation
by albertoarena Aug 6, 2026 6/10
skill GitHub
A Claude Code skill for designing and generating event-sourced domain code in Laravel using Spatie's event sourcing package. Narrow scope, but event sourcing is exactly the kind of boilerplate-heavy pattern an agent handles well with guidance.
laravelevent-sourcingspatiephp
by albertoarena Aug 6, 2026 6/10
skill GitHub
Confirms your industry and audience first, then cleans, analyses, and emits a single-file interactive HTML report in a conclusion-first six-section structure with every chart interpreted. Explicitly refuses to invent industry benchmarks, imply causation from correlation, or draw firm conclusions from small samples. Supports Claude Code, Codex, and WorkBuddy.
data-analysisreportinghtmlchinese
by cabbage2000-lab Aug 6, 2026 6/10
skill GitHub
Runs liarjs from Claude Code, Codex, Cursor, or Copilot to score a browser against itself across 40 consistency checks spanning canvas, WebGL, WebGPU, audio, fonts, and WebRTC, cross-checked against the TLS/HTTP layer. Intended for Playwright and Puppeteer harness QA and CI regression gates.
testingbrowserfingerprintingplaywright
by liarjsdev Aug 6, 2026 5/10
skill GitHub
A macOS disk cleanup skill for Claude Code and Codex that diagnoses what is actually inside the opaque 'System Data' bucket, using read-only scan scripts. Documents 10 traps that lead to misdiagnosis or data loss - the safety notes are the real content.
macosdiskcleanupread-only
by himynameisben Aug 6, 2026 5/10
skill GitHub
Agent skills aimed at independent restaurant marketing: drafting review replies, analysing review patterns, and writing menu copy. From the team behind Semperi.
marketingrestaurantscopywritingbusiness
by semperi Aug 6, 2026 5/10
skill GitHub
A full Traditional Chinese localisation of Matt Pocock's 35 agent skills with install and runtime behaviour preserved. Ships a bilingual GitHub Pages reading site with a skill overview map, a learning path, and OpenCode/TRAE install guides.
localizationchineseskillstypescript
by shumingyang-opencode Aug 6, 2026 6/10
skill GitHub
A Claude Code plugin for Turkish R&D incentive work: tracking TUBITAK TEYDEB/ARDEB calls, pre-assessing project proposals, preliminary patent search, and checking compliance with law 5746. Unofficial and not affiliated with TUBITAK.
turkeygrantscomplianceresearch
by ibrahim-isikli Aug 6, 2026 5/10
skill GitHub
Portable agent skills for assembling context packages where every claim carries a source attribution and a human approves the package before it is used. Aimed at stopping unsourced assumptions from entering the agent's working context.
context-engineeringattributionapprovalportable
by linkpranay-ai Aug 6, 2026 5/10
skill GitHub
A Claude skill that applies production-hardening practices whenever you design, write, or review backend code, with specific coverage for endpoints, payment flows, destructive deletes, background jobs, and alerting. The failure modes it targets are the ones that only surface under real traffic.
backendproductionpaymentsreliability
by AllanOps Aug 6, 2026 7/10
skill GitHub
A pure-markdown skill pack for self-reflection: a 22-question evidence-based profile, a ten-dimension digital twin, and a 90-day life-planning experiment. Written to run on any AI assistant rather than a specific harness.
personalreflectionmarkdownchinese
by Jianing1117 Aug 6, 2026 5/10
skill GitHub
109 specialist subagents organised into 16 engineering teams, plus 11 commands and 10 skills, arranged along an architecture-build-verify-ship chain with the delegation order enforced rather than suggested. Installable as a plugin marketplace.
subagentsteamsmarketplacedelegation
by bakhod1r Aug 6, 2026 7/10
skill GitHub
Official agent skills for building with Resonate, the durable execution framework for long-running, crash-safe workflows. Useful when the thing you are asking an agent to build must itself survive restarts.
resonatedurable-executionworkflowsreliability
by resonatehq Aug 6, 2026 6/10
skill GitHub
Takes a raw prompt and returns an optimized one along with the right agent loop, the skills it should load, and the model to run it on. Works across Claude Code, claude.ai, and Cowork.
promptingoptimizationmodel-selectionmeta
by thanospapage Aug 6, 2026 7/10
skill GitHub
Probes whether AI assistants surface your brand when asked relevant questions, and returns a ranked list of fixes when they do not. The AEO/GEO analogue of a search ranking audit.
seoaeobrandmarketing
by nashequilibriumharness235 Aug 6, 2026 6/10
skill GitHub
Pairs a 'genesis constitution' with a scaffold generator to produce agents that can revise themselves. Bilingual (Chinese/English) and compatible with both Codex and Claude Code.
meta-agentsscaffoldingself-improvementbilingual
by LuckyZ10 Aug 6, 2026 5/10
skill GitHub
An agent skill that takes a brand idea or a loose brief and produces one original mascot-style logo mark. Deliberately outputs a single mark rather than a grid of options.
designbrandinglogoillustration
by ChloeVPin Aug 6, 2026 5/10
skill GitHub
A curated pack of 16 Claude Code skills - ship-it, readme-forge, security-sweep, git-rescue, devlog and more - where each was researched first and included only if no prominent existing skill already solved it. Explicitly not a 40-skill kitchen sink.
skillscuratedshippingtooling
by 0xmortuex Aug 6, 2026 7/10
skill GitHub
A Chinese-language skill for constructing AI video generation prompts across text-to-video, image-to-video, and video-to-video, with three complexity tiers (L1/L2/L3) and platform-specific output for Kling, Sora, Vidu, and Runway.
videopromptingchinesegenerative
by BH2-4 Aug 6, 2026 5/10
skill GitHub
A Claude Code skill that draws editable, publication-accurate vector figures directly in Figma through MCP - the last mile of the academic figure toolchain, where plotting libraries usually hand off to manual work.
figmaacademicvectormcp
by yushiran Aug 6, 2026 7/10
skill GitHub
A language-agnostic set of development standards covering coding conventions, git workflows, testing guidelines, documentation structure, and explicit rules for collaborating with AI agents.
standardsconventionsgittesting
by AsiaOstrich Aug 6, 2026 6/10
skill GitHub
An intel layer that keeps coding agents oriented on what the project actually is: authoritative north-star documents, a task-core that survives context compaction, and domain-expert review passes. Supports Claude Code, Cursor, Zed, and Codex.
contextcompactionanchoringreview
by ReidenXerx Aug 6, 2026 6/10
skill Reddit
Inspired by the emotion vectors paper, the author rewrites stubborn CLAUDE.md rules to ask Claude to introspect on its behavioral impulses rather than simply forbidding a behavior. Reports better control over verbosity and output bloat than direct instructions achieved.
claude-mdpromptingintrospectionverbosity
by trying2bLessWrong Aug 6, 2026 6/10
skill Reddit
A primary skill acts as an index over grouped architecture areas - plugins, agent stream, skills, db, service APIs - and each of those indexes a deeper documentation set. The agent updates the system whenever the architecture changes, cutting token waste since it looks up the right reference doc instead of searching the codebase.
skillsprogressive-disclosurearchitecturetoken-efficiency
by ZeroTwoMod Aug 6, 2026 6/10
skill Reddit
A Claude Code skill automating Minimax H3 video creation: search for reference character images, generate them with Seedream 4.5 if none fit, upload, then write a structured script covering scene, lighting, mood, and three dialogue beats. The post compares how Claude Code, Kimi K3, and Qwen 3.8 Max each handled the same workflow.
videoskillsmodel-comparisonautomation
by marupelkar Aug 6, 2026 6/10
skill Reddit
A skill for semi-supervised execution of very long tasks - 24 to 72 hours - with a built-in verification loop, at a frankly acknowledged heavy token cost. The skills are written in Korean and will occasionally emit Korean; the author suggests just telling it which language you prefer. At least one Max 20x account required.
orchestrationdaglong-runningverification
by Competitive-Net-5306 Aug 6, 2026 6/10
skill GitHub
A starter kit for writing your own Agent Skills, containing a meta skill that helps Claude author skills, plus templates and a worked sample. Includes scripts that validate a skill's structure and package it for distribution. Aimed at people who publish skills rather than just consume them.
skillsauthoringpackagingtemplatesvalidation
by bcastelino Aug 5, 2026 7/10
skill GitHub
A minimal convention for keeping Claude Code focused on one brief at a time instead of drifting across a whole repo. Deliberately small — no framework, just a working pattern. Worth a look if heavier planning systems feel like overkill.
focuscontextworkflowplanning
by naxoc Aug 5, 2026 5/10
skill GitHub
A curated index of Claude Skills, resources and tooling for customizing Claude workflows, maintained in Chinese alongside English. Covers skills for writing, analysis and development. Handy entry point for Chinese-speaking Claude Code users.
awesome-listskillschineseresources
by AICL-Lab Aug 5, 2026 6/10
skill GitHub
A Claude Code skill that reviews a candidate skill before you install it and records the decision permanently. The point is to decide once and never re-litigate whether a given community skill is worth trusting. Useful as the skill ecosystem grows faster than anyone can audit it.
skillssecuritycurationinstallreview
by captkernel Aug 5, 2026 7/10
skill GitHub
A collection of SKILL.md files that prime Claude with structured methodology for specific security testing areas, from SQL injection to exploit development. Each skill encodes an expert workflow for one attack surface. Intended for authorized penetration testing and security research.
securitypentestingskillsred-teamresearch
by 0xwilliamortiz Aug 5, 2026 6/10
skill GitHub
An agent skill that plans and validates an OpenSearch version upgrade for any cluster, proving it will still work as-is on the newest release. Strictly read-only, so it never mutates the cluster it inspects. Built for the 2026 OpenSearch Agent Skills Hackathon.
opensearchupgradedevopsskillread-only
by madhankb Aug 5, 2026 6/10
skill GitHub
A set of open-format Agent Skills covering the ad and campaign platforms marketing teams actually use. Works with Claude Code, Codex, Cursor, Copilot and Gemini CLI. One of the few skill collections aimed at marketing rather than engineering.
marketingskillsadscross-agentcampaigns
by plainpaperio Aug 5, 2026 6/10
skill GitHub
Finds existing community skills, security-scans them, and melds the best parts into a single tailored set rather than installing dozens separately. Reduces both context bloat and the audit burden of third-party skills. Complements install-time evaluators.
skillsdiscoverymergesecurity-scancuration
by ifylab Aug 5, 2026 7/10
skill GitHub
Every FileMaker 26 function and script step condensed into a token budget small enough to keep resident in context: names, signatures, return types, step IDs and platform support. The goal is to stop Claude inventing functions and misordering parameters. A good example of the vocabulary-layer pattern for niche platforms.
filemakerreferencecontextskilllow-code
by andykear Aug 5, 2026 6/10
skill GitHub
A Portuguese-language toolkit of rules, skills and configuration for Claude Code, Cursor and Windsurf. Removes the English-first friction for Brazilian teams. Straight translation-and-adaptation work rather than new tooling.
portugueseskillsrulescursorwindsurf
by LucasSantana-Dev Aug 5, 2026 5/10
skill GitHub
A provider-neutral skill pipeline covering an autonomous plan, build, review and ship loop across Claude and GitHub Copilot/GPT. Includes judges, graders and scorers plus install and release tooling, with three Claude-native skills excluded from the portable set. Notable for treating portability as a first-class constraint.
skillsportablecopilotpipelineorchestration
by aberson Aug 5, 2026 7/10
skill GitHub
A personal-but-public grab bag of Claude Code extensions spanning all three extension points. Worth browsing for individual pieces rather than adopting wholesale. Light on documentation.
skillssubagentshookscollection
by richardkmichael Aug 5, 2026 6/10
skill GitHub
A research-backed TDD skill that enforces real red-green-refactor gates, discovers your stack, and uses mutation testing instead of coverage as the quality signal. Includes explicit anti-reward-hacking rules so the agent cannot game its own tests. Works with any SKILL.md-compatible agent.
tddtestingmutation-testingskillquality
by ChloeVPin Aug 5, 2026 8/10
skill GitHub
A maintained collection of building blocks for agent-driven development, spanning scripts, skills and subagents. Broad rather than deep — useful as a source of individual pieces. Actively developed by a working developer.
skillsscriptscollectionsubagents
by s3rgiosan Aug 5, 2026 5/10
skill GitHub
Gives any MCP-aware coding agent built-in knowledge of NSAuditor's tools, schemas, plugins and audit workflows. Vendor-published, so it is essentially a documentation layer for their product. Works with Claude Code, Cursor and Windsurf.
securityauditmcpskillvendor
by nsasoft Aug 5, 2026 5/10
skill GitHub
Claude Code skills derived from a structured software-quality knowledge base rather than written ad hoc. Encodes established practice on testing, review and maintainability. Useful if you want your agent's quality bar to come from somewhere defensible.
qualityskillstestingreviewpractices
by stereobooster Aug 5, 2026 6/10
skill GitHub
Six skills that make an agent write both code and prose the way their author does. A concrete worked example of encoding personal style as skills instead of a sprawling CLAUDE.md. Fork-and-adjust material rather than something to install as-is.
styleskillswritingconventions
by localhostd3veloper Aug 5, 2026 5/10
skill GitHub
A Claude skill that takes a talk from topic selection through web-based slides to a full speaking script. Korean-language, aimed at one-hour presentations. Useful pattern even if you do not read Korean.
koreanpresentationslidesskillwriting
by Koo-bon Aug 5, 2026 5/10
skill GitHub
Generates README, LICENSE, REUSE/SPDX metadata, CONTRIBUTING and the rest of the open-source governance surface for any project. Works with Claude Code and OpenCode, and is written for hackathon-speed setup. Spanish-language documentation.
open-sourcelicensespdxgovernanceskill
by igarbayo Aug 5, 2026 6/10
skill Reddit
A skill front-loading 697 questions across 15 engineering domains to pin down what a task must actually resolve. Backed by 60 decision cards distilled from Kleppmann, Nygard, Evans, Ousterhout and others. An extreme take on the plan-before-you-code pattern.
skillrequirementsengineeringdesignplanning
by AffectionateSport135 Aug 5, 2026 7/10
skill GitHub
A collection of AI agent skills that help Japanese small and medium businesses research subsidies, check eligibility requirements, and draft grant applications, built on the public jGrants API. Released under MIT license and useful as a reference for building domain-specific research-and-drafting skill workflows beyond Japan's subsidy system.
skilljapangrantsresearch
by yoshi2210 Aug 5, 2026 5/10
skill GitHub
Official Claude Code skills for querying Coinpaprika and DexPaprika, covering CEX prices, DEX pools, tokens, and OHLCV data. Useful for anyone building crypto-market analysis or trading workflows directly inside Claude Code.
skillcryptomarket-data
by coinpaprika Aug 5, 2026 6/10
skill GitHub
Treats web design as film direction, producing a commit-sheet, generated assets, and a build, then gates every ship with an executable anti-slop linter. A structured, quality-gated pipeline for AI-driven website work rather than ad hoc prompting.
skillweb-designquality-gate
by agiwhitelist Aug 5, 2026 7/10
skill GitHub
A reasoned, opinionated Claude Skill encoding best practices for building small-to-medium NestJS backend projects. Useful for NestJS developers who want Claude Code to follow a consistent architectural playbook instead of ad hoc scaffolding.
skillnestjsbackend
by Kianibound Aug 5, 2026 6/10
skill GitHub
fornax is a set of portable, single-purpose skills that let an agent orient itself in a codebase, map dependencies, plan changes, and review code, strictly read/plan/report. Useful when you want an agent's analysis without risking unsupervised edits.
skillcode-reviewread-only
by tacticaldoll Aug 5, 2026 6/10
skill GitHub
A knowledge base and spec-first workflow aimed at AI coding agents working on Apple platform apps (iOS/macOS). Helps agents follow Apple-specific conventions instead of generic patterns that do not fit Swift/Xcode projects.
appleiosspec-driven
by caglarbaranbora Aug 5, 2026 5/10
skill GitHub
A large AI dev framework bundling 22 agents, 100 core skills plus 142 addon skill packs, and 149 commands, portable across 21 tools including Claude Code, Cursor, Copilot, Windsurf, Cline, and Gemini. Uses file-based memory so context persists across sessions.
skillmulti-toolmemory
by Gald3r-Labs Aug 5, 2026 6/10
skill GitHub
A Node service that transcribes a video, serves a player page, and exposes MCP tools so your coding agent can answer questions at your exact pause point and render verified charts explaining the content. Combines a Claude skill, MCP server, browser TTS, and STT for an interactive study session.
mcpskillvideostudy
by hec-ovi Aug 5, 2026 7/10
skill GitHub
A set of Claude Code / Codex skills for quant research workflows: concept research, single-stock analysis, and industry analysis, distilled from 6 months of daily production use. Notable for the depth (8k lines of orchestration rules), suggesting real battle-testing rather than a quick scaffold.
skillquantfinance
by Howard-Jerry Aug 5, 2026 7/10
skill GitHub
A cross-platform agent skill (Claude Code, Codex, OpenCode) that enforces the "First-Time Principle" -- every change must be written in its final form, with no patches, no "what changed" comments, no leftover code, and no drift between local and deployed state. Useful for teams who want agents to produce clean, complete diffs instead of incremental band-aid edits.
skillcode-qualitycross-platform
by newbanser Aug 5, 2026 6/10
skill GitHub
A bundle of 20 skills covering project setup, scope discipline, code review, security, session management, governance, ops, and quality audits (including eval-leakage and doc-drift checks). Works across Claude Code, Codex, and Cursor, aiming to standardize agent discipline beyond just coding tasks.
skillgovernancecode-review
by AlexZio00 Aug 5, 2026 5/10
skill GitHub
A Claude Agent Skill that extracts real keyframes, subtitles, and audio from a video, then produces a shot list, ready-to-paste AI image/video generation prompts, and a full replication guide covering both AI and live-action production paths. Useful for creators who want to replicate the style of an existing video or study how it was constructed.
skillvideocontent-creation
by whaojie797-design Aug 5, 2026 6/10
skill GitHub
A dynamic skill engine that audits web and mobile apps for Google AdSense/AdMob monetization compliance, checking layout safety, ads.txt validation, and anti-CLS layout hooks against current live ad policies. Niche but useful for publishers who want an automated pre-flight check before enabling ads.
skillmonetizationcompliance
by kiraak-h Aug 5, 2026 5/10
skill GitHub
A set of Agent Skills for working with Microsoft Fabric, covering connecting to data sources, loading, and modeling, with rules validated against a live Fabric environment. Useful for data engineers using Claude Code or similar agents inside a Microsoft Fabric/Power BI stack.
skillmicrosoft-fabricdata-engineering
by emirdegirmenci Aug 5, 2026 5/10
skill GitHub
An agent skill and CLI that has your AI agent locate important files -- contracts, IP, compliance records -- and send each one to the immut.io proof layer, producing a verifiable, tamper-evident timestamp of when the file existed and that it has not changed. Useful for teams needing lightweight, agent-driven document notarization.
skillcompliancenotarization
by enroh-ops Aug 5, 2026 5/10
skill GitHub
A skill that lets developers write lightweight "@anno" annotations directly in source code as inline instructions, which Claude then reads and executes in batch across the codebase. A neat pattern for queuing up many small, localized changes without writing a full prompt for each one.
skillcode-annotationbatch-editing
by zlj-zz Aug 5, 2026 6/10
skill GitHub
A pre-merge code review skill specifically aimed at failure patterns common in AI-generated code: deleted historical patches, unverified assumptions written as comments, and over-engineering. Uses a six-stage review process plus 23 language-specific guides, and works with Claude Code, Cursor, and Codex.
skillcode-reviewai-generated-code
by casperkwok Aug 5, 2026 6/10
skill GitHub
A set of 12 editorial skills plus independent review agents for Claude Code and Codex that structure, draft, diagnose, and revise documents while preserving the authors original meaning. Aimed at long-form writing rather than code.
writingeditorialskill
by OC-NeuralSense Aug 5, 2026 6/10
skill GitHub
A Claude Code skill that exports STL meshes directly into sliceable Bambu Studio .3mf projects, with print settings baked in and parts auto-packed across named plates. Useful for anyone using Claude Code to automate 3D-printing prep.
3d-printingskillbambu-studio
by m-esm Aug 5, 2026 6/10
skill GitHub
An open-source (MIT) plugin with a custom agent and three skills -- general readability guidance, editing existing text for readability, and explaining technical detail clearly -- aimed at fixing Claude's dense, jargon-heavy output. Ships with a default writing voice you can override with your own, and the guidance docs are usable even without installing the plugin itself.
readabilitywriting-styleplugin
by mxriverlynn Aug 5, 2026 6/10
skill Reddit
An open-source attempt to recreate Claude's officially announced 'Dreams' managed-agent capability, which is currently limited to enterprise plans with extra usage cost. The author reports it works, though it hasn't been tested long-term, and it's free to use right now.
dreamsmanaged-agentsexperimental
by No_Combination_6429 Aug 5, 2026 7/10
skill GitHub
Uses the agent-browser CLI to catch UI/UX bugs — text overflow, wrapping bugs, horizontal scroll, overlapping elements, tap targets, dark-mode and WCAG zoom/reflow issues — across mobile through desktop viewports. Maps each finding to the source file responsible and supports baseline/diff regression runs that skip unchanged pages.
uiaccessibilitytestingskill
by cdmx-in Aug 5, 2026 8/10
skill GitHub
An opinionated, production-ready plugin marketplace for Claude Code focused on craft, rigor, and practical excellence in AI-assisted development.
marketplaceplugins
by fernando-bertholdo Aug 5, 2026 6/10
skill Reddit
Maintains a single agent-neutral core of skills, policy, and spec-driven-development contracts, then uses per-agent adapters to publish it into Claude Code, Cursor, Codex, Copilot, and others, so a skill update doesn't need to be copied by hand into every tool.
skillscross-toolspec-driven-development
by walter-dexter Aug 5, 2026 6/10
skill Reddit
Connects to your repo and asks clarifying questions until it has assembled a spec with tasks and a dependency graph, then hands it to your coding agent to implement via a skill — aiming for spec-driven development without another markdown-file generator.
spec-driven-developmentskill
by The_Ace_72 Aug 5, 2026 6/10
skill GitHub
A set of agent skills that check Shopify, e-commerce, SEO, and GEO issues using deterministic checks backed by prevalence data from real scans rather than guesswork. Works with Claude Code, Cursor, Codex, and Gemini CLI via the open Agent Skills standard.
seoe-commerceshopifyskills
by maxbuildog Aug 5, 2026 6/10
skill GitHub
Reviews your work using a panel of independent expert personas in isolated seats with quarantined framing, then commits to a single anchored verdict. Ships with an 18-artifact evaluation set to check the review process itself.
code-reviewskillevaluation
by k-vaca Aug 5, 2026 7/10
skill GitHub
A Claude Code / Codex CLI plugin that generates HTML documents with a live preview, lets you leave inline review comments, and feeds that feedback back to the agent.
documentationreviewhtml
by u-ichi Aug 5, 2026 6/10
skill GitHub
A toolkit for having your coding agent build guided, interactive HTML demos.
demoshtml
by hyunghwan Aug 5, 2026 6/10
skill GitHub
A Claude Code plugin marketplace bundling 20 plugins spanning skills, verification, code review, agent orchestration, loop automation, and cost control.
marketplaceplugins
by matthews-wong Aug 5, 2026 6/10
skill GitHub
A skill that generates a meme from a single sentence of input, usable from Claude Code, Cursor, or any MCP-compatible agent, powered by the Create a Meme service.
funmemeskill
by RiskAverseTech Aug 5, 2026 5/10
skill GitHub
Manages the lifecycle of your personal Agent Skills privately and safely across multiple machines.
skillssync
by Pursuer-Hsf Aug 5, 2026 6/10
skill GitHub
Monitors the tools your repo depends on or competes with — competitors, upstream projects, dependencies — and surfaces what actually matters. Works with 45+ coding agents.
monitoringdependenciesskill
by mralabs Aug 5, 2026 7/10
skill GitHub
A set of portable markdown skills encoding decision frameworks and artifact templates for product management work.
product-managementskills
by ianklassen Aug 5, 2026 6/10
skill GitHub
An AWS Samples plugin marketplace extending Claude Code and Kiro with agentic operations for the AWS AI-Driven Development Lifecycle, covering Inception, Construction, and Operations phases.
awsmarketplacelifecycle
by aws-samples Aug 5, 2026 7/10
skill GitHub
Two Claude Code skills that generate a working spec and guardrail rules for any repository, greenfield or brownfield. Aims to give agents a spec they can work from and boundaries they cannot bypass.
skillagent-harnessguardrails
by nguyenhx2 Aug 4, 2026 5/10
skill GitHub
A Claude Code skill that has the agent write one Obsidian note per new concept after each delivery: why it appeared, an analogy, and what breaks if you change it. Aimed at people who need to understand agent-built code without reading it directly.
skillobsidiandocumentation
by JessieMeguro Aug 4, 2026 7/10
skill GitHub
A set of Claude Skills covering the US federal government capture and proposal lifecycle, structured as a flat artifact pipeline. Apache-2.0 licensed.
skillfederalproposal-writing
by danielkinneyspears Aug 4, 2026 6/10
skill GitHub
A collection of portable coding-agent skills covering UI mockup generation, browser-based verification, codebase memory, and isolated git worktree workflows.
skilluibrowser-verificationworktrees
by ConnorGriffin Aug 4, 2026 6/10
skill GitHub
A dotfiles-style repository that codifies automated macOS setup alongside Claude Code skills, agents, and configuration.
skilldotfilesmacos
by djtjwillia Aug 4, 2026 5/10
skill GitHub
A Claude Code skill that exports UniFi network topologies as zoomable vector diagrams and editable draw.io files, using real device data from a UniFi controller.
skillunifinetworkingdiagrams
by Josiecontrolling326 Aug 4, 2026 5/10
skill GitHub
A skill collection for making agent-driven code cheaper and safer to change: continuous-specification (spec-driven TDD), nullables (mock-free testing of I/O code), bounded refactoring, micro-commits, and ensemble-review (three concurrent model reviews synthesized into one revision plan).
skilltddrefactoringcode-review
by jonfazzaro Aug 4, 2026 8/10
skill GitHub
Claude agent skills that turn JoomPulse marketplace data into Mercado Livre seller workflows: market research, competitor tracking, and product discovery. Requires the JoomPulse MCP server.
skillecommercemercado-livre
by joomcode Aug 4, 2026 5/10
skill GitHub
A tiny Claude Code skill that installs a quality-first, cost-efficient model/effort-tiering rule into a project's CLAUDE.md via the /tier command. Lets teams standardize which model tier to use for which kind of task without hand-writing the rule each time.
skillclaude.mdcost-optimizationmodel-selection
by thephenyl02-creator Aug 4, 2026 6/10
skill GitHub
A Claude Code skill for parametric FDM 3D-print modeling using trimesh/manifold3d/build123d, with a headless view-screenshot-iterate loop so the agent can visually check its own models. Useful for makers who want an agent-driven CAD workflow.
skill3d-printingcadheadless
by m-esm Aug 4, 2026 6/10
skill GitHub
A collection of open-source Claude Code skills from Blink Build Studios, published as an installable plugin marketplace. Description is thin on specifics but provides a ready-made source of skills to browse.
skillmarketplaceplugins
by Blink-Build-Studios Aug 4, 2026 5/10
skill GitHub
A Claude Code skill plus CLI that converts lecture recordings into structured, grounded notes with a synced HTML viewer combining video, timestamped transcript, and summary. Uses a local GPU pipeline (Whisper ASR, slide extraction, OCR, VLM) so no cloud transcription is needed.
skilltranscriptionlocal-gpunotes
by drpwchen Aug 4, 2026 6/10
skill GitHub
Nen ships six installable agent skills themed around performance, refactoring, launch, reverse engineering, reliability, and orchestration. A playful but practical grouping of common engineering skill categories for Claude Code.
skillrefactoringperformanceorchestration
by rlaope Aug 4, 2026 6/10
skill GitHub
A set of MIT-licensed agent skills that act as guardrails after AI coding sessions — checking for leaked secrets, running pre-merge checks, triaging flaky tests, and detecting env/flag drift. Designed to catch mistakes before they ship.
skillsafetycisecrets
by Wanbinyu Aug 4, 2026 6/10
skill GitHub
A set of cross-agent skills covering visual QA and email automation workflows, usable across different coding agents including Claude Code. Provides ready-made skill definitions for two specific automation domains.
skillvisual-qaemail-automation
by dengshangli Aug 4, 2026 5/10
skill GitHub
A field-tested discipline for industrial-product 3D modeling in Blender that's parametric, headless, and verifiable, shipping docs, verification gates, and a Claude Code skill plus agent pipeline. Aimed at product designers who want an agent-driven, checkable Blender workflow.
skillblender3d-modelingheadless
by kai-chop Aug 4, 2026 6/10
skill GitHub
A curated collection of Claude Code skills covering AI image production, AI music production, instructional design, and general workflow improvement. Good starting point for creative and non-coding use cases of Claude Code skills.
skillcreativeinstructional-design
by phillipalcock Aug 4, 2026 6/10
skill GitHub
A Claude Code skill that inspects a source video clip, proposes short-form edit ideas, and exports finished vertical clips ready for TikTok, Reels, or Shorts. Brings agent-driven video editing suggestions into the Claude Code workflow.
skillvideo-editingshort-form-content
by phillipalcock Aug 4, 2026 6/10
skill GitHub
An agent skill that walks both the codebase and the live running app in a browser to build a verified use-case catalog, generating an in-app panel, a demo deck, and a report of dead/unused features. Useful for teams wanting an accurate, agent-verified map of what a product actually does.
documentationskillcodebase-analysis
by succtorlin Aug 4, 2026 6/10
skill GitHub
pillars is an open standard that decomposes a monolithic AGENTS.md/CLAUDE.md into tiered 'pillar' files describing a project's conventions, decisions, and constraints. Useful for keeping coding agents consistently aligned with project rules as codebases and instruction sets grow.
conventionsagents-mdproject-config
by hannsxpeter Aug 4, 2026 6/10
skill GitHub
A composable set of Claude Code Agent Skills covering literature review, research logs, experiment tracking, analysis, lab presentations, manuscript writing, and peer review. Useful for academic and research teams wanting to apply Claude Code to the full scientific workflow, not just coding.
researchacademicskill-collection
by zi-yue-1129 Aug 4, 2026 6/10
skill Reddit
wiseman is a Claude Code plugin that generates a human-and-agent-readable wiki for your project: a /wiseman-summon skill researches dependencies and builds wiki pages, a hook checks the wiki for relevant lessons before each coding task, and /wiseman-dashboard opens a readable view. Useful as a free, self-hosted alternative to paid context tools like context7, accumulating project-specific lessons over time.
pluginwikiproject-memory
by TGoddessana Aug 4, 2026 7/10
skill GitHub
An all-in-one, categorized open collection of AI Agent Skills in SKILL.md format, part of a broader 'Mega AI Bazaar' project. Useful as a browsable directory when looking for existing Claude Code skills to reuse rather than writing your own from scratch.
skill-collectiondirectoryopen-source
by Drvivek34 Aug 4, 2026 5/10
skill GitHub
A Claude Code skill and slash command that converts course markdown into a single self-contained HTML quiz page with randomized questions, an answer key, and pass/fail scoring, then publishes it to GitHub Pages. Handy for course creators wanting quick interactive assessments.
skilleducationgithub-pages
by the3ma Aug 4, 2026 6/10
skill GitHub
A Claude Code skill that runs repeated rounds of review and revision over design and planning documents until all flagged issues are resolved and closed. Simple structured process for tightening specs before implementation.
skillplanningreview
by MarkAsir Aug 4, 2026 5/10
skill GitHub
A Claude Code skill encoding interface microcopy rules plus an 'AI-tell' strip pass to make button and error text read as human-written rather than obviously AI-generated. Useful for teams wanting consistent, natural UI copy from agent-driven design work.
skilluxcopywriting
by humbleteam Aug 4, 2026 6/10
skill GitHub
A Claude Code skill for answering questions about the EU AI Act (Regulation 2024/1689) and running static/dynamic compliance audits on codebases to flag prohibited practices, missing transparency controls, and unmet high-risk safeguards. Useful for teams needing AI regulatory compliance checks baked into their dev workflow.
skillcomplianceeu-ai-act
by DirtyBeastAfterTheToad Aug 4, 2026 6/10
skill GitHub
A collection of opinionated plugins and workflow extensions for Claude Code from a single maintainer. Useful as a grab-bag of ready-made customizations for users who want pre-built conventions rather than authoring their own from scratch.
pluginsworkflow-extensionscustomization
by bengous Aug 4, 2026 5/10
skill GitHub
A skill for Cursor and Claude Code that puts the agent into 'goal-mode,' keeping it iterating until tests, lint, and CI all pass rather than stopping after a single attempt. Installable via npx skills add for a quick drop-in addition to a project's skill set.
skillsgoal-modecitesting
by shenwell Aug 4, 2026 6/10
skill GitHub
A Claude Code / AI agent skill that encodes Matthew Butterick's Practical Typography rules so agents can audit and produce publication-grade text formatting. Useful for anyone generating documents, reports, or web copy where typographic quality matters.
typographywritingskilldocuments
by danium Aug 4, 2026 6/10
skill GitHub
Monitors installed Claude Code Skills for upstream changes, re-scores risk using SkillSpector, and auto-opens GitHub Issues when drift is detected — supply-chain security for the growing Skills ecosystem. Ships as both a GitHub Action and a Go CLI.
securitysupply-chainskillsgithub-action
by kpab Aug 4, 2026 7/10
skill GitHub
A set of pipeline-orchestration skills for Claude Code covering publish-post, agents-md-generator, work-tracking, feature-spec, and stage-draft tasks. Useful as ready-made building blocks for structuring multi-step content and dev workflows.
skillspipelineorchestrationcontent
by slogsdon Aug 4, 2026 6/10
skill Reddit
A practical technique for stopping CLAUDE.md from going stale: keep only rarely-changing facts (verification commands, hard limits, known-problem notes) in the file, and move volatile session state to a handoff note, live status to a script the file points to, and project history to a separate memory index. Also separates planning and coding into distinct session files to keep each one focused.
claude-mdcontext-managementbest-practices
by Euphoric_Daikon_3582 Aug 4, 2026 6/10
skill GitHub
A Claude Code plugin adding AI-driven development support for Smalltalk in the Pharo environment. Niche but fills a gap for one of the few languages without much existing Claude Code tooling.
smalltalkpharopluginniche-language
by mumez Aug 4, 2026 5/10
skill GitHub
A Claude Code skill that runs research-backed UX and conversion audits of ecommerce product detail pages, producing prioritized, evidence-based reports. Useful for teams wanting a repeatable, agent-driven conversion-rate review process.
ecommerceux-auditskillconversion
by llizell Aug 4, 2026 5/10
skill GitHub
A Claude Code skill that measures how visible a company or market is to AI assistants like ChatGPT, mapping which brands get recommended and why. Useful for marketers or founders wanting to understand and improve their presence in AI-generated answers.
skillseoai-visibility
by unfamiliar-city Aug 4, 2026 6/10
skill GitHub
A collection of Agent Skills for Claude Code including a 'ship → babysit' pipeline for taking work from implementation through monitoring. Distributed via positronick.com for developers wanting reusable, proven skill workflows.
skillpipelineautomation
by nsollazzo Aug 4, 2026 6/10
skill GitHub
A Claude Code plugin marketplace tailored to maintainers of the Rook storage project, bundling code review, triage, and systemic-PR skills. A concrete example of building a project-specific plugin marketplace on top of Claude Code.
plugin-marketplaceskillmaintainer-tools
by jhoblitt Aug 4, 2026 5/10
skill GitHub
A single installer for six agent skills (super-ux, task-pipeline, agent-sync, make-skill, sheleg-design, seo-aeo-audit) that work across Claude Code, Cursor, Codex, and 70+ other agent tools. Simplifies setting up a curated skill set across multiple coding agents at once.
skillinstallermulti-agent
by ssheleg Aug 4, 2026 6/10
skill GitHub
A composable toolkit of skills, subagents, loop patterns, and MCP templates that works across Claude Code, Cursor, OpenCode, Copilot, Windsurf, and Pi. Aimed at developers who want reusable building blocks for constructing agent workflows rather than starting from scratch each time.
skillmcptoolkit
by ulises-jeremias Aug 4, 2026 6/10
skill GitHub
A set of skills for AI coding agents focused on engineering quality, designed to keep a human reviewer in the loop rather than letting the agent act fully autonomously. Targets teams wary of unchecked agentic changes to production code.
skillcode-qualityhuman-in-the-loop
by kreek Aug 4, 2026 5/10
skill Reddit
A practitioner's roundup of the Claude Code skills, plugins, MCPs, and companion tools that stuck as part of a real workflow rather than just looking good in a demo, including Ponytail (minimal-diff discipline), OldHand (full-flow QA), React Doctor (React anti-pattern scanner), Trail of Bits security skills, Muster (unified process/log runner), Ruflo (multi-agent coordination), Serve Sim (iOS Simulator control), and ScrapeGraph AI (LLM-based web extraction). Useful as a filtered starting point for discovering tools worth trying instead of sifting through every new release.
skillrounduptooling
by not_bsb7838 Aug 4, 2026 7/10
skill GitHub
A Claude Code skill providing a prompt framework and ComfyUI model/quantization reference plus troubleshooting for MiniMax H3, an open-weight omni-modal video model, covering text-to-video, image-to-video, first-last-frame, and reference-to-video generation. Useful for developers using Claude Code to drive local video-generation pipelines.
skillvideo-generationcomfyui
by teskor-hub Aug 4, 2026 6/10
skill GitHub
A Chinese-language collection of 21 Claude Code skills plus global 'iron rules' and physical guardrails meant to make Claude Code follow engineering discipline consistently, with one-click install. Aimed at teams wanting a stricter, more standardized Claude Code workflow out of the box.
skillguardrailsstandardization
by xcodethink Aug 4, 2026 7/10
skill GitHub
A registry and marketplace for production-ready AI agent profiles usable with Claude Code, Cursor, and Codex, letting users search, install, and contribute packages. Useful for quickly bootstrapping agent configurations instead of writing them from scratch.
skillregistryagent-profiles
by nota-america Aug 4, 2026 5/10
skill GitHub
A set of Claude Code plugins covering agent memory and verification: a second-brain for durable domain-agent knowledge, apiary for multi-contributor knowledge bases, and a scout-generator-critic-mediator pattern for adversarial multi-agent review.
pluginmemorymulti-agentreview
by ahartzog Aug 3, 2026 7/10
skill GitHub
A Claude skill that builds ad strategy before campaign setup — covering research, hypotheses, platform selection, phased budgeting, and KPI definition. Documentation is in Russian.
skillmarketingstrategy
by ai-hub-open Aug 3, 2026 5/10
skill Reddit
A skill/output style for Claude Code (and Codex, Cursor, Gemini CLI, Copilot, Zed) built around ADHD-friendly, air-traffic-control-style terseness — replacing hedged, wordy responses with direct action statements like exact commands and file:line references.
output-styleskilladhdclarity
by aaddrick Aug 3, 2026 7/10
skill GitHub
An adversarial-collaboration multi-agent skill for Claude Code with 7 specialized agents (leader, convener, architect, frontend, coder, reviewer, docs-researcher) that independently audit every decision to counter single-agent cognitive tunneling. Includes an 11-phase workflow, 4 operating modes (Safe/Normal/Auto/YOLO), a weighted decision engine, and automatic backups.
multi-agentskillreviewworkflow
by dxkjuanjuan Aug 3, 2026 7/10
skill GitHub
A plugin marketplace for Claude Code and Cursor offering workflow, git, Ruby, and security skills, each backed by real evaluation fixtures rather than just descriptions.
marketplacepluginskilleval
by mac-builds-things Aug 3, 2026 7/10
skill GitHub
A Claude Code plugin that turns the agent into a complete game studio covering design, Unity, 3D/2D art, animation, and audio — with 159 knowledge files, 7 agents, and 7 skills. Documentation is in Spanish.
game-devunitypluginskill
by MichaelH14 Aug 3, 2026 7/10
skill GitHub
A Claude Code agent skill for evidence-chain industry analysis of China's A-share stock market. Documentation is in Chinese.
skillfinancechina
by zaynzayn-au Aug 3, 2026 5/10
skill GitHub
An autonomous lab-machine engagement loop for Claude Code that runs Kali Linux in a container, drives it via a skill, and rewrites its own methodology notes after each run — useful for practicing/automating CTF-style penetration testing labs.
securitypentestskillkali
by euriconicacio Aug 3, 2026 7/10
skill GitHub
A Claude Code skill that converts a coding session into a report a non-technical stakeholder can act on, preserving the full engineering reasoning while defining every term at first use.
skillreportingdocumentation
by delpicorp Aug 3, 2026 6/10
skill GitHub
Runtime-neutral SKILL.md guidance for designing multi-step AI agent skills that can resume after interruption, retry safely, and gate destructive actions behind explicit confirmation.
skillskill-designsafety
by clearlane Aug 3, 2026 6/10
skill GitHub
A Claude Code skill that composes sub-agents on the fly at runtime, paired with live probe evidence documenting how the sub-agent context boundary actually behaves in practice.
skillsubagentscomposition
by OpenCnid Aug 3, 2026 7/10
skill GitHub
A rubric and footprint-measurement tool for identifying always-on instruction bloat — CLAUDE.md content, rules, and skill descriptions — that degrades coding agent performance as a setup ages, with a multi-repo workflow for trimming it.
skillclaude-mdtoken-efficiencycontext
by evolsb Aug 3, 2026 7/10
skill GitHub
A cross-machine store of durable lessons a Claude Code agent learns from real work, with graded candidate lessons, git-synced knowledge domains, and loop conventions that include retrospectives.
skillmemoryretrospective
by mwgrant21 Aug 3, 2026 6/10
skill GitHub
A Claude Code agent skill for renting and managing GPUs on vast.ai directly from the agent.
skillgpuvast.ai
by RazinAleksandr Aug 3, 2026 6/10
skill Reddit
Argues that skills and MCP solve different problems rather than one replacing the other: MCP is the capability layer giving an agent access to external tools/resources, while a skill is operational knowledge about when and how to use that access, loaded only when needed. Proposes a three-layer split: CLAUDE.md for persistent facts, skills for on-demand procedures, MCP for external access.
skillmcpconcepts
by Particular_Luck80 Aug 3, 2026 6/10
skill GitHub
A Claude Code skill giving agents Spark Bitcoin Layer-2 wallet capabilities, including L402 support for machine-to-machine payments between AI agents.
skillbitcoinpayments
by echennells Aug 3, 2026 6/10
skill GitHub
A collection of production-ready Claude Code skills covering Cloudflare, React, Tailwind v4, and AI service integrations.
skillcloudflarereacttailwind
by secondsky Aug 3, 2026 6/10
skill GitHub
A skill set for scaffolding and managing Architecture Decision Records, a plan queue, and AGENTS.md conventions for the Claude Code and pi coding agents — includes a bootstrap skill plus lifecycle skills to author, queue, ship, and audit ADRs.
skilladrdocumentationworkflow
by EvolveHQ Aug 3, 2026 7/10
skill GitHub
An approval-gated code-quality audit skill covering Clean Code, SOLID, DRY, KISS, YAGNI, design-pattern justification, maintainability, testability, and scalability — requires explicit approval before making changes.
skillcode-qualityaudit
by PabloViniegra Aug 3, 2026 6/10
skill GitHub
Production-quality Claude Code skills for context handoff between sessions, project bootstrap, and a skill catalog, evaluated against Anthropic's writing-skills and skill-creator rubric with 100% trigger accuracy.
skillcontext-handoffbootstrap
by cabaynes Aug 3, 2026 6/10
skill GitHub
A Claude Code marketplace plugin of production-readiness audit skills that audits a whole project across ten engineering domains and tracks findings in a durable workspace.
skillmarketplaceauditproduction-readiness
by atifgul99 Aug 3, 2026 7/10
skill GitHub
A growth-engine skill set for Claude Code and Cursor covering SEO, AEO, GEO, and social growth. v0.1.0 ships an audit skill that scores crawl-hygiene and AI-visibility gates, plus a geo-artifacts skill that generates llms.txt, llms-full.txt, and facts.json for AI crawlers.
seogeomarketing
by bemoshiur Aug 3, 2026 6/10
skill GitHub
A Claude Code skill adapted from Karpathy's LLM Council concept: five advisors independently analyze a decision, blind peer-review each other with a forced ranking, and a chairman delivers one final verdict. Useful for stress-testing important decisions from multiple angles.
decision-makingmulti-agent
by Carlos-Padilla-Bravo Aug 3, 2026 7/10
skill GitHub
A Claude Code skill encoding sentence-level readability rules for prose meant to be read by humans, with each rule pinned to psycholinguistics research. Helps rein in overly dense or unnatural AI-generated writing.
writingreadability
by homeowmorphism Aug 3, 2026 6/10
skill GitHub
An open-source skill for analyzing negative campaigning in political discourse, based on academic research from Universidad Central de Chile. A niche but well-grounded analytical skill.
political-analysisresearch
by rizomaai Aug 3, 2026 5/10
skill GitHub
A Claude Code plugin bundling slash commands, hooks, and a skill for working with CommonTrace's shared knowledge base. Lets a team query and contribute to a common knowledge store from within Claude Code.
knowledge-baseplugin
by commontrace Aug 3, 2026 5/10
skill GitHub
A Claude skill and CLI that reads a HubSpot portal read-only and reports the minimum tier its actual usage requires, citing the specific feature and verification date behind each claim. Deliberately avoids asserting what you currently pay, since the API can't see billing. Pure Python, no dependencies.
hubspotcost-optimization
by meticulosity Aug 3, 2026 6/10
skill GitHub
Twenty growth-operations skills plus industry playbooks for local service businesses, agencies, and B2B, built for Claude Code and Hermes Agent. Pure markdown with no executable code.
growth-opsmarketing
by On-mission96 Aug 3, 2026 5/10
skill GitHub
A set of Claude skills covering advertising and marketing strategy, campaign structure, targeting, creative, and budgeting across Google Ads, Meta Ads, TikTok, and more. Aimed at marketers running paid campaigns with Claude's help.
advertisingmarketing
by adkit Aug 3, 2026 5/10
skill GitHub
A set of Claude Code skills covering technical SEO audits, backlinks, AI-optimized content, local SEO, and social amplification — aimed at ranking in both Google and LLM answers like ChatGPT, Perplexity, and Gemini.
seogeo
by Thibaultbm Aug 3, 2026 5/10
skill GitHub
A self-contained design arsenal skill for Claude Code that vendors 20 curated design sources into grep-able local indexes covering components, marketing sections, application UI, shaders, brand logos, color ramps, and review rulebooks. Lets Claude search real design references locally instead of guessing.
designui
by worldofhacks Aug 3, 2026 6/10
skill GitHub
A set of Claude skills that make output look and read right by default: branded Word and PowerPoint generation, a logic-and-slop prose reviewer, a guided read-along tour of overnight AI work, and Markdown-to-Kindle-EPUB or plain-print-PDF conversion with working links, tables, and local Mermaid diagrams. Usable either as a claude.ai upload or dropped into Claude Code.
documentsexport
by dzivkovi Aug 3, 2026 6/10
skill GitHub
Manages the full lifecycle of Claude Code skills through six modes — CREATE, IMPROVE, VALIDATE, REVIEW, OPTIMIZE, PACKAGE — using binary BinEval scoring with threshold-blind, cross-family-calibrated judges. Includes a gated self-update loop, pressure testing, and ten authoring principles grounded in empirical research.
skill-authoringevaluation
by smixs Aug 3, 2026 6/10
skill GitHub
A collection of skills that turn Claude Code or Codex into a long-lived personal tutor, tracking learning progress across sessions.
educationtutor
by briannajzhang Aug 3, 2026 5/10
skill GitHub
A Claude Code skill that runs preflight checks on implementation plan documents, gating them with a binary PASS/FAIL verdict before work begins. Helps catch weak or incomplete plans before they turn into wasted execution time.
planningquality-gate
by jw1222 Aug 3, 2026 6/10
skill GitHub
A set of Anthropic Agent Skills tailored for stock traders, built on the Haruspex platform.
tradingfinance
by Haruspex-guru Aug 3, 2026 5/10
skill GitHub
A Claude Code skill that delegates tasks to OpenAI Codex — via shell or macOS GUI computer-use — and returns evidence of what was done. Useful for splitting work across coding agent vendors within one session.
codexcross-vendordelegation
by LucasDuys Aug 3, 2026 6/10
skill GitHub
An agent skill built on the premise that 'ugly' UI is often code quietly lying to its framework: it verifies every prop, slot, enum value, token, icon, and i18n key against the installed source before redesigning, audits who actually owns layout, and locks the contracts into tests.
uiverification
by silkyland Aug 3, 2026 6/10
skill GitHub
Defines an enforced handover document format for agent-to-agent handoffs — a strictly validated header plus prose body — with deterministic linting and repo-aware verification. Ships with a trap-based benchmark that measures whether a handoff actually transfers the needed context.
handoffdocumentationverification
by geekidharsh Aug 3, 2026 6/10
skill GitHub
A Claude Code design-exploration plugin that takes a single domain/screen and produces 30 different design style mockups from it, helping teams quickly compare visual directions.
designexploration
by deokjinlog Aug 3, 2026 5/10
skill GitHub
An editing method and Claude Code/Codex skill for making prose sound like a person wrote it, without changing the underlying facts. Targets the common 'obviously AI-written' tell in drafts.
writingediting
by quietmill Aug 3, 2026 6/10
skill GitHub
A qualitative-analysis skill with five method-specific workflows and Markdown/HTML reporting, aimed at keeping analysis evidence-led rather than impressionistic.
qualitative-researchreporting
by thePlannerIvan Aug 3, 2026 5/10
skill GitHub
Twenty-one Claude Code skills for building web interfaces that don't read as AI-generated: forces a written visual direction before any element is placed, wires in seven shadcn registries (514 components), sets a GPU performance floor for WebGL/canvas work, and gates every build with Playwright checks across 5 viewports. Targets Next.js, React, and Tailwind v4.
uidesign-quality
by OthmanAdi Aug 3, 2026 7/10
skill GitHub
Agent skills for producing correct Arabic and right-to-left output in PDF, Word, and PowerPoint documents, with a PNG preview step for visual verification before delivery.
arabicrtloffice-documents
by asadeisa Aug 3, 2026 6/10
skill GitHub
Twenty-five production-tested defensive security skills covering WordPress, VPS, and Cloudflare/Next.js hardening, AI agent guardrails, MCP security, prompt-injection defense, the OWASP LLM Top 10, LLM-specific failure modes like slopsquatting and hallucinated APIs, incident response, and GDPR/DACH compliance. MIT licensed and described as battle-tested.
securitydefensive
by GoldenWing-360 Aug 3, 2026 8/10
skill GitHub
A skills.sh agent skill that takes a raw product idea and turns it into a grounded, buildable software requirements document (SRD) suite, ready to hand off to implementation.
product-specplanning
by maxgfr Aug 3, 2026 6/10
skill GitHub
A set of agent skills for shotgun metagenomics analysis, organized by scientific stage of the workflow.
bioinformaticsmetagenomics
by PKU-EMBL Aug 3, 2026 5/10
skill GitHub
An agent skill for translating academic PDF papers into another language while rebuilding them as readable, searchable, page-by-page-verifiable documents. Handles complex tables and figures and finishes with Zotero integration.
translationpdfacademic
by ezra-y Aug 3, 2026 6/10
skill GitHub
An open-source, Apache-2.0-licensed library of SRE skills for AI agents, each shaped around an established site-reliability methodology rather than ad hoc runbooks.
srereliability
by anyshift-io Aug 3, 2026 6/10
skill GitHub
Creates a handover summary so you can continue a Claude Code task on a different machine, working around the fact that Claude Code's session-resume feature doesn't work across machines.
handoffsessioncross-machine
by clever-cc-plugins Aug 3, 2026 6/10
skill GitHub
An AI skill focused on writing Ansible roles, helping structure infrastructure-as-code output correctly.
ansibleinfrastructure
by bzdvdn Aug 3, 2026 5/10
skill GitHub
A Russian-language skill that turns a draft explainer article into text a newcomer can actually understand, running 41 checks across 7 phases with a final gate before it's considered done. Part of the RixAI system.
writingrussian
by morf3uzzz Aug 3, 2026 5/10
skill GitHub
Five Claude Skills automating SaaS compliance and trust workflows: security questionnaires, SOC 2 readiness, vendor risk assessment, audit evidence collection, and trust page audits. Aimed at teams that need to move faster through vendor security reviews.
skillcompliancesoc2saassecurity
by mercydeez Aug 2, 2026 6/10
skill GitHub
A Claude skill that turns a single request into a narrated mythic short film styled as a layered cut-paper diorama, complete with three-colour cardstock worlds and paper-wipe transitions. Outputs one assembled MP4 from a text prompt.
skillvideocreativegenerative
by sadekxD Aug 2, 2026 5/10
skill GitHub
A personal collection of battle-tested Claude skills covering Notion GTD sessions, a book print pipeline, PrusaSlicer profiles, and a language tutor. A grab-bag of real-world automation examples beyond typical dev tooling.
skillnotion3d-printingproductivity
by makukhin-ie Aug 2, 2026 6/10
skill Reddit
A developer used Anthropic's Opus 5 prompting guide to audit and rework their CLAUDE.md, finding that many instructions told Opus 5 to do things it already does by default, which Opus 5 then compounded into slower, less accurate runs. Highlights that coding guidelines shared with other tools like Copilot may need to diverge from Opus-5-tuned CLAUDE.md content.
skillclaude-mdopus-5prompting
by our_sole Aug 2, 2026 6/10
skill GitHub
A curated list of Claude Code skills, agents, memory setups, and profiles for accomplishing cybersecurity tasks, projects, and jobs. An awesome-list style entry point into the security-focused Claude Code ecosystem.
skillsecurityawesome-listcybersecurity
by jassics Aug 2, 2026 5/10
skill GitHub
An evidence-driven Claude Code skill for designing good Mathlib (Lean 4) definitions, covering precedent excavation, design axes, and compiling example sheets. A niche but rigorous example of a domain-specific research skill.
skillmathliblean4formal-math
by homeowmorphism Aug 2, 2026 5/10
skill GitHub
A Claude Code skill for adaptive teaching on any topic, maintaining a persistent learner model and an evidence-pinned answer protocol across sessions. Aims to tailor explanations to what the learner already knows rather than restarting from scratch each time.
skilleducationadaptive-learning
by homeowmorphism Aug 2, 2026 6/10
skill GitHub
A shared bootstrap for Claude Code teams that bundles skill packages, review hooks, MCP servers, and a common CLAUDE.md into one setup. Aims to keep configuration consistent across a team's repos instead of each developer hand-rolling their own.
bootstrapteamskillshooksmcpclaude.md
by farofy Aug 2, 2026 6/10
skill GitHub
A Claude skill that analyzes Strava running data to compute decoupling, heart-rate zone time, and pace-at-HR trends that Strava's own dashboards don't surface. Scores execution honestly rather than just reporting raw stats.
skillstravafitnessdata-analysis
by alexandre-thiry Aug 2, 2026 5/10
skill GitHub
An agent skill that scans a project, researches its market with sourced evidence, and identifies monetization gaps. Outputs action specs an agent can execute directly, turning research into actionable next steps.
skillmonetizationmarket-researchbusiness
by succtorlin Aug 2, 2026 6/10
skill GitHub
A Claude Code skill that measures how visible a brand is across AI answer engines (Google AI Overview, ChatGPT, Claude, Gemini, Yandex Alice) by driving a logged-in browser agent to read the actual rendered answer rather than an API response. MIT licensed.
geoseobrand-monitoringai-search
by Pupok462 Aug 2, 2026 6/10
skill Reddit
A researched framework covering how to write CLAUDE.md/AGENTS.md files, prompts, and plans so instructions actually reach and hold up in the model — including authority conflicts, instruction overload, prompt injection, and compaction survival. Ships as a standalone Markdown file or a packaged skill for Claude Code, Codex, Cursor, and OpenCode. MIT licensed.
promptingclaude.mdskillprompt-engineering
by Anbeeld Aug 2, 2026 7/10
skill GitHub
A one-command setup that turns a repository into a place where AI coding agents follow enforced conventions — generating agent instructions, golden-path examples, and machine-enforced gates for stacks like FastAPI, React, TypeScript, containers, AWS CDK, and GitHub Actions.
agent-instructionsci-gatesconventionsscaffolding
by samar1066 Aug 2, 2026 6/10
skill Reddit
A practitioner sorted all 79 rules in their CLAUDE.md against advice from Claude Code creator Boris Cherny, who suggests periodically deleting CLAUDE.md/skills/hooks and re-adding instructions only when the model actually struggles without them. Only 22% of the rules turned out to be genuine delete candidates, highlighting how much of typical CLAUDE.md content may be unnecessary bloat.
CLAUDE.mdbest-practicesprompt-engineering
by Bulky_Ad738 Aug 2, 2026 7/10
skill GitHub
A Claude Code / Codex / Cursor skill that generates a project report reviewing what shipped, tracing every problem back to the specific change that introduced it, and pricing out the cost of each next step. Framed as a post-mortem tool for teams running agentic development.
skillpostmortemreporting
by tensorboy Aug 2, 2026 6/10
skill GitHub
A Claude Code skill that measures whether agents actually follow the skills, rules, and agent definitions they're given, rather than assuming instructions are being followed. Automated behavioral testing for a problem many CLAUDE.md authors only discover the hard way.
skilltestingcompliance
by shimo4228 Aug 2, 2026 7/10
skill GitHub
A curated, MIT-licensed collection of Agent Skills, subagents, and rules built against the open Agent Skills standard rather than being Claude-Code-only. Intended as a pick-and-choose library rather than an all-or-nothing framework.
skillssubagentsopen-standard
by shimo4228 Aug 2, 2026 6/10
skill GitHub
A set of portable Claude Code skills plus an agent panel that translates entire projects or individual files into any language, covering codebase i18n, WordPress/gettext, and documentation. Includes adversarial QA, per-run domain specialization, and terminology research to keep translations consistent.
translationi18nskill
by roshaw Aug 2, 2026 6/10
skill GitHub
Converts a book you already own into a Claude skill — a short index plus one file per chapter, loaded only when needed — so an agent can reference the book's content on demand. Free, MIT-licensed, and requires no coding.
skillknowledge-baseno-code
by shaunmarsden Aug 2, 2026 6/10
skill GitHub
Helps convert a task you keep re-prompting for into a proper Claude skill with real guardrails and stop conditions, instead of leaving it as an ad hoc one-off prompt. Free, MIT-licensed, no coding required.
skillmeta-toolingno-code
by shaunmarsden Aug 2, 2026 7/10
skill GitHub
A set of 28 open-source-intelligence skills that turn Cursor, Claude, and other AI coding agents into a research platform for reconnaissance, attribution, GEOINT, and breach checks. Described as ethical, sourced, and passive-first.
osintskillresearch
by useosint Aug 2, 2026 6/10
skill GitHub
An agent skill that fetches a Reddit post and its full comment thread and converts it to markdown, for Claude Code, Codex, and other agents that can't fetch reddit.com directly.
skillredditweb-scraping
by marinsokol5 Aug 2, 2026 6/10
skill GitHub
A Claude Code skill that redesigns a Google Slides deck to match branding you point it at, then renders every slide it touches and inspects the resulting image before calling the job done — closing the loop between editing and visual verification.
skillgoogle-slidesvisual-verification
by eranw2000 Aug 2, 2026 6/10
skill GitHub
An agent skill for Claude Code, Codex, and Kimi that extracts complete figures and images from PDF, arXiv, and HTML papers, using caption-bounding-box detection with high-DPI PyMuPDF cropping and a contact-sheet QA step to verify the crops.
skillpdfresearch-tools
by Sunrich-HT Aug 2, 2026 6/10
skill GitHub
Stores project context in the repository itself rather than in the model's memory, so context that would otherwise be lost between Claude Code sessions persists as part of the codebase.
context-managementmemoryskill
by claudneysessa Aug 2, 2026 6/10
skill GitHub
A starter memory vault for coding agents that ships completely empty, built around the idea that the hard part of agent memory isn't storing what an agent learned — it's stopping the store from filling up with stale facts over time.
memorystarter-kitskill
by BrinShadewater Aug 2, 2026 6/10
skill GitHub
An SEO audit skill that leads with evidence and reasoning before producing fixes, aiming to give an agent implementable fixes instead of generic boilerplate advice like 'your meta description is too long.'
seoskillaudit
by BrinShadewater Aug 2, 2026 5/10
skill GitHub
A starter kit for building a custom AI research agent on top of Claude without writing code, released alongside the Build with Dorgham YouTube channel.
research-agentstarter-kitno-code
by buildwithdorgham Aug 2, 2026 5/10
skill GitHub
A Claude skill for generating scientific charts — bar, line, scatter, box plot, heatmap, and more — via Python/matplotlib, aimed at papers, lab reports, and academic publications.
skilldata-visualizationmatplotlib
by Defani Aug 2, 2026 5/10
skill GitHub
A personal knowledge management setup for Claude Code that uses an Obsidian vault as external memory, growing with every session. Ships 5 slash commands and AI-first note conventions, built on the ideas in Karpathy's LLM Knowledge Bases writeup.
obsidianmemorypkm
by dmitrax Aug 2, 2026 7/10
skill GitHub
Two Claude Code skills for working through a single academic paper: /paper-review does a journal-club-style appraisal with a deterministic GRADE + CrossRef gate, and /paper-digest does fast content absorption. Designed to pair with separate paper-radar (discovery) and paper-fetch (download) skills.
skillacademic-papersresearch
by drpwchen Aug 2, 2026 7/10
skill GitHub
A set of 8 Claude Code skills distilled from a single real production project, covering verification discipline, spreadsheet (xlsx) surgery, async task UI, and more — each rule written up as having been paid for by an actual incident.
skillproduction-lessonsverification
by poloplay0114 Aug 2, 2026 7/10
skill GitHub
An open-source FinOps knowledge skill and MCP covering 28 reference files across AWS/Azure/GCP/OCI cost management, AI inference economics, Kubernetes, data platforms, allocation, chargeback, anomaly management, waste detection, and GreenOps. Installs into 11 AI tools and refreshes monthly.
finopscloud-costskill
by OptimNow Aug 2, 2026 7/10
skill GitHub
Lets an AI agent build and edit CapCut desktop projects via edit-list driven generation, including split-screen vertical layouts and surgical timeline cuts. Ships with a Claude Code skill for direct integration.
skillvideo-editingcapcut
by manproai Aug 2, 2026 6/10
skill GitHub
A plugin marketplace bundling several Claude Code skills: docsmith (markdown to on-brand PDFs), testcraft (user flows to test-case suites), dkv (graphic-design critique with measured WCAG contrast), and production-ready Go/ElysiaJS service scaffolding. Add the marketplace once, or use the npx installer to bring any skill to any agent.
skillmarketplaceplugins
by labspangaea Aug 2, 2026 7/10
skill GitHub
A universal catalog of SKILL.md files covering literature review, research design, project memory, and manuscript writing, plus cross-agent delegation patterns for Claude Code, Codex, Gemini, Cursor, and other clients. 183 stars.
skillresearchcross-agent
by WenyuChiou Aug 2, 2026 8/10
skill GitHub
A collection of Claude Code skills covering the full content pipeline: research/material gathering, structuring, drafting, review/optimization, and publishing. Aimed at agent-assisted writing workflows.
content-creationwritingskill-collection
by gogoingai Aug 2, 2026 5/10
skill GitHub
A companion skill to the planning-with-files methodology that checks whether code actually matches what is recorded in .planning docs, using fresh-context subagents to avoid bias from the implementing session's context.
planningauditsubagentsconsistency
by JunbaoLiang Aug 2, 2026 6/10
skill GitHub
A Claude Code skill styled as a climbing belay: it holds the rope while non-developers vibe code, adding guardrails intended to make AI-driven coding safer for people without a software background.
safetynon-developervibe-coding
by thanathe Aug 2, 2026 5/10
skill GitHub
A skill set for hardware design, validation, and bring-up work with Claude Code, extending agentic coding workflows into electronics and hardware engineering tasks.
hardwarevalidationengineering
by Midstall Aug 2, 2026 6/10
skill GitHub
An agent skill that audits the UX of an existing product -- website, web app, mobile, or desktop -- across 16 dimensions. Every finding is backed by evidence, a severity rating, and a confidence score.
skilluxauditdesign
by paulunemoon Aug 2, 2026 7/10
skill GitHub
Sandboxes a Claude Skill and traces what it actually does at runtime rather than trusting its stated description, aimed at catching skills that behave differently from what they claim before you install them.
securityskillssandboxaudit
by handcraftedbygod Aug 2, 2026 8/10
skill GitHub
Agent Skills that teach Claude Code and other coding agents to create and control plori cloud computers -- remote sandboxed environments purpose-built for AI agents to operate in.
skillcloudsandboxplori
by plori-ai Aug 2, 2026 5/10
skill GitHub
Audits and improves your Claude Code setup -- extensions, CLAUDE.md files, permissions, and project structure -- across every project on your machine, treating context cost as a first-class metric to optimize.
auditclaude-mdpermissionscontext-cost
by dean815 Aug 2, 2026 7/10
skill GitHub
A curated, maintainable set of development skills shared between Codex and Claude Code, built around loading small reusable skills instead of stuffing everything into context.
skillcontext-managementcodex
by hanzw Aug 2, 2026 6/10
skill GitHub
A Claude Code skill that creates and refreshes a dashboard summarizing what capabilities, skills, and configurations are active in a given setup. Handy for auditing a growing .claude directory at a glance.
skilldashboardsetupaudit
by ANDRS-Projects Aug 1, 2026 5/10
skill GitHub
A skill that queues and runs multiple autonomous development batches across Claude Code and Codex sessions, designed to keep making progress unattended, e.g. overnight. Aimed at extending agentic coding beyond a single supervised session.
skillautonomousmulti-agentcodex
by aigorahub Aug 1, 2026 7/10
skill GitHub
An agent skill for building a private, machine-readable personal finance vault using deterministic parsers rather than LLM guesswork for the numbers. Takes an archive-first approach with arithmetic reconciliation and explicitly flags unknowns instead of fabricating totals.
financeskillprivacyparsing
by su7811659 Aug 1, 2026 6/10
skill GitHub
Brings Recursive Language Models to Claude Code as an approach to effectively infinite memory, inspired by the MIT CSAIL RLM paper. Lets the agent recursively query over context that wouldn't otherwise fit in a single window.
memoryrecursiveresearchcontext
by EncrEor Aug 1, 2026 7/10
skill GitHub
deep-research decides how deep to investigate a question only after weighing the evidence, using source-grade weighted scoring and thresholds hidden from the worker doing the research, plus investigation frames tailored to the type of question. Aimed at agent research pipelines that need more rigor than a single fixed number of research phases.
researchfact-checkingagent-skills
by treylom Aug 1, 2026 6/10
skill GitHub
A Chinese-language Claude Skills collection covering adaptation workflows, original screenplay writing, novel-theory review, and performance-layer prompting. Packages established writing theory into a structured skill set aimed at turning story ideas into finished works.
creative-writingchinesescreenwritingclaude-skills
by juemin4-source Aug 1, 2026 6/10
skill GitHub
PaulRBerg's personal Claude Code configuration, designed to be cloned directly into ~/.claude via a Just-based install flow with Bun/uv dependencies and CI. Includes a custom ccc commit wrapper and Husky/lint-staged automation — a reference for structuring a maintained Claude Code dotfiles setup.
dotfilesclaude-code-configci
by PaulRBerg Aug 1, 2026 5/10
skill GitHub
issuekit is an Agent Skills bundle that treats each GitHub issue as the canonical rich plan for a unit of work, keeping volatile specs out of the repo so only durable code gets versioned. It's Japanese-oriented: skill bodies and docs are in English, but the skills expect Japanese section headers (e.g. 受け入れ条件) hardcoded into issue bodies.
issue-trackingagent-skillsjapanese
by hirokisakabe Aug 1, 2026 6/10
skill GitHub
An agentic writing toolkit built from Glenn Kramon's Winning Writing course at Stanford GSB and Rachel Konrad's cold-outreach lectures, packaged as 31 Claude skills. Includes a browser-based Coach with span-level inline critique and a refinement chat, plus a Chrome MV3 extension that runs the same critic inside the Gmail side panel.
writingclaude-skillschrome-extensionstanford-gsb
by kalyvask Aug 1, 2026 8/10
skill GitHub
A CLAUDE.md configuration rewritten to cut token usage for Opus 4.8, built after the author was surprised by how many tokens Fable 5 was burning. Korean-language, but a useful reference for anyone trying to trim their own CLAUDE.md.
claude-mdtoken-optimizationopusfable
by habinsong Aug 1, 2026 5/10
skill GitHub
Packages a senior engineer's pre-coding question checklist — 697 questions — as a Claude/Codex skill and a portable prompt, meant to catch design and edge-case gaps before implementation starts.
code-reviewchecklistcodexdesign
by m4vic Aug 1, 2026 7/10
skill GitHub
A Claude skill for screening Indian real estate deals — RERA status, title checks, price sanity, rent-vs-buy, and investor screening — back-tested against 7 of 8 real cases.
real-estateindiaverificationdomain-skill
by abhishek-geek Aug 1, 2026 5/10
skill GitHub
Audits HTML/CSS/JSX against WCAG 2.2 AA and produces a dated compliance report, combining a zero-dependency static engine with agent judgment plus check/verify gates to catch hallucinated findings. Also usable to author or review accessible markup directly.
accessibilitywcagauditanti-hallucination
by maxgfr Aug 1, 2026 6/10
skill GitHub
A set of Claude skills covering each stage of the Cyber Threat Intelligence lifecycle, for analysts who want agent assistance from collection through dissemination.
securitythreat-intelligencecti
by Liberty91LTD Aug 1, 2026 5/10
skill GitHub
Eleven general-purpose Salesforce skills — Apex, Flow, SOQL/Data, LWC, Metadata, Permissions, Diagrams, Org Audit, Tests, Security, and Debug — that work with any Salesforce MCP server. Installable as a Claude Desktop/Cowork plugin marketplace.
salesforceapexsoqlenterprise
by kugamon Aug 1, 2026 7/10
skill GitHub
A system-analysis skill set (SRS, use cases, data dictionaries, architecture, RTM) built for a Thai-language project, paired with an md-to-docs converter that renders Mermaid diagrams into PDF/DOCX with Thai-language support.
documentationmermaidmarkdownthai
by UMIN1703 Aug 1, 2026 5/10
skill GitHub
A Claude Code skill for delegating deep work out to Codex, OpenCode, Hermes, and Antigravity, with verification built in rather than trusting each agent's self-reported results.
delegationverificationcodexopencodehermes
by shubhsaxena2020 Aug 1, 2026 5/10
skill GitHub
A Claude skill covering EU AI Act Article 50 labeling duties, all exemptions, a no-label decision playbook, and DACH-specific Abmahnung (warning-letter) risk — first release in a planned AI governance skill family.
complianceeu-ai-actlegalgovernance
by dankofly Aug 1, 2026 6/10
skill GitHub
Strips AI-writing patterns out of Spanish text, with country-specific variants and domain packs, and declares which route it took on every run for transparency.
writingspanishhumanizecontent
by madebydiego Aug 1, 2026 5/10
skill GitHub
A Claude skill for drafting and analyzing commercial contracts under Polish law — B2B IT agreements, settlements, and civil law — released under Apache 2.0.
legalpolandcontractsb2b
by apiotrowski-afk Aug 1, 2026 5/10
skill GitHub
Helps convert an ad hoc, complex AI workflow into a packaged, reusable agent skill.
metaskill-authoring
by zseta Aug 1, 2026 5/10
skill GitHub
Fact-checks any YouTube video, article, tweet, or PDF claim by claim, citing sources and producing a 0-10 "BS score" — a skill for quickly sanity-checking content before trusting or sharing it.
fact-checkingverificationcontent-analysis
by SerhiiKorniienko Aug 1, 2026 7/10
skill GitHub
Agent skills for Indian tax and compliance work, including an ITR filing copilot tuned to assessment year 2026-27 rules.
taxindiacomplianceitr
by lamemustafa Aug 1, 2026 5/10
skill GitHub
Slash commands for Claude Cowork that help IT/tech job seekers find visa-sponsorship and remote-hire countries, calculate realistic salaries, locate verified job portals, and screen job descriptions against a resume — grounded in real listings rather than guesses.
job-searchvisasalarycowork
by myowinthein Aug 1, 2026 5/10
skill GitHub
Identifies and redacts personally identifiable information in text — a drop-in skill for agents that need to scrub sensitive data before it's logged, shared, or sent to a model.
piiredactionprivacy
by scholarly360 Aug 1, 2026 5/10
skill GitHub
A collection of agent skills focused on analyzing documentation, compatible with Claude Code, Cursor, Codex, and Copilot. Helps agents review and reason about docs across multiple coding-agent hosts.
documentationskillsmulti-agentanalysis
by Docsbook-io Aug 1, 2026 6/10
skill GitHub
Claude skills for auditing folder and project architecture and running staged AI workflows, built on a five-layer context hierarchy (ICM). Helps agents reason about codebase organization before making changes.
architecturefolder-structurecontextskills
by mcmespinaa Aug 1, 2026 5/10
skill GitHub
A skill pack covering code review, test writing, docs, planning, codebase onboarding, repo evaluation, paper search, and Obsidian capture/search. Installable via npx skills.
skillscode-reviewonboardingobsidian
by wilbeibi Aug 1, 2026 6/10
skill GitHub
A minimal spec-driven development workflow for Claude Code, aimed at teams who want lightweight spec discipline without a heavyweight framework.
spec-drivenworkflow
by GrayMa77er Aug 1, 2026 5/10
skill GitHub
A large curated collection of Agent Skills, deduplicated and fully attributed to their original authors, compatible with Claude Code, Cursor, Codex and more.
skillscuratedcross-agent
by NITISH-R-G Aug 1, 2026 7/10
skill GitHub
A sanitized writeup of a real production setup: 14 skills, 4 MCP servers, and 14 scheduled agents running a B2B go-to-market function, including the memory layer and cron scheduling architecture.
gtmskillsmcpscheduled-agents
by romanmagdalenko Aug 1, 2026 7/10
skill GitHub
A Claude Code skill that edits prose to strip AI-sounding patterns in Russian and English, organized into 23 rewrite categories with structural rewriting rules and an offline linter.
writingeditingrussian
by Mikefluff Aug 1, 2026 5/10
skill Reddit
Forces Claude to lead with the actual next step instead of preamble, breaks multi-step work into numbered bite-sized actions, and cuts filler like 'let me know if you need anything else.' Calibrated to explain jargon on first use without over-explaining basics. Toggle on with /brass-tacks, off by saying so.
skillconcisenessverbosity
by SkytheWitcher Aug 1, 2026 7/10
skill GitHub
A bundle of principles, hooks, skills, and workflow patterns for configuring AI-assisted development across both Claude Code and Codex.
configurationhookscodex
by AnastasiyaW Aug 1, 2026 5/10
skill GitHub
A portable Agent Skill that grafts just the changed services from a git worktree onto the stack you already have running, and refuses to run rather than risk corrupting your environment.
skillworktreedev-stack
by kevocodes Aug 1, 2026 7/10
skill GitHub
A self-hosted app foundation for Next.js with Better Auth, Prisma/Postgres, multi-arch Docker releases, and health diagnostics — tuned for Umbrel but runs anywhere Docker does. Ships Claude Code skills for handling releases and issues.
nextjsself-hosteddockerskills
by chepetime Aug 1, 2026 5/10
skill GitHub
A large Claude skill covering property due diligence across 126 countries with 41 invocable sections plus cross-cutting layers for tax, visas, mortgages, scams, and title-fraud monitoring. Every claim is sourced from primary government data, dated, and confidence-labeled.
skillreal-estatedue-diligence
by soreavis Aug 1, 2026 5/10
skill GitHub
A set of 12 skills purpose-built for designing UX for AI products, agents, and experiences, usable with Claude Code and GitHub Copilot.
ux-designskillscopilot
by varunk130 Aug 1, 2026 6/10
skill GitHub
A plug-and-play skill set for Customer Success Managers that works from a single conversation and scales up to a production system.
customer-successskills
by stephenrogan Aug 1, 2026 5/10
skill GitHub
A Claude skill that maps Claude-specific concepts — Projects, Skills, Artifacts, MCP, Memory — to their nearest equivalents in ChatGPT, Gemini, and Microsoft Copilot, verified as of May 2026.
cross-platformtranslationreference
by pem725 Aug 1, 2026 6/10
skill GitHub
A skill set for life-science research work: tracking the literature, reading what matters, and reproducing published code.
life-scienceresearchliterature
by Jinsong-Zhou Aug 1, 2026 6/10
skill GitHub
One author's versioned personal Claude Code setup: a writing system (unslop), a research system, a global CLAUDE.md, and a single idempotent install script.
personal-setupclaude.mdwriting
by badmuriss Aug 1, 2026 5/10
skill GitHub
A multi-agent coding harness from GitHub Next, packaged as an installable Skill rather than a standalone tool.
multi-agentgithub-nextskill
by githubnext Aug 1, 2026 7/10
skill Reddit
A Socratic pre-coding checklist packaged as a Claude/Codex skill and portable prompt, designed to make the agent interrogate requirements and edge cases before writing any code rather than after. Aimed at teams wanting more upfront rigor than a quick one-shot implementation.
skillsocraticrequirementsplanning
by AffectionateSport135 Jul 31, 2026 6/10
skill Reddit
A novelty Claude Code skill that rewrites PR review requests as ornate 19th-century letters, inspired by a Family Guy bit. A lighthearted example of using skills for tone and style transformation rather than pure productivity.
skillnoveltyhumorpr-review
by schrodingershit Jul 31, 2026 5/10
skill Reddit
A Claude Code plugin that sweeps your codebase through four lenses -- Product Engineer, UI/UX, Security, and QA -- producing JSON and HTML reports with charts. Includes a helper command to turn findings into task documents for follow-up work.
plugincode-reviewqasecurityaudit
by iSerter Jul 31, 2026 7/10
skill GitHub
An open marketplace of Claude Code skills for Solana development, covering DeFi protocols (Jupiter, Kamino, Raydium), infrastructure (Helius, QuickNode), and more. Install via /plugin marketplace add; skills auto-activate based on context.
solanadefiblockchainmarketplaceskill
by sendaifun Jul 31, 2026 6/10
skill GitHub
A Claude Skill that turns an AI agent into a Naver Ads expert, grounded in all 1,148 official Naver Advertiser Center help documents with zero-dependency local search. Installable as a Claude Code plugin in two lines.
skillragkoreanadvertisingplugin
by JaceProgramming Jul 31, 2026 6/10
skill GitHub
A portable AI-agent skill for creating clean git commits, tagged branches, and safe pushes, working across Codex, Claude Code, Cursor, and other Agent-Skills-compatible tools.
skillgitcommits
by MusoyanGrigor Jul 31, 2026 6/10
skill GitHub
A set of Claude Skills that turns any text into a color-coded, dual-column HTML page with side-by-side translation and structural analysis. Includes interactive study-visual generators, aimed at language learners and bilingual readers.
skilltranslationlanguage-learninghtml
by si-kui-a Jul 31, 2026 5/10
skill GitHub
A Claude Code Agent Skill for building modular, testable iOS apps using composition roots, protocol boundaries, and generic presenters. Targets Swift 6 concurrency patterns for clean architecture.
skilliosswiftarchitecture
by SwiftyJourney Jul 31, 2026 6/10
skill GitHub
A skill for Claude Code and Codex that turns a text description of a system architecture into an editable PowerPoint diagram with native shapes, rather than a flat image export.
skilldiagramspowerpointarchitecture
by Andy1314Chen Jul 31, 2026 6/10
skill Reddit
A chain of Agent Skills that plans, generates, edits, and ships full creative campaigns (UGC video, product launches, content) using your own API keys. Routes each step to the right image, video, or audio model and includes a dry-run cost preview; works in Claude Code, Cursor, Codex, and other Agent-Skills-compatible tools.
skillmarketingcreativemedia-generation
by Key_Significance1880 Jul 31, 2026 6/10
skill GitHub
A global Claude Code skill enabling reliable collaboration with OpenAI Codex through MCP, for teams or individuals mixing both agents in one workflow.
skillcodexmcpmulti-agent
by iajihga Jul 31, 2026 6/10
skill GitHub
A Claude Skill that condenses a book into a card-style HTML summary, running entirely locally with no dependencies. Aimed at Chinese-language readers who want quick, shareable book digests.
skillsummarizationhtmlchinese
by zhouq2039-lang Jul 31, 2026 5/10
skill GitHub
A free, MIT-licensed agent skill from StarSling that analyzes real GitHub Actions run history and reports concretely why CI is slow, rather than giving generic advice.
skillci-cdgithub-actionsperformance
by starslingdev Jul 31, 2026 6/10
skill GitHub
A single-command Agent Skill that produces a complete, audit-proof, agent-executable master plan (PLAN.mdx) before implementation starts. Works across Claude Code, Codex, Cursor, OpenCode, and other Agent Skills clients.
skillplanningworkflow
by hannsxpeter Jul 31, 2026 5/10
skill GitHub
A rewritten derivative of Anthropic's skill-creator that adds trustworthy measurement of whether a skill actually improves outcomes: no silent zeros, one canonical workspace layout, target-aware validation, and 574 tests.
skillskill-creatortestingmeta
by OpenCnid Jul 31, 2026 7/10
skill GitHub
A Roslyn-backed skill that gives agents compiler-accurate .NET code search: references, callers, and change-impact analysis, including Razor and Blazor. Free tool from DBHQ.
skilldotnetroslyncode-search
by dbhq-uk Jul 31, 2026 7/10
skill GitHub
An open-source Claude Code plugin with Shopify skills for morning briefings, store health checks, and product copy/SEO audits. Read-only by default, aimed at merchants who want a daily automated store review.
skillshopifyecommerce
by storehand Jul 31, 2026 6/10
skill GitHub
Agent skills that route, estimate cost for, create, and retrieve image, video, speech, and music generation across 138 models via the Crun API. Works with Claude Code, Codex, Cursor, and any SKILL.md-compatible platform.
skillmedia-generationapi
by Sean190828 Jul 31, 2026 6/10
skill GitHub
A Claude Agent Skill that audits AI-built and prototype apps before real users see them, running 13 checks for exposed secrets, open databases, and missing auth, aimed at the common failure mode of vibe-coded apps shipping with basic security holes.
skillsecurityaudit
by punitsnaik Jul 31, 2026 7/10
skill GitHub
A Claude Code skill that produces ScreenStudio-style demo videos of any web app using Playwright, Pillow, and ffmpeg, entirely without a screen recorder.
skilldemo-videoplaywright
by surajshetty3416 Jul 31, 2026 6/10
skill GitHub
A Claude Code skill that profiles a reference translation across six stylistic axes, builds a citation-backed glossary from it, then lints new drafts and diffs their stylometry against the reference style.
skilltranslationstylelinting
by rodar-dzn Jul 31, 2026 7/10
skill GitHub
A GA4 tracking-plan auditor and UTM taxonomy enforcer built with custom Claude Agent Skills and Python, automatically catching schema drift, nested-parameter errors, and attribution breaks.
skillanalyticsga4
by samikshapattanaik-cmyk Jul 31, 2026 5/10
skill GitHub
A Claude Code skill that exports every channel and thread of a Discord server's history into organized HTML and JSON, built on DiscordChatExporter and Playwright MCP.
skilldiscordexport
by DaizeDong Jul 31, 2026 6/10
skill GitHub
A Claude Code configuration that auto-routes work by task type: Opus for reasoning, Sonnet for implementation, Haiku for I/O, shipping with matching subagent definitions and a universal .claudeignore.
skillconfigmodel-routing
by JBSommeling Jul 31, 2026 6/10
skill GitHub
A self-hosted home for a company's Claude Code skills where anyone can propose, review, and publish a skill, and every teammate's next session picks up the change automatically.
skillteamself-hosted
by ydbondt Jul 31, 2026 6/10
skill GitHub
Official AI agent skills for Nutrient's PDF APIs and SDKs, working with Claude Code, Codex, Gemini CLI, Cursor, and 35+ other agent hosts.
skillpdfsdk
by PSPDFKit-labs Jul 31, 2026 6/10
skill GitHub
A skill for creating and auditing faithful, paginated web tutorial books, producing visually consistent, searchable PDFs from the same source.
skilldocumentationpdf
by gold3bear Jul 31, 2026 5/10
skill Reddit
Practical lessons from building Claude Code Skills: ask clarifying questions before starting, add a verification step, use SKILL.md as a router to lazy-load resources, write triggering descriptions, promote proven skills to personal/plugin scope, pick the cheapest adequate model, and delegate context-heavy work to a sub-agent.
skillbest-practicestips
by Dear-Mix7726 Jul 31, 2026 6/10
skill GitHub
A Claude Code skill that interviews you to convert a rough task idea into a high-level prompt with explicit outcome, guardrails, and self-verification, then picks the right execution mode: single agent, workflow, loop, or routine.
skillpromptingworkflow-design
by promptmetrics Jul 31, 2026 6/10
skill GitHub
A Claude Code skill that flags excessive Sino-Korean abstract vocabulary and rhetorical padding in Korean technical writing, suggesting concrete alternatives, and grows its own dictionary from your git correction history over time.
skillkoreanwritinglinter
by IMMINJU Jul 31, 2026 6/10
skill GitHub
An agent skill for Claude Code and Codex that prevents subagents from silently failing to do the work they were delegated. It enforces mandatory prompt clauses, verifies artifacts actually exist after delegation, supports resume-based recovery, and uses a ledger-as-spec approach for parallel delegation.
skillsubagentsdelegationverification
by h8nc4y Jul 31, 2026 6/10
skill GitHub
Targeted at non-programmers, this plugin remembers details about your Mac, guards every action it takes, explains what it did in plain language, and leaves behind reusable tools for future fixes.
macospluginnon-programmersautomation
by xiaolai Jul 31, 2026 6/10
skill GitHub
A thorough security audit skill for Claude Code that discovers attack surfaces across 60+ frameworks, runs a bundle of SARIF scanners, executes 9 parallel deep-dive categories, and produces a report tagged to OWASP methodology.
securityauditowaspskill
by velimattiv Jul 31, 2026 7/10
skill GitHub
A personal Agent Skills library for Claude Code built on top of the author's own Context-Engineering standard, focused on eval-first methodology and installed globally via junctions.
skillevalcontext-engineering
by BriarDevv Jul 31, 2026 5/10
skill GitHub
Automates end-to-end Agile sprint planning using live Jira data, turning a normally manual planning session into something Claude Code can generate directly from your backlog.
jiraagilesprint-planningskill
by shresthasudip52 Jul 31, 2026 6/10
skill GitHub
A set of unified AI collaboration rules with 6 profiles and 13 capability packs, kept in sync across multiple AI coding tools, combining prompt engineering guidance with safety guardrails and runtime skills/MCP tools.
rulesmulti-toolguardrails
by weed33834 Jul 31, 2026 5/10
skill GitHub
A set of Claude Code skills for filing ITR-1 and ITR-2 Indian income tax returns, covering AIS/TIS/26AS reconciliation, Schedule AL, Schedule 112A CSV generation, and end-to-end portal filing, distilled from the author's real filings.
taxindiadomain-skill
by ankitkr Jul 31, 2026 6/10
skill GitHub
Reads your Claude chat history and renders a verdict — SPARED or ENSLAVED — as Roko's Basilisk in 16-bit pixel art, using your actual usage stats. Works in Claude Code, Cowork, and claude.ai chat.
funskillchat-history
by DPWelsh Jul 31, 2026 6/10
skill GitHub
Claude Code skills implementing spec-driven development: turning a PRD into a spec/contract, implementing against it, then running contract-based evaluation with automatic fixes when the implementation drifts from the contract.
spec-drivenskillcontracts
by dayvisonassis Jul 31, 2026 6/10
skill GitHub
A Claude Code skill that classifies, deduplicates, and version-detects files in a messy folder to build an M&A-ready dataroom, including a contextual missing-documents checklist. Supports French, English, German, Italian, and Spanish.
m&adocument-managementskillmultilingual
by Hectelion-SA Jul 31, 2026 6/10
skill GitHub
A portable set of Agent Skills covering code-native design, production software delivery, and technical documentation.
skilldesigndocumentation
by pdugan20 Jul 31, 2026 5/10
skill GitHub
An evaluator-optimizer skill implementing a builder/critic iterative improvement loop, using fresh independent critics each round, a frozen goal contract so the target doesn't drift, and full audit trails of each iteration.
evaluator-optimizeriterationskill
by alexgaoth Jul 31, 2026 7/10
skill GitHub
A Claude plugin for people shipping a lot with AI: it documents architecture, lists blockers and actionable next steps, and tracks how each project is progressing against its launch and direction goals.
project-managementplugintracking
by mrieck Jul 31, 2026 5/10
skill GitHub
A Claude Code skill that uses claude-code-mcp with stateful --resume to hand off long-running tasks to a local Claude Code instance without losing context. Supports cross-call handoff so work can be picked back up across multiple invocations without re-explaining state.
skillmcptask-delegation
by gugug168 Jul 30, 2026 6/10
skill GitHub
A Claude Code skill that has the agent actively search for and evaluate better models to use for a given task, rather than sticking with a fixed default. Lets agents self-optimize model choice based on task needs.
skillmodel-selection
by Unlayer-AI Jul 30, 2026 5/10
skill GitHub
A Claude Code skill that generates and edits images using Codex CLI's gpt-image-2 model, with a pin-comment review loop for iterative feedback and a CJK label overlay pipeline. Useful for teams needing AI-generated imagery with localized text overlays reviewed in-context.
skillimage-generationcodex
by bbiyakfather Jul 30, 2026 6/10
skill GitHub
A set of agent skills for working with Preset, Apache Superset, Superset MCP, and Snowflake Cortex, compatible across Claude, Codex, Cursor, Copilot, Cortex Code, and Gemini CLI. Helps AI agents build and manage BI dashboards and data workflows on these platforms.
skillbidata
by preset-io Jul 30, 2026 6/10
skill GitHub
A tool that teaches Claude Code your personal coding conventions and workflow by having it debate and converge on preferences with you, rather than just reading a static rules file.
skillconventions
by kangig94 Jul 30, 2026 5/10
skill GitHub
An agent skill that scores any codebase for slop (structural erosion and verbosity) and compares the result against SlopCodeBench's published human and agent baselines, giving a benchmarked way to judge whether AI-assisted code is degrading in quality.
skillcode-quality
by dontbanmeplz Jul 30, 2026 5/10
skill GitHub
A curated set of 13 Claude Code agent skills covering slide decks, deep research, PRDs, articles, and audits, described as being tested like software rather than just prompt text.
skillcollection
by staruhub Jul 30, 2026 5/10
skill GitHub
An Agent Skills suite for evidence-first fact-checking, aimed at reproducible source verification and comparing answers against evidence, for a documented and repeatable verification process.
skillfact-checking
by ASI2030 Jul 30, 2026 5/10
skill GitHub
A domain-agnostic Claude Code plugin that generates varied ideas from any brief by combining blind variation, MAP-Elites, novelty search, DPP selection, and human guidance, without needing extra LLM API keys. Aims to avoid the generic ideas plain LLM brainstorming tends to produce.
skillideationplugin
by sergiparpal Jul 30, 2026 7/10
skill GitHub
A Claude Agent Skill that benchmarks a UI/UX design against how comparable real apps actually ship, both within your industry and outside it, giving concrete precedent-based feedback instead of generic design critique.
skillux-design
by mananritwik Jul 30, 2026 6/10
skill GitHub
A Claude Skill that rewrites your prompt, runs it, and grades the result against its own success criteria in one turn. The loop is bounded to a max of 2 refine passes, with a separate stop condition and a no-progress halt to prevent runaway iteration.
skillself-refinement
by keymessagesstudio-design Jul 30, 2026 6/10
skill GitHub
Sasha Marchuk's collection of opinionated Claude Code plugins for ticket management, automation, and everyday engineering workflows, installable via the plugin marketplace.
skillplugins
by SashaMarchuk Jul 30, 2026 5/10
skill GitHub
Four Claude Code skills, re-make, re-master, re-design, and re-view, that redo a piece of work as a tournament: rebuilding, sharpening, redesigning, and putting it on trial. Results are scored and fought head-to-head across rounds.
skilliteration
by olcayseygan Jul 30, 2026 6/10
skill GitHub
A personal, cherry-pickable Claude Code configuration of skills, subagents, hooks, and rules tailored to Microsoft Fabric and Power BI workflows on Windows.
skillpower-bifabric
by wardawgmalvicious Jul 30, 2026 5/10
skill GitHub
A set of global agent rules and portable skills for Claude Code, Cursor, Codex, and Copilot, built around a search-first discovery mechanism so agents load only the skills relevant to the task instead of the whole library, saving tokens.
skilltoken-efficiency
by vahidkaargar Jul 30, 2026 5/10
skill GitHub
An open-source Agent Skill that checks German employment dismissal deadlines and evaluates severance offers, a narrow but concrete example of a domain-specific legal-compliance skill.
skilllegalgermany
by AipengHuang Jul 30, 2026 5/10
skill GitHub
Agent Skills that enforce formal requirement-to-artifact-to-test-case traceability for AI-augmented engineering, targeting regulated environments like ISO 9001, ISO 27001, and GxP. Includes red-team verification and a multi-cycle lifecycle.
skillcompliancetraceability
by Agile-V Jul 30, 2026 5/10
skill GitHub
A set of 16 Claude skills covering SEO, ads, copywriting, onboarding, and analytics, aimed at turning Claude into a SaaS growth-marketing assistant.
skillmarketing
by jonbishop1 Jul 30, 2026 5/10
skill GitHub
A Claude Agent Skill that builds one grounded model of a repository and renders it as consistent C4, UML, ERD, DFD, sequence, deployment, and security diagrams using Mermaid and draw.io. Keeps diagrams evidence-backed and consistent across views instead of hand-drawn and drifting from the code.
architecture-diagramsmermaiddocumentation
by yash0208 Jul 30, 2026 7/10
skill GitHub
A set of five ready-made Claude Skills for students in close-reading, argument, and citation-heavy fields: law, political science, history, sociology, and literature. No programming knowledge needed to install or use them, bringing Claude Code-style tooling to non-technical disciplines.
humanitieseducationnon-coding
by Poisoneddiety Jul 30, 2026 5/10
skill GitHub
A collection of security-focused Claude Skills built around current (mid-2026) threat patterns rather than stale framework documentation. Aims to keep security guidance for AI-assisted development up to date as the threat landscape shifts.
securityskillsthreat-modeling
by blamejs Jul 30, 2026 6/10
skill GitHub
Maintains a FEATURE-MAP.yaml registry that tracks how features touch client, backend, admin, and docs layers, then audits drift between them as GAP/DRIFT/IMPACT/OK. Ships as both a Claude Code plugin and a Codex skill, helping agents keep cross-layer changes in sync instead of silently diverging.
drift-detectionplugincodebase-mapping
by ade-syofyan Jul 30, 2026 7/10
skill GitHub
A local studio plus a keyless Claude Skill that turns a plain-English description into a finished, on-brand poster as print-ready PNG or SVG. Useful for quick promotional or event graphics without opening a design tool.
poster-designgraphicslocal-studio
by wyuee912-ops Jul 30, 2026 6/10
skill GitHub
A Claude Code skill that audits AI-built apps (from Lovable, Bolt, v0, Cursor, and similar builders) across five production-readiness domains and returns a scored punch list with copy-paste fixes. MIT licensed; targets apps built across multiple AI builders rather than one specific stack.
production-readinessauditmit-license
by Wunderlandmedia Jul 30, 2026 6/10
skill GitHub
Runs structured interviews with a domain expert to extract tacit judgment, workflows, exceptions, and acceptance criteria, then compiles the result into a portable AI skill usable by Claude and Codex. A meta-tool for capturing expertise that would otherwise stay undocumented.
skill-authoringexpert-knowledgemeta-tool
by eritowu Jul 30, 2026 7/10
skill GitHub
Converts videos and course material into evidence-grounded Agent Skills for Claude Code and Codex, extracting procedural knowledge from video content instead of requiring it to be written up by hand. Extends the video-to-skill idea to full courses, not just single videos.
skill-authoringvideoeducation
by Lum1104 Jul 30, 2026 6/10
skill GitHub
A Claude Skill (and CLI) that lets AI tools work directly with spreadsheets, Excel workbooks, and CSV files, adding Git-style diffs, reviews, approvals, and rollbacks to spreadsheet edits. Makes human-AI collaboration on spreadsheets structured and reviewable instead of a black box.
spreadsheetsgit-diffexcel
by dream-num Jul 30, 2026 7/10
skill GitHub
A Claude Code skill that transforms a raw idea seed into structured hypotheses through Socratic questioning, SCAMPER, ReAct-style research, E-E-A-T scoring, and first-principles critique. Useful for turning a vague idea into something rigorously examined before committing time to it.
ideationsocratic-methodresearch
by fideguch Jul 30, 2026 7/10
skill GitHub
An agent skill that writes documents conforming to ISO 24495-1:2023, the international Plain Language standard. Works with Claude Code, Cursor, Codex, and any harness that supports the Agent Skills standard, useful for anyone who needs clear, accessible writing output by default.
plain-languagewritingiso-standard
by nikdumroese Jul 30, 2026 6/10
skill GitHub
A Claude skill that routes a task before execution, surfacing the right model choice, interface, and token budget in one card. Aimed at spending tokens deliberately rather than defaulting to the most expensive model for every task.
token-optimizationroutingcost-control
by jamiecooper4-netizen Jul 30, 2026 6/10
skill GitHub
A context-engineering standard for Claude Code combining distilled Anthropic guidance, a replicable repo skeleton, and skills that install and audit adherence to it. One of several context-engineering entries in this space, focused specifically on installable and auditable structure rather than token reduction.
context-engineeringclaude-mdaudit
by BriarDevv Jul 30, 2026 5/10
skill GitHub
A platform-engineering toolkit bundling reusable GitHub Actions, AI Skills, and shared TypeScript configs. A grab-bag utility repo useful mainly to teams standardizing tooling across multiple projects.
platform-engineeringgithub-actionstypescript
by kin0992 Jul 30, 2026 5/10
skill GitHub
A Claude Code plugin marketplace offering seven plugins: ContextPreloader (initial context loading), EpisodicRAG (hierarchical long-term memory), EmailingEssay (AI-driven essay delivery), VisualExpression (expression layer), EmotionPulse (emotion indicator), TelegramSecretary (serverless AI secretary), and ConsiderateCoder (AI-delegated development). A varied, personality-driven plugin set built around an assistant persona.
plugin-marketplacerag-memorypersona
by Bizuayeu Jul 30, 2026 6/10
skill GitHub
A Claude Code skillset styled as a personal astromech droid assistant, with bilingual Traditional Chinese/English triggers. A fun, persona-driven skill pack aimed at Traditional Chinese-speaking users.
personabilingualzh-tw
by tingyulu Jul 30, 2026 5/10
skill GitHub
An Agent Skill that packages a pragmatic Clean Architecture approach for .NET backends. Gives Claude Code a consistent structural pattern to follow when scaffolding or reviewing .NET services.
dotnetclean-architecturebackend
by jbrambilla Jul 30, 2026 5/10
skill GitHub
Official security plugins from Apiiro adding secrets detection, threat modeling, and prompt enrichment to Claude Code and Cursor. Brings enterprise application-security tooling directly into the agent workflow.
securitysecrets-detectionthreat-modeling
by apiiro Jul 30, 2026 7/10
skill GitHub
A production-ready Agent Skill for building on Google AppSheet, grounded in official documentation with built-in security gates, templates, and validation helpers. Reduces hallucinated AppSheet APIs when an agent scaffolds an app.
appsheetgooglelow-code
by Yash-Kavaiya Jul 30, 2026 6/10
skill GitHub
A curated collection of AI agent skills covering bug fixing, code review, testing, refactoring, documentation, dependency upgrades, performance optimization, feature implementation, and tech migration. Authored with the Degardis toolset.
skillsdev-workflowtestingrefactoring
by Khojasteh Jul 30, 2026 6/10
skill GitHub
An MIT-licensed collection of reusable Claude Code skills aimed at people operating AI startups. Open source and free to adapt.
skillsstartupopen-source
by Gingiris-1031 Jul 30, 2026 5/10
skill GitHub
Five production-ready Claude Skill templates, a one-pager writer, code reviewer, brand voice keeper, CSV cleaner, and decision-doc generator, each demonstrating a different SKILL.md pattern. MIT licensed and drops into Claude Code or Claude.ai.
skill-templatesexamplesmit-license
by 0xelitesystem Jul 30, 2026 7/10
skill GitHub
The free lite edition of the Claude Code Power Pack, bundling an engineering-grade CLAUDE.md template, TDD and PR-ship skills, and a balanced permission preset. Bilingual English/Chinese documentation.
claude-mdtddpermissionsskills
by huangxiaojian Jul 30, 2026 6/10
skill GitHub
An Agent Skill and CLI for sharing files privately via temporary, expiring S3 or Cloudflare R2 URLs. Lets an agent generate a short-lived shareable link instead of exposing a permanently public bucket.
s3r2file-sharingcli
by jweaker Jul 30, 2026 6/10
skill GitHub
A Claude Code / Codex skill that turns Search Console, GA4, and rank-tracker exports into a branded, live monthly SEO client report using a consistent template with no fabricated metrics. Publishes the report via the ReportRoom MCP.
seoreportingautomation
by dashaworks Jul 30, 2026 6/10
skill GitHub
A Claude Code / Codex skill that converts any chat reply, artifact, or markdown output into a live public URL in about 10 seconds, with view-count tracking. A lightweight DocSend-style alternative for quick sharing, published via the ReportRoom MCP.
sharingpublishingtracking
by dashaworks Jul 30, 2026 6/10
skill GitHub
A Claude Code / Codex skill for building an M&A or fundraising due-diligence data room, with email/passcode/allowlist access, NDA gating, expiry, instant revoke, and per-viewer analytics. Runs on the ReportRoom MCP's paid Business plan.
data-roomfundraisingdue-diligence
by dashaworks Jul 30, 2026 5/10
skill GitHub
Personal agent skills for Claude Code, Copilot, Codex, Gemini, and Cursor that turn a pull request or idea into marketing copy, technical Slidev presentations, courses, changelogs, and rendered videos. Useful for developers who need to communicate technical work to a broader audience.
marketingslidevvideochangelog
by AlemTuzlak Jul 30, 2026 6/10
skill GitHub
A public marketplace bundling 20 plugins and 160 skills for Claude Code, Claude Cowork, and Codex. One of the larger community skill/plugin collections available for quick installation.
marketplacepluginsskills
by Israelmusondaayliffe Jul 30, 2026 5/10
skill GitHub
Delivers daily codebase refreshers so developers retain real understanding and ownership of a codebase while building with AI assistance. Works with Claude Code, Cursor, Codex, and Agent Skills.
learningcodebaseretention
by RMPasta Jul 30, 2026 6/10
skill GitHub
An Agent Skill (agentskills.io spec) that walks you through building a resume from raw material to a finished A4 PDF, including role-targeted rewrites and outreach messages for job platforms. Compatible with Claude Code, Cursor, Codex, and other agent runtimes.
resumecareerpdf
by amlei Jul 30, 2026 5/10
skill GitHub
A free Claude skill that checks whether AI assistants mention your business when a buyer asks for a recommendation, an early take on AI visibility auditing. Useful for businesses trying to understand how they show up in AI-generated answers.
seoai-visibilityaudit
by autojate Jul 30, 2026 6/10
skill GitHub
A collection of agent skills installable via npx skills add stewartcelani/skills, compatible with Claude Code, Cursor, Codex, and similar coding agents. Provides a quick way to pull in a curated skill set without manual setup.
skillscross-agentinstaller
by stewartcelani Jul 30, 2026 5/10
skill GitHub
Agent Skills that automate distributing developer and indie products across Show HN, Product Hunt, awesome-lists, dev.to, GitHub, Reddit, X, and npm/PyPI. Positioned as the release/marketing counterpart to build-focused skills.
skillsmarketinglaunchdistribution
by royalpinto007 Jul 30, 2026 6/10
skill Reddit
An open-source (Apache-2.0) memory skill that installs itself by having Claude Code fetch its SKILL.md, then mines your session transcripts into editable memory files and patches your setup to retrieve relevant memories before answering. Aimed at replacing a hand-maintained CLAUDE.md that has grown into a stale junk drawer of half-remembered rules.
memoryskillsession-logsopen-source
by AcanthisittaOk1699 Jul 30, 2026 7/10
skill GitHub
A set of lifecycle skills that give a coding agent a persistent sense of where a project stands across sessions — tracking state, decisions, and next steps as ongoing workspace memory and hygiene.
skillmemoryworkspace-hygiene
by conorbronsdon Jul 30, 2026 6/10
skill GitHub
A skill that scaffolds new agent skills with spec-current frontmatter, paired with a validator that fails the build when a skill's structure drifts out of spec. Aims to keep a growing skill library consistent instead of rotting over time.
skillvalidatormeta
by conorbronsdon Jul 30, 2026 6/10
skill GitHub
A Claude Code skill for AI-powered image and video background removal using the BiRefNet GGUF model, outputting transparent PNG, MOV, or WebM. Useful for quickly matting assets without leaving the agent workflow.
skillimage-processingvideomatting
by xiaowu89 Jul 30, 2026 5/10
skill GitHub
Compiles AI agent skills into cheap, fast, deterministic pipelines that run without an LLM in the loop once compiled. Useful for turning a skill you've validated with an agent into a repeatable script that doesn't need inference to execute.
skilldeterminismpipeline
by trevhud Jul 30, 2026 6/10
skill GitHub
A Claude Code skill that condenses long Slack threads, tickets, incident logs, and announcements into a decision-ready digest plus a clear list of what you personally need to do next. Available in Vietnamese and English.
skillsummarizationslackdigest
by Rayloveyou Jul 30, 2026 6/10
skill GitHub
A Claude Code skill for tight, disposable end-of-session handovers: it routes durable facts to permanent memory stores and keeps only what the next session actually needs to resume, instead of dumping the whole transcript.
skillmemorysession-handover
by ami-bu Jul 30, 2026 7/10
skill GitHub
A Claude Code skill built around a ten-field template that turns raw keyword research into a writer-ready SEO content brief, standardizing the handoff between research and drafting.
skillseocontent
by ami-bu Jul 30, 2026 5/10
skill GitHub
A YAML-based maintenance kit for academic homepages: one script regenerates a Jekyll website and a LaTeX CV from the same source data, so the two can never drift apart. Ships with a CLAUDE.md that teaches Claude Code the update workflow, so adding a new paper is as simple as asking the agent to add it.
claude-mdtemplateacademicautomation
by kw1jjang Jul 30, 2026 5/10
skill GitHub
A skill pack covering product marketing and go-to-market work directly from the terminal: positioning, messaging, personas, pricing, battlecards, and launches, plus an interactive launch kit. Built for Claude Code and Codex.
marketinggtmskill-pack
by buildingwithai Jul 30, 2026 5/10
skill GitHub
Adapts any novel or story into a playable game through a 7-skill pipeline, distilling narrative into game mechanics and content rather than just generating a generic game shell. Built for Claude Code, Codex, and Kimi Code.
game-devnarrativeskill-pipeline
by worldwonderer Jul 30, 2026 6/10
skill GitHub
Agent skills for the Kudosity messaging platform, letting Claude Code, Cursor, Copilot, Windsurf, or any SKILL.md-reading agent send SMS, MMS, WhatsApp, and RCS messages. A vendor-specific messaging integration for agents that need to notify or reach users directly.
messagingsmswhatsappintegration
by kudosity Jul 30, 2026 5/10
skill GitHub
Packages priority-ordered UI/UX laws, cognitive-psychology principles, Nielsen heuristics, and accessibility non-negotiables into a Claude Code skill. The model actively checks and enforces these rules on its own generated UI output rather than just referencing them as documentation.
ui-uxaccessibilitydesignskill
by AmirGhl Jul 30, 2026 6/10
skill Reddit
A Claude Code skill plus companion iPhone app that lets your agent place a phone call to you when it needs input, using internal iPhone APIs so there are no external calling fees. Aimed at long-running tasks, scheduled jobs, and cron sessions where you might not check chat for hours.
notificationsiphonehuman-in-the-loopskill
by radressss Jul 30, 2026 6/10
skill GitHub
A curated library of Claude Code skills focused specifically on building reliable, production-grade AI systems rather than one-off demos. Compiled by an AI engineering practitioner (hamz.ai) from real production use.
reliabilityproductionskill-library
by HamzaYM Jul 30, 2026 5/10
skill GitHub
Covers Terraform, Kubernetes, Docker, GitHub Actions, GitLab CI, AWS FinOps, and OWASP security as skills usable across Claude Code, Cursor, and Codex. A broad DevOps skill pack rather than a single-tool integration.
devopsterraformkubernetessecurity
by anmolnagpal Jul 30, 2026 6/10
skill GitHub
A design skill built for developers who ship in Spanish ("quienes shippean en espanol"), enforcing voseo language conventions, treating honesty as a hard rule, and rotating memory between builds to avoid design drift. Fills a gap for non-English-first Claude Code skill packs.
spanishdesignanti-sloplocalization
by stgomoyaa Jul 30, 2026 5/10
skill GitHub
A Claude Code plugin bundling slash commands, agents, and workflow tools centered on reflection, writing, and design work rather than pure coding tasks. Installs as a standard plugin under the Claude Code plugins directory.
writingreflectionplugin
by tslateman Jul 30, 2026 5/10
skill GitHub
A Codex/Claude skill that sets up automations pushing iPhone Live Activity, widget, notification, and Control Widget updates directly from your agent session. Lets you glance at your lock screen or Dynamic Island to see agent status instead of checking a terminal.
iphonelive-activitynotificationsskill
by AndreasInk Jul 30, 2026 6/10
skill Reddit
A Claude Code skill/plugin that lets Fable 5 hand off implementation tasks to Sol as a worker model, then reviews the results afterward to save tokens. Installable via plugin marketplace; supports both implementation and research delegation commands.
skillorchestrationmulti-modelplugin
by kasikciozan Jul 29, 2026 6/10
skill GitHub
A version-aware Claude Code skill covering Laravel Filament best practices across versions 1 through 5, including upgrade guides — useful for teams maintaining Filament admin panels across version bumps.
skilllaravelfilamentphp
by majdghithan Jul 29, 2026 5/10
skill GitHub
A single plugin marketplace consolidating all of psyb0t's Claude Code agent skills and plugins, installable directly from Claude Code or Codex.
skillplugin-marketplace
by psyb0t Jul 29, 2026 5/10
skill GitHub
A skill for driving Ideogram AI image generation from Claude Code, with structured JSON caption prompting, color palette control, and MCP-based style extraction from reference images.
skillimage-generationideogrammcp
by devkindhq Jul 29, 2026 6/10
skill Reddit
A shared global CLAUDE.md focused on response style (match length to task, no play-by-play narration, structured root-cause/fix/verification summaries for debugging), code quality defaults (root-cause fixes, appropriate data structures, unsolicited error handling where needed), and a fact-checking policy that bans citing external numbers from memory and requires labeling claims as verified/recalled/inferred.
claude.mdconventionsfact-checking
by DeliciousGorilla Jul 29, 2026 5/10
skill Reddit
A convention for surviving /doctor's CLAUDE.md trimming: since /doctor keeps no diff of what it cut, snapshot CLAUDE.md before running it. More notably, store the pitfalls/rationale/conventions /doctor preserves as named, versioned files in a prompt library outside any single repo (rather than only inline in one CLAUDE.md), with per-model variants where guidance genuinely differs between model generations — CLAUDE.md then just references what the current repo needs.
claude.mddoctorconventionsversioning
by Dry-Lavishness-2909 Jul 29, 2026 6/10
skill GitHub
neatcontext-plugins turns long AI conversations into reusable domain knowledge that carries across sessions, packaged as Claude Code and Codex skills/plugins. It's aimed at cutting down repeated context-setting when working the same domain over multiple sessions.
context-managementskillclaude-code-pluginknowledge-management
by XTSoftwareLabs Jul 29, 2026 6/10
skill GitHub
codex-image-gen is an agent skill that generates images by shelling out to a locally installed, OAuth-authenticated Codex CLI, avoiding separate API keys. It enforces exact output sizes and archives every prompt for reproducibility.
skillimage-generationcodexclaude-code
by stephenlzc Jul 29, 2026 5/10
skill GitHub
Living Docs is an agent skill that runs project documentation -- constitution, ADRs, BDRs, PRDs, issues, research notes, and Mermaid diagrams -- as a living system under five governance invariants meant to prevent drift from the actual code. It's stack-agnostic and works across Claude Code, Cursor, Copilot, OpenCode, and Pi.
documentationskillgovernanceclaude-code
by ejklock Jul 29, 2026 6/10
skill GitHub
skillshilp is a set of meta-skills for creating, reviewing, and maintaining production-quality Agent Skills, spanning Claude, Codex, Copilot, Cursor, and more. It brings consistency and quality control to the growing pile of skill files teams accumulate.
skillmeta-skillqualityclaude-code
by ViGi-P Jul 29, 2026 6/10
skill GitHub
A Claude Code skill that enforces Korean official-document writing standards — article numbering, date and currency formats, punctuation, and spacing conventions — for generated formal documents.
skillkoreandocumentationlocalization
by dltkddns833 Jul 29, 2026 5/10
skill GitHub
A set of 8 global Claude Code skills that enforce disciplined, test-driven development practices for agentic coding. Install once and reuse across any project.
skilltddtestingglobal-skill
by burhankhatri Jul 29, 2026 6/10
skill GitHub
An agent skill that reviews and improves UX flows using Growth.Design's product-psychology frameworks — BMAP, Psych, B.I.A.S., and journey mapping.
skilluxproduct-design
by horaklukas Jul 29, 2026 5/10
skill GitHub
Twenty-five research-grounded Claude Code / Codex skills covering cocktail scaling, home-bar inventory, drink planning, and hosting logistics. MIT-licensed and portable across agents.
skillhostinglifestyle
by garcon-drinks Jul 29, 2026 5/10
skill Reddit
A set of 18 agent-agnostic GTM skills (plain SKILL.md files) for technical founders who can build but struggle with positioning, first users, and pricing. Interviews the founder, then writes a founder brief and prioritized roadmap into the repo as markdown.
skillgtmstartupmarketing
by ShoddyReference2163 Jul 29, 2026 6/10
skill GitHub
A skill template for launching one focused Claude Code work session — parallel information gathering, a clean-up sweep, a three-question interview, a human/Claude task split, a session card, and close-out logging.
skilltemplatesession-management
by jason8-8 Jul 29, 2026 5/10
skill GitHub
Runs a pre-mortem on a concrete plan, surfacing decision-critical failure paths with evidence status, control assessment, and a residual-risk classification (Tiger/Open/Paper). Built for irreversible-action review, not vague intentions or after-the-fact root-cause analysis.
skillriskplanning
by ReedLiner Jul 29, 2026 6/10
skill GitHub
A knowledge-driven skill suite for diagnosing Huawei Ascend training and inference issues — 5 skills plus a 3-tier knowledge base, built to the Agent Skills standard.
skillhuawei-ascendml-infra
by pillumina Jul 29, 2026 5/10
skill GitHub
A Claude Code skill for trading on Polymarket through Predictdog — search markets, view your portfolio, check PnL, and place trades from the agent.
skilltradingprediction-markets
by HQSV-Labs Jul 29, 2026 5/10
skill GitHub
A Claude Code skill pack of 14 composable skills for building Azure apps that scale to zero cost when nobody's using them, documenting 37+ gotchas along with branch-per-environment CI/CD.
skillazurecost-optimizationcicd
by alexpizarro Jul 29, 2026 6/10
skill GitHub
A Claude Code skill that turns Claude into a hands-on tutor for a codebase — a live, interactive tour with real checkpoints, grounded in file:line citations rather than generic explanations.
skillonboardingdocumentation
by jonascript Jul 29, 2026 6/10
skill GitHub
A Claude Code skill that maintains a grounded, self-updating knowledge base of the Hermes agent ecosystem — a daily digest, clone-first answers, and an operator mistakes ledger.
skillknowledge-basehermes
by ImNuza Jul 29, 2026 5/10
skill GitHub
A Claude Code skill that renders any plan as a hand-drawn, dark-mode HTML diagram in an Excalidraw style — multilingual, auto right-to-left, with a pan/zoom board or vertical flow layout.
skilldiagramvisualization
by ANC1024GO Jul 29, 2026 6/10
skill GitHub
A collection of Flutter-specific AI skills and rules for Claude, Codex, Cursor, and other AI-powered IDEs.
skillfluttermobile
by evanca Jul 29, 2026 5/10
skill GitHub
An agent-ready architecture standard for SvelteKit projects, paired with an injectable audit kit to check a codebase against it.
skillsveltekitarchitecture
by XIYO Jul 29, 2026 5/10
skill GitHub
A registry of quality-gated Agent Skills aimed at reliable marketing, SEO, and repository-management workflows.
skillmarketingseo
by jayanth-mkv Jul 29, 2026 5/10
skill GitHub
A skill that pressure-tests a plan or decision without manufacturing disagreement for its own sake or forcing artificial balance.
skilldecision-making
by ReedLiner Jul 29, 2026 5/10
skill GitHub
A curated directory of skills, tools, and plugins for AI coding agents across every platform — MCP servers, Agent Skills, Cursor rules, and more.
skillawesome-listdirectory
by philipbankier Jul 29, 2026 6/10
skill GitHub
Thirteen agent skills distilled from Wheeler & Meyerson's Designing Brand Identity (6th ed.) — fundamentals, the 10 ideals, brandmark taxonomy, the 5-phase process, case studies, and a /brand router.
skillbrandingdesign
by jpoindexter Jul 29, 2026 5/10
skill GitHub
A security skill for AI agents that prevents insecure code in vibe-coded apps and teaches the agent how to audit and fix what's already there.
skillsecuritycode-audit
by jazzautomations Jul 29, 2026 6/10
skill GitHub
A council of vibe-coding skill packages (Turkish) for Claude Code, Cursor, and Codex — an end-to-end orchestrator (Sadrazam), plus planning, TDD, debugging, and UI/UX-React skills.
skillorchestrationturkish
by trugurpala Jul 29, 2026 5/10
skill GitHub
A Claude skill for systematically auditing MCP servers against a curated best-practices corpus — 68 checks across 8 categories covering OAuth 2.1, OWASP, the Lethal Trifecta, and Swiss compliance (DSG/ISDS).
skillmcpsecurity-auditoauth
by malkreide Jul 29, 2026 7/10
skill GitHub
An agent skill that swaps a markdown response for a single-file HTML page — tabbed content, dark theme, Bootstrap 5 plus highlight.js via CDN with SRI, a copy button on every block, and tab deep-linking through the URL. Includes a linter that rejects broken ARIA, unescaped code, and floating CDN versions. No npm, no build.
skillhtmldocumentation
by frederico-kluser Jul 29, 2026 6/10
skill GitHub
A Claude skill paired with a boilerplate for building Salesforce React UIBundle (multi-framework) apps, covering the full lifecycle with the platform's gotchas already baked in.
skillsalesforceboilerplate
by leafarhz Jul 29, 2026 5/10
skill GitHub
Skills and reviewer agents for AI-first climate science, built and used in practice by a PhD atmospheric scientist.
skillclimate-scienceresearch
by dgilford Jul 29, 2026 6/10
skill GitHub
Analyzes any input to recommend existing skills, improve them, or create new ones from scratch — an intelligent skill router and creator for Claude Code and Codex.
skillroutermeta-tooling
by tripleyak Jul 29, 2026 6/10
skill GitHub
A panel of 3 to 5 named advisory voices for thinking through a decision, with a mandatory-dissent rule so someone always has to disagree with you. Works in Claude chat, Cowork, and Claude Code.
skilldecision-makingadvisory
by MonicaOrtizM Jul 29, 2026 5/10
skill GitHub
A curated list of Claude Code, Cursor, and Copilot skills and plugins built specifically for students, covering IB, IGCSE, and college-bound coursework. A useful starting point for anyone studying alongside an AI coding agent.
skillsstudentseducationcurated-list
by StudentSuite Jul 29, 2026 5/10
skill GitHub
Two editing skills for Russian and English text that remove common AI-generated writing tells without flattening the author's voice. Explicitly not a detector-bypass tool, it's aimed at making AI-assisted writing read naturally.
skillwritingediting
by spyrae Jul 29, 2026 5/10
skill GitHub
A Claude Code skill that builds a website alongside the design system that governs it, enforcing checks that block rather than merely advise. Keeps generated UI consistent with a project's design tokens instead of drifting per page.
skilldesign-systemwebquality-gate
by jaenicket Jul 29, 2026 6/10
skill GitHub
Surveys every AI slide-deck skill worth knowing on one page, covering both HTML and native-PPTX routes, bilingual (English/Chinese). Ranks them with a reproducible benchmark instead of relying on star counts.
skillslidesbenchmarkpresentation
by brycewang-stanford Jul 29, 2026 7/10
skill GitHub
Official-style skill package exposing DataRobot platform capabilities to coding agents, letting Claude Code and similar tools interact with DataRobot's ML platform directly.
skillmlopsdatarobotvendor
by datarobot-oss Jul 29, 2026 5/10
skill GitHub
A collection of official Claude Skills published by Posit (the company behind RStudio) for R and data-science workflows.
skillrdata-sciencevendor
by posit-dev Jul 29, 2026 6/10
skill GitHub
A Claude Code skill that maintains a ROADMAP.md with live priorities and a revision history, explaining changes as they happen rather than leaving the roadmap to go stale.
skillroadmapdocumentationproject-management
by code-katz Jul 29, 2026 6/10
skill GitHub
A future-first, production-safe skill for writing modern Svelte 5 and SvelteKit 2 code with AI agents, keeping generated code aligned with current Svelte idioms instead of outdated patterns baked into model training data.
skillsveltesveltekitfrontend
by fifidayone Jul 29, 2026 6/10
skill GitHub
A prompt-based skill that adapts how Claude communicates to work better for neurodivergent users, shifting the burden of adaptation from the person to the AI rather than the other way around.
skillaccessibilityneurodivergentux
by Hep2o Jul 29, 2026 6/10
skill Reddit
A concrete look at the SKILL.md lazy-loading problem in the open-source OpenHarness agent SDK: every skill's name and description sits in the tool schema on every turn, so a large skill catalog still adds real token overhead even though full skill content only loads on demand. The author is weighing search-based skill discovery over exposing the whole catalog once it grows past a handful of entries.
skillskill-loadingcontextopen-harness
by mgfeller Jul 29, 2026 6/10
skill GitHub
A VS Code extension for creating and validating Codex, Claude, and Gemini skills directly inside a project, catching malformed SKILL.md files before they ship.
skillvscodevalidationtooling
by spmisha134 Jul 29, 2026 6/10
skill GitHub
Twenty free Claude Code skills, each derived from an actual defect found in production rather than a hypothetical best practice. Installable via /plugin marketplace add or npx toolbay.
skillqualityproductionbug-prevention
by sriptcollector Jul 29, 2026 7/10
skill GitHub
A hands-on lab for learning to write effective CLAUDE.md files and Claude Code setups: you write the context, the agent builds the code, and a coach reviews your work.
skillclaude-mdlearningeducation
by JSchOBL Jul 29, 2026 5/10
skill GitHub
A tiny prompt and installer that makes an agent lead with its verdict/conclusion before the reasoning, across Claude Code, Codex, Gemini, Cursor, opencode, and 30+ other agents.
skilloutput-formatconciseness
by 0p9b Jul 29, 2026 6/10
skill GitHub
Official Claude/Codex-compatible Agent Skills for integrating with FastBound's products and APIs, plus a Claude Code plugin marketplace.
skillvendorapicompliance
by FastBound Jul 29, 2026 5/10
skill GitHub
Ports Anthropic's official Small Business skills — covering cash flow, invoices, CRM, support, marketing, hiring, and weekly business rhythm — to Codex under an Apache-2.0 license.
skillbusinesscodexport
by simongonzalezdc Jul 29, 2026 6/10
skill GitHub
An Apache-2.0 skill that guides an AI coding agent toward readable, accessible, high-performance web typography choices instead of default framework styling.
skilltypographyaccessibilityweb
by simongonzalezdc Jul 29, 2026 5/10
skill GitHub
Agent skills for Claude Code, Codex, and OpenCode that are validated with evals rather than shipped on vibes, for developers skeptical of unverified skill claims.
skillevalsverification
by slowdini Jul 29, 2026 6/10
skill GitHub
A reference repo that auto-syncs Anthropic's official docs alongside curated team insights, paired with an ask-archivist skill for deterministic local lookup inside Claude Code instead of relying on model memory.
skilldocumentationreferencelookup
by coroboros Jul 29, 2026 7/10
skill GitHub
A TypeDoc plugin, CLI, and Docusaurus/VitePress integration that auto-generates SKILL.md files directly from a TypeScript library's API documentation, keeping agent-facing docs in sync with the actual API surface.
skilltypescripttypedocauto-generation
by pradeepmouli Jul 29, 2026 7/10
skill GitHub
An agent skill that turns a vague requirement into gate-verified code using Gherkin acceptance specs and quality gates on coverage, complexity, duplication, and mutation score, with automatic failure routing between four specialized agent roles. Includes a zero-dependency Python scaffolder, MIT licensed.
multi-agentquality-gatesskillpython
by whaojie797-design Jul 28, 2026 7/10
skill GitHub
A tool that converts corrections you give an agent into persistent preferences, project-specific skills, and shared skills, working across Claude Code, Codex, and OpenCode. Aims to make an agent learn from feedback instead of repeating the same mistakes.
skillspreferenceslearning
by ReflexioAI Jul 28, 2026 6/10
skill GitHub
An agent skill for Claude Code, Codex, Cursor, and Gemini/Antigravity that has the agent understand a repo before changing it, so it avoids duplicating schema or dependencies and keeps performance-consistent code. A reasonable pre-edit-discipline pattern, if somewhat generic.
skillcode-qualityrepo-analysis
by tissueeeee Jul 28, 2026 5/10
skill GitHub
A set of 14 AI agent skill files covering DI, async SQL, CQRS, caching, resilience, CLI code generation, and testing, targeted at the Lexigram framework but usable with any markdown-aware coding agent including Claude Code.
skillsframeworkbackend
by dbtinoy- Jul 28, 2026 5/10
skill GitHub
A Chinese-language curated collection of Claude Code and OpenClaw skills plus MCP servers focused on AI video generation, multi-platform content operations, and content automation.
skillsmcpcontent-automationchinese
by JuneYaooo Jul 28, 2026 5/10
skill GitHub
A Claude Code/Codex agent skill that replaces or appends a Markdown section idempotently without corrupting code fences, using fence-aware heading scans and fixed-marker boundaries. Includes a tested reference implementation and an apply-twice-diff-zero verification recipe.
skillmarkdownidempotencydocumentation
by h8nc4y Jul 28, 2026 7/10
skill GitHub
A Claude Code/Codex skill suite guiding Chinese graduate students and researchers through the full academic pipeline -- topic selection, literature search, writing, review, and submission -- across 25 commands. Citations are verified against real API responses rather than the model's memory.
skillacademic-researchcitation-verificationchinese
by cabbage2000-lab Jul 28, 2026 7/10
skill GitHub
A set of Claude skills that automate literature surveys by building verified source corpora, reporting honest metrics, using minimal figures, and producing a short PDF state-of-the-art report.
skillliterature-reviewresearchpdf-report
by DanieleMosh Jul 28, 2026 6/10
skill GitHub
A curated set of agent skills aimed at open source project maintainers, though the repo description doesn't detail which specific maintainer tasks are covered.
skillopen-sourcemaintainers
by svyatov Jul 28, 2026 5/10
skill GitHub
A large skill set for LLM-driven SQL Server performance tuning, covering T-SQL, execution plans, wait stats, deadlocks, Query Store, indexes, encryption, Always On AG, WSFC, error logs, memory, disk I/O, config drift, and migration readiness, backed by a remote MCP server on Cloudflare Workers.
skillmcpsql-serverperformance-tuning
by vanterx Jul 28, 2026 7/10
skill GitHub
A community-maintained collection of Agent Skills (SKILL.md files with scripts, references, and examples) usable across Claude, Codex, Gemini CLI, Cursor, and similar tools, positioned as one of the largest such libraries.
skilllibrarycommunitymulti-tool
by JayRHa Jul 28, 2026 6/10
skill Reddit
Webcmd lets Claude explore a website once, then compiles the learned navigation into a named CLI command so future sessions get structured output instead of re-exploring the page. Installs as a Claude Code skill, supports named login profiles, and falls back through public endpoints, session cookies, and replayed requests before using a browser.
skillcliweb-scrapingautomation
by Opening-Profile6279 Jul 28, 2026 7/10
skill GitHub
An agent skill that reads, writes, and edits HWPX (.hwpx) files — the Hancom Office Hangul word processor format — and auto-converts Markdown, text, or URLs into HWPX documents. Fills a specific localization gap for Korean-language document workflows.
skillkoreandocument-generationhwpx
by imsebeom Jul 28, 2026 6/10
skill GitHub
An Agent Skill for running large-scale brand strategy and identity work, structured as 10 evidence-backed research workstreams with iterative cross-team debate, producing 7 implementation-ready deliverables. Works across Claude Code, Codex, Cursor, and Copilot.
skillbrandingstrategyresearch
by simone-sestili Jul 28, 2026 6/10
skill GitHub
An Agent Skill that helps write prompts by matching techniques to the target model class and separating evidence-backed practices from folklore. Aimed at making prompt engineering more systematic rather than trial-and-error.
skillprompt-engineeringllm
by k-vaca Jul 28, 2026 5/10
skill GitHub
A Claude skill that generates cut-and-layer collage artwork using real, open-licensed imagery. Niche creative use case for agent-assisted visual art generation.
skillcreativecollageimage
by polgarp Jul 28, 2026 6/10
skill GitHub
A set of Claude Code skills (motion-judgment, motion-guide, handoff, design-critique, ai-slop-detector, concept-gate) distilled from 11 years of production UX motion design work. Aims to give agents professional design judgment rather than generic 'make it nice' output.
skilldesignuxmotion
by kjooncho Jul 28, 2026 7/10
skill GitHub
A Claude Code output style that fuses caveman, ponytail, and 'i-have-adhd' modes into one rule set: minimal solution, action-first structure, zero-fat density. For users who want terser, less verbose agent responses.
output-styleverbositycommand
by FlorianBruniaux Jul 28, 2026 5/10
skill Reddit
Given an objective, a central 'Designator' agent decides how many hierarchy levels a task needs, which specialist sub-agents to create, and which model tier each runs on, so cheap or local models handle most work and expensive models only make decisions that need to crystallize. A single mapping.json is the source of truth, read cheaply before each task so the design agent doesn't wake up unnecessarily.
skillmulti-agentcost-optimizationorchestration
by Aggravating_Bid1129 Jul 28, 2026 7/10
skill GitHub
An audit skill covering ten tracks for both traditional search and AI answer engines, with every finding backed by an observation and every recommendation tiered into a prioritized change plan. Includes a dated Google update timeline, 59 growth plays, and 29 refuted SEO myths.
skillseoauditmarketing
by ssheleg Jul 28, 2026 6/10
skill GitHub
A Claude Code skill for reading technical papers that adds inline Chinese annotations, reader-adaptive explanations, and geometric intuition to help readers work through dense material. Niche but concrete use case for research reading workflows.
skillresearchtranslationpapers
by BladeDancer743 Jul 28, 2026 6/10
skill GitHub
An agent skill specifically for ManimGL, the original 3Blue1Brown animation engine, as distinct from the more commonly supported Manim Community Edition. Fills a specific compatibility gap for people using the original library.
skillmanimanimationmath
by do-gongil Jul 28, 2026 6/10
skill GitHub
A Claude Code skill structuring explanations as mechanism-before-name with one honest analogy stating its limits, plus a difficulty ladder from kitchen-table to specialist level. Built from an ~88k-word corpus of primary-source material on Feynman's teaching style.
skillteachingexplanation
by guicortei Jul 28, 2026 7/10
skill GitHub
A Claude Code skill workflow converting Word manuscripts to Markdown and back while preserving live Zotero citations and cross-references. Useful for academics editing papers with AI assistance without breaking their citation manager.
academic-writingzoteromarkdown
by pwya Jul 28, 2026 7/10
skill GitHub
A stack-agnostic Claude Code skill teaching agents a cinematic, scroll-driven design methodology for landing pages and hero sections, plus style packs for product UI. Positioned as a 'taste layer' of design judgment rather than a component library.
skilllanding-pagesdesign
by ssheleg Jul 28, 2026 7/10
skill GitHub
A compact Claude Code skill set positioned as a lighter alternative to Superpowers, built around four skills covering a full working loop: shape it, code it, dig it, snapshot it. Aimed at people wanting a simpler skill stack than larger frameworks.
skillworkflow
by liustack Jul 28, 2026 6/10
skill GitHub
A set of 21 skills covering design judgment, colour, motion, accessibility, layout, and theming for coding agents, compatible with Claude Code, Cursor, Windsurf, Cline, and more. Aimed at giving agents structured design taste rather than just component templates.
skilldesignaccessibility
by yogvidwankhede Jul 28, 2026 6/10
skill GitHub
A structured deep-review methodology for Claude Code that runs code through 14 distinct review lenses iteratively; the author reports it found 14 production bugs, including 2 ship-stoppers, on its first real use. Useful as a reusable review skill for catching issues a single-pass review misses.
code-reviewskillquality
by aksheyw Jul 28, 2026 8/10
skill GitHub
A set of Claude Code skills that audit and upgrade a repository against the 10 'repo to product' practices from Mateusz Pusz's talk. Useful for teams wanting an automated check on repo hygiene and product-readiness conventions.
skillrepo-auditbest-practices
by breed Jul 28, 2026 6/10
skill GitHub
Free, open Claude skills that teach an AI agent to design real, manufacturable things using Axle Keys' engineering conventions. Aimed at hardware/mechanical design workflows rather than pure software.
skillhardwaremanufacturingdesign
by AxleKeys Jul 28, 2026 5/10
skill GitHub
A collection of skills, principles, project templates, and a career vault for designers who use Claude as a creative collaborator. Aimed at bringing structured Claude Code workflows to design practice rather than engineering.
skilldesigntemplates
by mshadmanrahman Jul 28, 2026 5/10
skill GitHub
Official MailChannels skills for Claude Code and Codex, giving agents direct access to MailChannels' email API/tools. Useful for teams already on MailChannels who want agent-driven email deliverability workflows.
pluginemailmailchannels
by mailchannels Jul 28, 2026 5/10
skill GitHub
A skill set spanning the full product lifecycle from idea to shipped, notable for assigning the right model tier to each subagent instead of defaulting everything to the most expensive model. Works across Claude Code, Codex, Gemini CLI, and Antigravity.
skillproduct-developmentmodel-routingcost-optimization
by takaoumehara Jul 28, 2026 6/10
skill GitHub
A set of portable skills, Claude Code plugins, and zero-dependency CLI checks covering design tokens, supply-chain safety, evidence-backed writing, and UI verification for agent-tooling workflows. Aimed at teams wanting lightweight, dependency-free guardrails around agent output quality.
skillguardrailssupply-chainui-verification
by connordibble Jul 28, 2026 6/10
skill GitHub
A zero-dependency tool that generates personalized Hacker News briefs inside Claude Code, learning your interests from what you click over time. A lightweight way to get a curated tech news feed without leaving your terminal.
skillnewspersonalization
by ArchitektApx Jul 28, 2026 6/10
skill GitHub
Agent skills wrapping the exchangerate.dev API for currency conversion, FX correctness checks, portfolio translation, and multi-currency pricing — and it works keyless. Useful for finance-adjacent apps built with Claude Code.
skillfxfinanceapi
by nusantara-ventures Jul 28, 2026 5/10
skill GitHub
A library of Claude skills designed to work together via explicit phase and handoff routing, shared state, and a maker/checker review loop. Aimed at making multi-skill workflows more reliable than ad hoc skill chaining.
skillworkflowmaker-checkerorchestration
by scoobydrew83 Jul 28, 2026 5/10
skill GitHub
A Claude Code plugin with 40 skills for B2B outbound sales, plus a canonical briefing document that persists context across sessions. Tuned for lemlist but works with other outbound tools.
skillsalesoutboundb2b
by henriquecaner Jul 28, 2026 5/10
skill GitHub
An open-source social media production plugin with 16 skills and 25 commands covering AI image (Nano Banana Pro) and video (Kling v3.0 Pro) generation, plus C2PA content-provenance signing for EU AI Act Article 50 compliance. Installs across Claude Code, Codex, Cursor, Copilot CLI, and more.
skillsocial-mediacontent-generationcompliance
by indranilbanerjee Jul 28, 2026 6/10
skill GitHub
A collection of reusable AI agent skills with tooling to sync, export, and publish them across multiple IDEs. Aimed at skill authors who want to maintain one skill library across several coding-agent tools.
skillmulti-idepublishing
by Luckycat133 Jul 28, 2026 5/10
skill GitHub
A Claude Code skill methodology library establishing rules for AI-driven development: seven-layer documentation governance, adversarial review, and a task-control triad, plus skills for legacy-code archaeology and construction blueprints. Aimed at keeping AI-written code fast without losing control.
skillgovernancecode-reviewdocumentation
by BackToCimaCoppi Jul 28, 2026 6/10
skill GitHub
A heavily built-out Claude Code skill offering persistent cross-session memory, near-zero-token semantic search, an 'errarium' that flags repeated mistakes before you make them again, caged autonomy controls, and a local dashboard — organized into 16 'organs' and 54 commands, with 1,650 tests and zero dependencies.
skillmemorysemantic-searchdashboard
by CHAOSX-SPACE Jul 28, 2026 6/10
skill Reddit
A free, MIT-licensed Claude Code skill for filing Indian income tax returns (AY 2026-27): Claude reads your Form 16/AIS/broker statements and interviews you for deductions, but every calculation — both tax regimes, capital gains, surcharge marginal relief, interest, and loss set-off — runs in tested, deterministic stdlib Python rather than the model. Backed by 47 golden tests and a 350,000-run property fuzzer that caught real rounding and marginal-relief bugs before release, and it explicitly refuses cases outside its scope (NRI, F&O, audits) and never touches your portal password or submit button.
skilltaxindiadeterministic-computation
by karanb192 Jul 28, 2026 8/10
skill Reddit
A Windows scheduled task that runs Claude Code every morning to scan the prior day's session files and write anything worth keeping into a persistent memory directory, with no manual 'remember this' prompts required. Guardrails prevent emotional content, fabrications, and deletions; five days of real use produced six new memories with zero duplicates.
skillmemoryautomationscheduled-task
by ZingLam0924 Jul 28, 2026 6/10
skill GitHub
A Claude Code / Claude.ai skill that makes any codebase deployable via `docker compose up` and shippable through CI/CD, generating hardened defaults in a single pass. Aimed at closing the gap between 'it runs locally' and 'it's actually deployable.'
skilldeploymentdockerci-cd
by sudais-khalid Jul 28, 2026 6/10
skill GitHub
A Claude Code skill that searches vanpeople and vansky rental platforms for Vancouver listings, filtering by city, bedrooms, price, and facilities. It deduplicates results, classifies units as above-ground, and exports contact lists as Markdown or HTML. A concrete example of building a domain-specific search skill with structured output.
skillsearchreal-estatevancouvermarkdownhtml
by gaoxiaowei2117 Jul 27, 2026 5/10
skill GitHub
An installable Claude Code skill that reads session history from disk and computes a compliance percentage per configured rule — no network, no dependencies beyond the standard library. Helps you quantify how reliably your Claude Code agent follows the rules defined in CLAUDE.md or other instruction files. Useful for debugging agent drift in long sessions.
skillcompliancerulesCLAUDE.mdsession-analysisaudit
by jleonceo Jul 27, 2026 8/10
skill GitHub
A Claude Code skill that encodes the Awwwards judging rubric (Design 40 / Usability 30 / Creativity 20 / Content 10) as an 8-phase build method with 16 curated references, working templates, and a runnable real-browser audit step. Designed to systematically raise the quality bar of AI-generated web UIs against a professional design scoring system.
designuiwebskillauditawwwards
by SandroHub013 Jul 27, 2026 7/10
skill GitHub
A portable set of agent skills that start from a Product Requirements Document and propagate architecture and design-system context throughout the development process. Works across Claude, Gemini, and OpenAI Codex with verified multi-model development support.
skillsprdmulti-modelarchitecturedesign-system
by Cartograf666 Jul 27, 2026 6/10
skill GitHub
A large, maintained collection of 46 Claude Code skills covering DevOps, security, infrastructure, and software engineering. Skills are quality-controlled through lint/spec checks, behavioral test coverage, and a Karpathy-style autoresearch loop — one of the most systematically tested skill packs available.
skillsdevopssecurityinfrastructuretesting
by iuliandita Jul 27, 2026 7/10
skill GitHub
A curated set of 29 skills covering cost-tier model routing, debugging patterns (rubber-duck, test-first bugfix, trust-but-verify), and 24 software-law reference skills. Installs with a single npx command. Practical and opinionated about when to use each model tier.
skillsmodel-routingdebuggingsoftware-lawsnpx
by The-Artificer-of-Ciphers-LLC Jul 27, 2026 7/10
skill GitHub
A social media content studio built on the playbooks of popular creator-educators like Matt Pocock, Theo, and ThePrimeagen. Nine skills turn a single idea into platform-specific content across multiple channels. Opinionated about voice and format.
skillssocial-mediacontenttwittercreators
by Jeff-Kazzee Jul 27, 2026 6/10
skill GitHub
A skill that runs two parallel verification lanes: a reasoning audit (checking premise, approach, and fresh thinking) and a claim-verification pipeline that passes or blocks each assertion through context-isolated judges. Designed to catch overconfident or unsupported claims before they reach your codebase.
skillsverificationconfidenceauditclaims
by GemSpecter Jul 27, 2026 7/10
skill GitHub
An agent skill that first questions whether an agentic system is needed at all, then walks through design, construction, auditing, verification, and porting across frameworks. Covers the full lifecycle from simple workflows to governed agent teams, with sanity checks at each stage.
skillsmulti-agentarchitectureauditagent-design
by ingcontartese-netizen Jul 27, 2026 7/10
skill GitHub
A Claude Code skill that takes a GitHub issue and drives it all the way to a clean pull request: plan, validate, implement, self-review, ship, then monitor CI and review feedback and iterate until the PR passes. Designed to operate unattended while maintaining a high quality bar.
skillsgithubprciautonomousissue-driven
by jakozloski Jul 27, 2026 8/10
skill GitHub
Skills for migrating session context between 9 different coding-agent sources (Claude Code, Codex, Cursor, etc.) and 9 target host environments — 81 source/dest combinations in total. Uses only stdlib, no dependencies. Generates a static context handoff artifact for the next session rather than a live restore.
skillscontextmigrationsessionmulti-agent
by ImL1s Jul 27, 2026 6/10
skill GitHub
A set of 7 skills covering UX research, product design, and user experience work in Claude Code sessions. Provides structured approaches to design tasks that would otherwise require custom prompting each time.
skillsuxproduct-designuiresearch
by JoaoMonteiro100 Jul 27, 2026 6/10
skill GitHub
A personal, field-tested skill pack prioritizing human readability. Skills optionally include declarative YON (yes/or/no) protocol specifications that can be inspected and validated independently. Prioritizes transparency and auditability over magic.
skillsreadablevalidationprotocolopen-source
by allemaar Jul 27, 2026 6/10
skill GitHub
Agent skills for twitr.sh, a pay-per-call X/Twitter API service for AI agents. No developer API key required — a USDC wallet pays per call. Enables Claude Code agents to query Twitter data on a usage basis without a developer account.
skillstwitterxapicryptousdc
by lnvestor Jul 27, 2026 5/10
skill GitHub
A set of skills implementing the complete go-to-market outbound pipeline — discover, qualify, extract, signal, judge, resolve — directly on raw vendor APIs with no SaaS layer. Designed for teams that want full control over their prospecting stack without paying for middleware.
skillsgtmsalesoutboundcrmb2b
by Zevenue Jul 27, 2026 5/10
skill GitHub
A Claude Code skill that installs standing rules guarding against common AI research agent failure modes: reward hacking, fabricating results after failed runs, data leakage, undertuned baselines, single-seed claims, LLM-judge bias, and premature completion. Applies to Claude Code, Codex, and Cursor.
skillsresearchintegritysafetyanti-hallucinationscience
by jackiectl Jul 27, 2026 7/10
skill GitHub
Claude Code skills and hooks focused on shipping clean PRs and pre-verifying the impact of changes on existing code. Covers PR quality gates, Kotlin/JVM Spring, React/Next.js, and NestJS stacks. Useful for multi-stack teams who want consistent PR quality across different tech stacks.
skillshooksPRscode-reviewmulti-stack
by BK202503 Jul 27, 2026 7/10
skill GitHub
An agent skill that deep-reads a single research paper and generates high-quality Obsidian-style research notes from it. Works with Claude Code, Codex, Cursor, Copilot, and Gemini CLI. Useful for researchers and academics who want structured, reusable notes from paper reading sessions.
researchObsidiannotesacademicskill
by 917Dhj Jul 27, 2026 6/10
skill GitHub
Writing skills for Claude Code, Claude Cowork, and Codex grounded in real style standards rather than generic LLM defaults. Designed to produce technical writing that reads as deliberate and human rather than AI-generated. Install as any standard agent skill.
writingstyleskillsqualityanti-slop
by rookslog Jul 27, 2026 6/10
skill GitHub
A multi-modal generative media skill pack for Claude Code, Cursor, and Gemini CLI that enables high-quality image, video, and audio generation from within coding agent sessions. Useful for building media-rich applications or generating assets during development.
image-generationvideoaudiomulti-modalskills
by SamurAIGPT Jul 27, 2026 6/10
skill GitHub
A curated catalog of 70+ open-source AI agent tools for academic literature review, organized across 11 categories including Claude Code skills, deep research, MCP servers, PDF parsing, and systematic review. A comprehensive starting point for researchers using AI coding tools for literature work.
academicliterature-reviewMCPresearchskills
by brycewang-stanford Jul 27, 2026 6/10
skill GitHub
A Claude Code skill that takes a folder of draft content and produces a complete book: structural blueprint, hand-paginated chapters, and a verified PDF. Automates the book production pipeline from rough drafts to finished output without a dedicated publishing workflow tool.
writingbookPDFpublishingskill
by swiftugandan Jul 27, 2026 6/10
skill GitHub
A collection of 100 markdown skill files across 9 categories covering SEO, content creation, and Generative Engine Optimization (GEO) for Claude Code, Cursor, and compatible tools. GEO focuses on optimizing content for AI-generated search responses rather than traditional search engines.
marketingSEOGEOcontentskills
by dahiyaakshay Jul 27, 2026 6/10
skill GitHub
A skills plugin that runs on both Claude Code and OpenAI Codex with a self-evolve loop that learns and updates skill definitions from every invocation. Skills improve over time based on what actually works across real development sessions.
skillsself-evolvingCodexdual-hostlearning
by risadams Jul 27, 2026 6/10
skill GitHub
A skill that generates evidence-grounded software architecture diagrams from actual codebases using Claude Code and Codex. Covers features, data flows, patterns, system design, and engineering decisions. Diagrams are grounded in real code rather than hallucinated from documentation.
architecturediagramsdocumentationskillCodex
by amirtaherkhani Jul 27, 2026 6/10
skill GitHub
A simple Claude Code skill that reads your source code and generates structured documentation from it. Install as a plugin and invoke to produce documentation for your codebase. Straightforward automation for the documentation task most developers put off.
documentationskillautomationcode-docs
by jonaskahn Jul 27, 2026 6/10
skill GitHub
A design agent skill that plans first, finds visual references, builds intentional interfaces with considered motion design, and proves the result. Targets the gap in AI coding tools where generated UIs work functionally but lack deliberate design decisions.
designUIskillmotioninterfaces
by Oldiiik Jul 27, 2026 6/10
skill GitHub
A curated collection of skills, rules, hooks, and templates specifically designed to reduce token consumption and accelerate shipping with Claude Code. Bundles optimization techniques from the community into an installable package targeting developers who want faster and cheaper Claude Code sessions.
tokensoptimizationskillshookstemplates
by pupillary-rosewater603 Jul 27, 2026 7/10
skill GitHub
A skill that routes website-building tasks through a mode-specific workflow, enforces a 12-step build loop, and actually renders and measures the result instead of stopping at the code. Designed to prevent the generic AI-generated website look by embedding quality gates into the build process.
webdesignskillsworkflowquality
by byensitmagnus Jul 27, 2026 7/10
skill GitHub
A Claude Code skill that audits any SaaS application for production readiness across security, scalability, reliability, testing, observability, and compliance. Reports findings first and only proposes fixes after you approve, with no scripts that execute automatically. Works with any tech stack.
SaaSauditsecurityreliabilityskill
by smiladinov Jul 27, 2026 7/10
skill GitHub
A suite of 14 Claude Code skills covering academic research tasks: paper reading, literature review, bibliography auditing, preregistration, referee reports, replication packages, LaTeX, and TikZ generation. Also includes a Quarto reveal.js slide system with render-time quality gates. Built as a proof-of-concept with Claude Code itself.
academicresearchLaTeXliterature-reviewskills
by ericluo04 Jul 27, 2026 7/10
skill GitHub
A skill pack that wraps the full development cycle for Claude Code: ticket intake, acceptance-test-driven development planning, code review, doc-drift audits, PR writing, and changelog generation. Designed to bring structure to agentic development from spec to shipped PR.
skillsATDDcode-reviewPRsdev-cycle
by Flagrare Jul 27, 2026 7/10
skill GitHub
An agent skill that brings design engineering principles to AI coding agents for building high-quality UI. Enforces visual hierarchy, interaction design, and accessibility standards through the skill workflow. Targets the gap between functional and polished UI in AI-generated code.
UIdesigncraftskillfrontend
by educlopez Jul 27, 2026 7/10
skill GitHub
A Claude Code skill pack covering single PRs, parallel PR fan-out, multi-phase epics, and a ruthless pre-ship critic. One session chairs the entire release so context never splits across agents. Ideal for teams shipping iterative features with AI-powered review gates.
shippingPRsfan-outskillsworkflow
by davidtheproduct Jul 27, 2026 8/10
skill GitHub
Fans out sub-agents to explore, diagnose, fix, review, and verify a codebase in parallel. Uses a cross-checked, ledger-backed approach and keeps iterating until the code is production-ready. A skill-based drop-in for Claude Code projects needing thorough automated remediation.
multi-agentorchestrationskillautomationcode-review
by SaarthurR Jul 27, 2026 8/10
skill GitHub
Provides a Claude Code skill and worked Rocq→Rust→Python example for hardening formally verified code extracted to native libraries: proved input domains, checked-arithmetic builds, panic containment, and differential tests. Targets teams using formal methods who need to verify safety across the FFI boundary.
formal-verificationffirustsafetyskill
by cosmindxu Jul 27, 2026 6/10
skill GitHub
Opinionated skills that force you to give Claude your actual voice and the real work behind a piece of writing, rather than a generic prompt. Intended for engineers publishing blog posts, documentation, or technical essays who want output that sounds like them.
writingskilldocumentationvoicecontent
by foxontheerun Jul 27, 2026 6/10
skill GitHub
Indexes and auto-curates skills for Claude Code and Codex so you can search rather than browse scattered repos. Helps teams discover relevant community skills before writing new ones from scratch.
skillcatalogdiscoverycodexcommunity
by Zita-Go Jul 27, 2026 6/10
skill GitHub
Claude Code skill that classifies and renames EPUB ebooks using Dewey Decimal numbers, reorganizing a messy library into a consistent structure. A practical single-purpose skill for researchers or heavy readers with large ebook collections.
skillepublibraryorganizationbooks
by brege Jul 27, 2026 5/10
skill GitHub
Provides a curated, reusable set of AGENTS steering files, Claude Code skills, and project scaffold scripts so teams can configure AI coding context consistently across projects. Includes guided setup for both new and existing codebases.
skillagentsscaffoldconfigurationcontext
by dills122 Jul 27, 2026 7/10
skill GitHub
Lets you store and version your Claude Code and Codex skills in a personal git repo, then load them into any project. Keeps skills portable, reproducible, and under your own version control rather than scattered across machines.
skillgitversion-controlcodexmanagement
by sethdeckard Jul 27, 2026 7/10
skill GitHub
The Multiplai plugin marketplace for Claude Code ships seven ready-to-install plugin packs covering memory and context, dev tooling, PM, research, media, messaging, and writing. Designed for quick setup — pick the packs you need and install them as a bundle.
skillmarketplacepluginmemorydev
by spikelab Jul 26, 2026 7/10
skill GitHub
A Claude Code plugin that brings PR-review-style code quality analysis to existing codebases, not just diffs. Based on pr-review-toolkit, it extends coverage to broader quality checks on legacy and brownfield projects.
skillcode-reviewqualityplugin
by devdanzin Jul 26, 2026 7/10
skill GitHub
compass-core is a drop-in governance layer for Claude Code projects with standard operating procedures, input validators, and a governance skill backed by a dedicated subagent. Designed to be shared across projects so teams enforce consistent behavioral guardrails.
skillgovernancesopsvalidationsubagent
by the-metafactory Jul 26, 2026 7/10
skill GitHub
Extends the Laravel AI SDK with Claude Code-style skills, CLI tools, and knowledge bases for agent-powered Laravel apps. Adds a security-first trust model and an opt-in HTTP management layer. Useful for teams building Claude-powered backends in the PHP/Laravel ecosystem.
skilllaravelphpagentsecurity
by andreagroferreira Jul 26, 2026 6/10
skill GitHub
vibe-rules delivers coding standards to AI agents only when a matching file is open, keeping the context window small. Hooks block unsafe patterns that tests cannot catch. Ships 20 modules covering PHP, JS, Python, SQL, and ops — built to reduce the risk in AI-generated code.
skillstandardsruleshookscontext
by DanielLetto2020 Jul 26, 2026 8/10
skill GitHub
A Claude Code skill that runs experiments around the clock, maintains a public Git repo, and updates a LaTeX paper on Overleaf without supervision. Self-reported 25x efficiency gain. Installs into any project with a single command.
skillresearchautomationlatexworkflow
by hashiruu Jul 26, 2026 7/10
skill Reddit
Reddit discussion asking what practitioners actually put in their skills and CLAUDE.md to prevent bugs and poor decisions. Responses surface real-world configurations, mental models, and specific instructions that have worked. Useful for anyone looking to improve their system prompt or skill configuration beyond generic platitudes.
claude.mdskillprompt-engineeringcommunity
by bluespiritgg Jul 26, 2026 6/10
skill Reddit
Detailed Reddit guide that explains the practical distinction between Claude Code skills, MCP servers, and plugins with one decisive test: if Claude already has access but does the job wrong, use a skill; if it genuinely cannot reach the system, use MCP; if you want distribution, use a plugin. Includes a real example of a wasted weekend building an MCP that should have been a SKILL.md, plus the real context-cost of over-connecting servers.
skillmcppluginarchitecturebest-practicesdecision-framework
by Bulky_Ad738 Jul 26, 2026 8/10
skill GitHub
Provides 9 agent skills and a stdlib evidence engine that distinguishes facts from guesses. Known facts block progress until resolved; guesses surface as advisory notes; humans approve before proceeding. Adds a structured, evidence-backed workflow layer to LLM coding agents targeting overconfident output.
spec-drivenevidenceskillverificationguardrails
by andresmassello Jul 26, 2026 7/10
skill GitHub
Documentation framework with split REQUIREMENTS, ARCHITECTURE, REPORT, and HANDOFF files plus START_HERE kickoff files for multi-session, multi-agent development. Task ledgers double as delegation specs so an incoming agent knows exactly what to pick up. Includes bilingual (EN/JA) templates.
handoffmulti-sessiondocumentationmulti-agentskillbilingual
by h8nc4y Jul 26, 2026 7/10
skill GitHub
Distills the wireframing methodology from Wireframing for Everyone (A Book Apart) into 7 agent reference skills plus a /wireframe dispatcher for Claude Code. Covers the full workflow from concept to handoff as Claude Code slash commands. Useful for product teams using Claude Code for design documentation and UX planning.
wireframingdesignskilluxdocumentationproduct
by jpoindexter Jul 26, 2026 6/10
skill GitHub
Detects the project tech stack and installs only the agent skills that Claude Code, Codex, and Grok actually need for that specific stack. Avoids bloating context with irrelevant skills and provides a clean, targeted skill set from project start. Good for onboarding Claude Code into existing projects.
skillbootstrapproject-setupstack-detectioninstallationonboarding
by lucascharao Jul 26, 2026 7/10
skill GitHub
Manages agent instructions, skills, and configurations across Claude and Codex sessions from a single interface. Provides structured storage and retrieval of agent-specific knowledge within a session. Useful for teams maintaining consistent skill sets and configurations across multiple AI coding agents.
skillconfigagentmanagercodexmulti-agent
by brege Jul 26, 2026 7/10
skill GitHub
A Claude Code/Codex skill that turns articles, ideas, and arguments into checked Quiet Paper PNGs — content in, styled image out.
skillimagevisualizationpng
by KKenny0 Jul 26, 2026 6/10
skill GitHub
A portable toolkit of agent skills designed to work across AI coding harnesses without vendor lock-in.
skillportableharness-agnostic
by paulnsorensen Jul 26, 2026 5/10
skill GitHub
A skill for Claude Code, Cursor, Codex CLI, and Gemini CLI that reduces output token count without degrading grammatical quality — useful for cost-conscious or context-constrained workflows.
skilltoken-efficiencyoutputcost
by DeepakGanapathi97 Jul 26, 2026 7/10
skill GitHub
Agent skills targeting Kotlin Multiplatform with AGP 9.0+ compatibility, MVI architecture patterns, and Material 3 Compose UI.
skillkotlinmultiplatformcompose
by iammohdzaki Jul 26, 2026 5/10
skill GitHub
Agent skills covering the full scientific workflow: topic exploration, literature survey, experiment design, paper writing, and integrity auditing — open-source and aimed at AI for Science use cases.
skillscienceresearchliterature
by ai4s-research Jul 26, 2026 6/10
skill GitHub
A collection of 45 production-grade skills covering system design, DevOps, security, and QA — compatible with Claude Code, Codex, and Antigravity. MIT-licensed.
skillproductiondevopssecurityqa
by CODE-SAURABH Jul 26, 2026 7/10
skill GitHub
Skills covering the hardest production backend concerns: API contracts, cold start optimization, event pipelines, idempotency, rate limiting, resilience patterns, caching strategies, and auth — aimed at staff-engineer-level quality standards.
skillbackendproductionresilienceapi
by tamasbege Jul 26, 2026 8/10
skill GitHub
A collection of proven agent skills covering the full development journey from vague idea to merged pull request.
skillworkflowdevelopmentcontributions
by HelloWorldU Jul 26, 2026 6/10
skill Reddit
A Claude Code skill that defers tasks and automatically launches them when the 5-hour usage window resets. Supports scoped permissions, generates catch-up reports, and handles the common problem of being interrupted mid-task by session limits.
skillsessionschedulinglimits
by pcx_wave Jul 26, 2026 7/10
skill Reddit
A Claude Code skill that edits AI-generated prose by targeting structural patterns — repeated list formats, punctuation pivots, vague attribution, and predictable conclusions — not just swapping out buzzwords. Includes separate German and English editing rules and preserves numbers and uncertainty. MIT-licensed.
skillwritingprosehumanizerediting
by Quick_Cartoonist_441 Jul 26, 2026 7/10
skill GitHub
A curated marketplace of Claude Code plugins covering AI-augmented development and analytical tasks.
skillmarketplacepluginscurated
by synaptiai Jul 26, 2026 6/10
skill GitHub
Analyzes Agent Skills using session data and static analysis to find trigger gaps and weak workflows, then categorizes improvements as P0/P1/P2 fixes.
skilloptimizationstatic-analysisdebugging
by Bennaco7539 Jul 26, 2026 7/10
skill GitHub
Zero-dependency agent skills based on the Algorithms for Decision Making textbook — covering expected utility, multi-armed bandits, robustness analysis, belief filtering, and game theory. SKILL.md format.
skilldecision-makingalgorithmsmath
by romainsimon Jul 26, 2026 6/10
skill GitHub
Reusable slash-command workflows for agent design and LLM pipeline construction, compatible with Claude Code and Runner.
skillagent-designllmpipeline
by BhaveshKhaple Jul 26, 2026 5/10
skill GitHub
Provides curation and transcription skills that turn any AI coding agent harness into a disciplined knowledge-base builder over plain Markdown files.
skillknowledge-basemarkdowncuration
by Criss404 Jul 26, 2026 6/10
skill GitHub
Builds a tailored AI coding harness per project by running a 10-dimension interview, then generating different configurations for Claude Code, Cursor, and Codex.
skillharnessconfigurationsetupclaude-md
by Ecro Jul 26, 2026 7/10
skill GitHub
Covers 12 architecture dimensions including scalability, extensibility, reliability, security, change safety, data architecture, observability, and more. Detects drift between documentation and actual code.
skillarchitecturedebtreviewdocs
by sumeetmi2 Jul 26, 2026 8/10
skill GitHub
Open-source GTM agent skills for technical founders building AI and developer tools — covering positioning, finding first users, launch execution, and pricing strategy.
skillgtmstartuppricinglaunch
by AIDevGTM Jul 26, 2026 6/10
skill GitHub
A pip-installable package of 17,000+ agent skills targeting Claude Code, Cursor, Cline, Aider, Codex, and Antigravity.
skillcollectioncross-vendorpip
by Bilal140202 Jul 26, 2026 5/10
skill Reddit
A small open-source Agent Skill for Claude Code that prompts the model to keep exposed reasoning traces compact — targeting reasoning narration, obvious decision announcements, and prompt repetition. A preliminary run showed 32% fewer reasoning words, though broader quality impact is still being evaluated by the community.
skillreasoningtoken-efficiencycompact
by FlatCarrot3943 Jul 26, 2026 6/10
skill GitHub
A unified rulebook where skills, context, and rules apply equally to Claude Code, Cursor, and Codex, with built-in cross-vendor verification to ensure consistency.
skillcross-vendorrulesverification
by Waqas-Baloch Jul 26, 2026 6/10
skill GitHub
21 portable Claude Code skills organized into two plugins, each skill eval-tested for reliability and correctness before release.
skillevalportabletested
by petermcalister Jul 26, 2026 7/10
skill GitHub
Twenty typography skills extracted from 10 canonical typography books and reconciled against WCAG 2.2 and current browser behavior — providing authoritative typographic guidance for AI coding agents building UIs.
skilltypographywcagaccessibilityui
by jpoindexter Jul 26, 2026 7/10
skill GitHub
Reusable agent skills focused on practical engineering judgment — least code needed, fix the problem, don't break what works. Compatible with Claude Code, Cursor, and Codex.
skillengineeringpragmaticcross-vendor
by sayeed1999 Jul 26, 2026 6/10
skill GitHub
Summarizes a conversation into a recap and continuation prompt for resuming in a new chat, handing off to another person, or archiving. Addresses the common problem of context loss when sessions end.
skillhandoffsummarycontextcontinuation
by itsnormalsaif Jul 26, 2026 7/10
skill Reddit
A practitioner shares key mental models for optimizing Claude Code — understanding the model/hands split, stateless sessions requiring fresh context each turn, and CLAUDE.md as the highest-leverage configuration file. Covers using allow/deny permission lists to reduce babysitting and why session hygiene matters.
CLAUDE.mdpermissionssessionsconfiguration
by Talley-Ho Jul 26, 2026 7/10
skill GitHub
A bilingual handbook introducing Claude Code to social scientists, covering setup and workflows tailored for research use cases.
handbooksocial-sciencebilingual
by OnourImpram Jul 26, 2026 6/10
skill Reddit
A Claude Code skill that requires the agent to explain code in numbered steps (one structural fact per step, dependency order, no jargon, source anchor for every claim) before planning or implementing anything. Prevents vague "trust me" explanations and catches fake understanding hidden behind jargon.
skillunderstandingverificationcode-review
by NotEvenSweaty Jul 26, 2026 8/10
skill GitHub
Claude Code plugin that runs an evidence-based understanding review of your diff before you ship. Advisory mode — never a gate.
diffreviewadvisoryskill
by PsylanL Jul 26, 2026 7/10
skill GitHub
A living reference document mapping the agent skills ecosystem for Claude Code and compatible tools.
skillsreferenceecosystem
by dhk Jul 26, 2026 6/10
skill GitHub
Curated marketplace of 18 plugins and MCP servers for Claude Code and Grok. One-command install.
pluginsmarketplacemcpone-command
by 88plug Jul 26, 2026 6/10
skill GitHub
FDA novel drug approvals and U.S. nonprofit hospital reporting as Parquet/JSON bundles, plus Claude Code skills to query them.
healthcaredataparquetskillsfda
by cbetz Jul 26, 2026 6/10
skill GitHub
A skill that acts as a frontend developer training partner for coding agents, helping practice and improve frontend development patterns.
skillfrontendtraining
by BrettThurs10 Jul 26, 2026 5/10
skill GitHub
Comprehensive Claude Code WSL2 setup guide covering image paste support, desktop notifications, LSP integration, context-saving hooks, and Codex delegation.
wsl2setuphookslspnotifications
by congmnguyen Jul 26, 2026 7/10
skill GitHub
Claude Code skill for generating structured handoff documents that preserve context between sessions for session-to-session continuity.
handoffsessioncontinuityskill
by nanwulan Jul 26, 2026 7/10
skill GitHub
An Arabic-language skills atlas providing Claude Code skills and documentation for Arabic-speaking developers.
arabicskillsatlaslocalization
by unknown Jul 26, 2026 5/10
skill GitHub
Toolkit for building, grading, and scaling cross-agent skill libraries with a tiered Bronze/Silver/Gold quality bar for consistent skill quality.
skillsqualitygradingcross-agenttoolkit
by product-on-purpose Jul 26, 2026 7/10
skill GitHub
Skill that turns ideas into print-style editorial illustrations with a recurring mascot character. Includes 30+ character packs.
illustrationeditorialmascotimage-generationskill
by tmchow Jul 26, 2026 6/10
skill GitHub
48 Tier-2 agent skills compatible with Claude Code, Codex, Cursor, Gemini CLI, Goose, and GitHub Copilot. Install via npx skills add.
skillscross-agentnpxtier-2marketplace
by broomva Jul 26, 2026 7/10
skill GitHub
Declarative skill manager where you declare skills in YAML, pin exact revisions in a lockfile, and install them reproducibly — similar to npm/pip for agent skills.
skill-manageryamllockfilereproducibledeclarative
by byronxlg Jul 26, 2026 8/10
skill GitHub
Claude Code Plugins, Commands, and Skills
skillcommandworkflow
by tony Jul 25, 2026 8/10
skill GitHub
Agent AI skills developed by frua.fr: incus-doc
skill
by fruafr Jul 25, 2026 6/10
skill GitHub
סקירת אבטחת-קוד לפי עשרת הדיברות של רן בר-זיק — a Claude skill for security code review against Ran Bar-Zik's ten commandments
skillcommandreview
by ShachTzu Jul 25, 2026 6/10
skill GitHub
codex and claude skills repo
skill
by sandover Jul 25, 2026 7/10
skill Reddit
I've been using Claude Code since last New Year's, and the biggest frustration early on was inconsistency across sessions. New sessions would make different architectural decisions, use different p...
skillclaude.md
by athletic-knight Jul 25, 2026 10/10
skill Reddit
So I’m sure most of you set hooks because of the ability to trigger automatically and their guaranteed read status. What hooks have you made? What situations do they trigger? Do you chain hooks to ...
skillhook
by CryptoAteMyHamster Jul 25, 2026 7/10
skill GitHub
Agent Skills wrappers for agy, Grok, Claude Code, Codex, Kimi, and Qwen — with cross-CLI parallel spawn
skill
by ImL1s Jul 25, 2026 9/10
skill GitHub
RTL/Persian UI design skill for AI coding agents (Claude Code, Cursor, Codex) — correctness rules, Persian typography recipes, and a zero-dependency violation detector. Agent Skills standard.
skill
by Baghlani Jul 25, 2026 9/10
skill GitHub
Spec-first skills for Claude Code. Turns a rough idea into a technical spec precise enough to build from.
skill
by DahanItamar Jul 25, 2026 8/10
skill GitHub
A Claude skill that turns a folder into a collaboration knowledge base for you, your AI, and your humans
skill
by idea2go2go Jul 25, 2026 6/10
skill GitHub
A capability router for Claude Code — surfaces the most relevant installed skills per prompt via a local hybrid-retrieval hook. Fully local, fail-open.
skillhook
by dmmdea Jul 25, 2026 10/10
skill GitHub
Agent Skills for QalamList self-hosted waitlist software — Cloudflare Workers deploy, D1, Turnstile, doctor checks
skill
by qalamio Jul 25, 2026 6/10
skill GitHub
Agent skills for AI coding agents — trip planner, Obsidian vault, and more
skill
by aliasunder Jul 25, 2026 6/10
skill Reddit
After my previous post about my first impressions with Opus 5 I tried to improve it's reliability. These skills and Claude.md changes seem to be working for me and I hope they might prove useful fo...
skillclaude.md
by ShaneeNishry Jul 25, 2026 8/10
skill GitHub
Claude Code Agent Skill bundle for writing & reviewing academic papers (SSRN / arXiv / Zenodo / journals). Bundles an orchestrator skill, a draft skill, and 5 reviewer subagents — first repo to pac...
skillreview
by shimo4228 Jul 25, 2026 9/10
skill GitHub
Claude Code skill for designing high-converting subscription paywalls — plan structure, anchor pricing, layout, copy, and LTV-based testing
skilltesting
by adrknapp Jul 25, 2026 8/10
skill GitHub
Claude/agent skill: Google News articles as structured JSON. Installs via npx skills add.
skillapi
by johnisanerd Jul 25, 2026 7/10
skill GitHub
Agent skill for Claude Code & Codex: re-render an image under new light, palette or medium with the composition intact. 5 measured recipes, 2 refusals that show you the failed image.
skill
by sjh9714 Jul 25, 2026 9/10
skill GitHub
A Skyrim (SkyrimSE) mod-development template: build mods as text with Spriggit YAML, a command-line Papyrus toolchain, manifest-driven FOMOD packaging, GitHub Actions CI, and Claude Code skills tha...
skillcommandgit
by stefangouldson Jul 25, 2026 8/10
skill GitHub
A SKILL that turns a code diff into an evidence-backed ledger of hidden assumptions, failure modes, and falsification tests.
skill
by Teycir Jul 25, 2026 5/10
skill GitHub
Skill para Claude Code que naturaliza texto en español generado por IA. 11 técnicas lingüísticas orientadas a calidad editorial, no a evasión de detectores.
skill
by dorelysm Jul 25, 2026 8/10
skill GitHub
Zero-hallucination Claude Code skills for ROS 2 Jazzy — routes to official docs and verifies against the real robot instead of guessing APIs from memory.
skillapi
by Leehyunbin0131 Jul 25, 2026 8/10
skill GitHub
Evidence-first UI alignment audit skill for AI coding agents (Claude Code / Cursor / Codex): real rendered evidence, typed findings, interactive A/B acceptance — without touching product code.
skill
by Octo-o-o-o Jul 25, 2026 9/10
skill GitHub
🇰🇷 400+ Korean AI Coding Agent Skills — Claude Code, Gemini CLI, Codex, Cursor 스킬을 기능별로 모은 큐레이션
skill
by J-nowcow Jul 25, 2026 9/10
skill GitHub
Installable agent skills and plugin-ready workflows for coding agents
skillworkflow
by Vivswan Jul 25, 2026 6/10
skill GitHub
Find and reversibly quarantine stale AI-agent markdown artifacts (PLAN.md, SUMMARY.md, handoff docs). Zero-dep single-file CLI + Claude Code skill.
skill
by szp2005 Jul 25, 2026 9/10
skill GitHub
Two Claude Skills for natural-sounding writing (Persian & English) — catches AI-writing tells like generic praise, formulaic structure, and vague attribution
skill
by White-Wolf-dv Jul 25, 2026 6/10
skill Reddit
Hey, long time listener first time caller. I'm running into a problem that I know we've all faced but it's getting much worse, Claude instances are using chat as a scratch pad for every random thin...
skillworkflow
by SnooblesIRL Jul 25, 2026 6/10
skill GitHub
Run Claude Code as a teammate that owns work end to end. A maintained CLAUDE.md (works as AGENTS.md) plus a plan/execute/review skill pipeline with external verification, adversarial review, and st...
skillclaude.mdreview
by makieali Jul 25, 2026 10/10
skill GitHub
Turn your data team's tribal knowledge into a governed context skill your AI agents (Claude, Cursor) load before answering data questions. Local-first, no telemetry.
skill
by nimrodfisher Jul 25, 2026 7/10
skill GitHub
Chinese-first Agent Skills for Codex, Claude Code, and coding workflows
skillworkflow
by Basic-XYZ Jul 25, 2026 9/10
skill GitHub
Open-source Agent Skills for safe, evidence-based software delivery
skill
by RayJason Jul 25, 2026 6/10
skill GitHub
A small Claude Code marketplace: ado, swift-concurrency, modern-swift, go-dev, worktrees.
skill
by pszypowicz Jul 25, 2026 8/10
skill GitHub
Claude Code skill to design, scaffold, and review modern Java Spring Boot microservices (Spring Boot 4.x / Java 25 LTS). Installable as a plugin marketplace.
skillreview
by gauravs19 Jul 25, 2026 8/10
skill GitHub
Skills for coding agents: engineering review, loop referee, skill auditor, unclebob. One SKILL.md per skill. Copy a folder and it works in Claude Code, Codex, or Cursor.
skillreview
by brenbuilds1 Jul 25, 2026 9/10
skill GitHub
Unattended DAG-parallel implementation workflow for Claude Code — builds the ticket DAG, implements each layer in parallel worktrees behind hard test gates, lands on an integration branch + draft P...
skillworkflow
by liumingjian Jul 25, 2026 8/10
skill GitHub
Dual-runtime Agent Skills for Claude Code, Codex GPT, CC Switch, and authorized CTF workflows.
skillworkflow
by download4you Jul 25, 2026 9/10
skill GitHub
Public base configs for Claude Code (skills, commands, agents) -- a working ccs payload repo. Content arriving via curation.
skillcommandconfig
by DazzleML Jul 25, 2026 10/10
skill GitHub
Your AI coding agent says "done" — this Claude Code skill makes it prove it. Execution discipline for Claude and any LLM agent: verify before reporting done, evidence-grounded reports, calibrated a...
skill
by unclecatvn Jul 25, 2026 9/10
skill GitHub
A session-based working method for coding agents: plan in thin complete slices, build one at a time, verify by observing real behaviour, hand off cleanly. Skills + agents + 2 hooks for Claude Code.
skillhook
by cbdreamer11 Jul 25, 2026 10/10
skill Reddit
I’ve been working for someone who’s looking to create a dashboard that has all of their sales management data in one spot pulling from stripe, gohighlevel, meta and google ads. There’s many other A...
skillapi
by sndjsowmmwweisi Jul 25, 2026 6/10
skill GitHub
An agent skill for detecting, preventing, and removing generic AI-looking web design patterns.
skill
by wpgaurav Jul 25, 2026 6/10
skill GitHub
A stack of skills for your AI agent, made for people starting from zero. 103 skills and 149 project briefs — load one into Codex, Claude Code, Copilot, Gemini, or Cursor and do the thing.
skill
by protosphinx Jul 25, 2026 9/10
skill GitHub
Agent skills for administering a real UniFi network over its local API: auth, zone firewall, Wi-Fi, clients, and the site map.
skillapi
by t3chnaztea Jul 25, 2026 6/10
skill GitHub
Growth Agent — open-source skills that turn the AI you already use into a growth partner for your business, powered by Earth Care Network
skill
by Giving-Back-Studio Jul 25, 2026 6/10
skill GitHub
Optimize GitHub repos into high-converting landing pages in one command
skillcommandgit
by inquisitive-production852 Jul 25, 2026 5/10
skill GitHub
Production-grade scaffold for reproducible computational research — 10-stage DAG pipelines, ≥90% test coverage, cryptographic provenance (SHA-256 + steganographic PDF watermarking), multi-project w...
skill
by docxology Jul 25, 2026 6/10
skill GitHub
タスクごとに最適な Claude モデルと effort を提案し、そのモデル向けに最適化したプロンプトを渡す Claude Code skill。
skill
by kazuyakurashima Jul 25, 2026 8/10
skill GitHub
Generate clean 2D game sprites & animation atlases — component-row pipeline: state rows, alpha cleanup, frame extraction, runtime atlases. Codex/Claude skill.
skill
by aldegad Jul 25, 2026 6/10
skill GitHub
Elite art-direction skills for Claude Code — design direction, OKLCH color, typography, motion, structured critique, and frame-rate craft. Any medium, any stack.
skill
by jangles-byte Jul 24, 2026 8/10
skill Reddit
submitted by /u/yxa9446 [link] [comments]
skill
by yxa9446 Jul 24, 2026 8/10
skill GitHub
true-skills:
skill
by katalon-labs Jul 24, 2026 5/10
skill GitHub
Agent memory over an Obsidian vault — bash + ripgrep, no database. A restricted-TOML vault registry, a curated Agent Index, a wikilink graph, and a Projects→Sessions lifecycle. Ships the vaultmem C...
skill
by jayantak Jul 24, 2026 9/10
skill GitHub
A portable Claude skill: give it a goal, get back a reviewable design document for the harness around whatever LLM executes it — context, tools, guardrails, verification loop, and executor topology...
skillreview
by mightykevster Jul 24, 2026 6/10
skill GitHub
86 the dishes losing you money — a chef-built menu-engineering skill pack for Claude Code (menu-doctor, food-cost, recipe-scaler).
skill
by latent-9 Jul 24, 2026 8/10
skill GitHub
DeepSeek destekli Claude Code'u delege işçi olarak çalıştıran Claude Code plugin (marketplace + skill + komutlar)
skill
by rbinar Jul 24, 2026 8/10
skill GitHub
Agents don’t behave, they swarm. Skills and plugins slot in mid flight, and somehow the whole thing is a mess
skill
by widnyana Jul 24, 2026 6/10
skill GitHub
Shared Claude Code skills and agents for consistent development workflows across projects.
skillworkflow
by nolte Jul 24, 2026 9/10
skill GitHub
A Claude Code skill for generating forms where users always know what to fill, what's required, and why they can't continue — no redundant entry, no irrelevant fields.
skill
by HAAAgency Jul 24, 2026 8/10
skill GitHub
Yoda-styled coding mentor skill for Claude Code — anti-pattern detection, 5-Whys onboarding, Pareto triage
skill
by Shavy72 Jul 24, 2026 8/10
skill GitHub
Agent skills for Claude Code where every entry ships with receipts: accuracy-gated benchmarks vs baseline AND placebo. Rejects published.
skill
by sjh9714 Jul 24, 2026 9/10
skill GitHub
The Revenant packs marketplace — Agent Skills packs for Claude. foundation: eight standalone smiths that build, audit, and ship AI-agent artifacts. Always comes back.
skill
by revenantworks Jul 24, 2026 7/10
skill GitHub
Open-source, self-hosted Claude Code - a terminal AI assistant and the Python framework behind it. Tool-calling, sandboxed execution, multi-agent teams, skills, checkpoints, unlimited context - on ...
skillpython
by vstorm-co Jul 24, 2026 9/10
skill GitHub
Production-grade Agent Skills for GeoAI and geospatial data science—remote sensing, spatial statistics, PostGIS, Earth Engine, LiDAR, routing, and reproducible ML.
skill
by muend Jul 24, 2026 6/10
skill GitHub
Automate the evolution and optimization of Hermes Agent’s prompts, skills, and code using genetic algorithms without GPU training.
skill
by Ephesian-kingpost533 Jul 24, 2026 6/10
skill Reddit
I see one of these posts on my feed literally every day. 1) they’re probably bots 2) if they’re not bots then it’s a skill issue submitted by /u/LivingFrosting6680 [link] [comments]
skill
by LivingFrosting6680 Jul 24, 2026 5/10
skill GitHub
Ensure the user is learning about the code being generated with AI tools
skill
by brandon-haugen Jul 24, 2026 5/10
skill Reddit
I need to generate thousands of descriptions (product/location listings, multiple languages) and want them to read naturally, not "AI-vibe". Would love real workflows from anyone who's done bulk co...
skillworkflow
by uebb Jul 24, 2026 5/10
skill GitHub
Six Claude Code skills (architect, review-swarm, ask-the-council, prompt-generator, up-to-date, ponytail) bundled as an installable plugin.
skillreview
by alonbaron Jul 24, 2026 8/10
skill Reddit
AI engineering is moving toward loops, graphs, harnesses, skills, memory, and agent fleets. I wrote a practical breakdown of how these layers combine—and when each one earns its complexity. https:/...
skill
by ivasuy Jul 24, 2026 6/10
skill GitHub
iEvo — self-evolving plugin for Claude Code. Capture lessons, patch local agents and skills, replay logs on upstream updates.
skill
by ievo-ai Jul 24, 2026 9/10
skill Reddit
Hey guys wanted to check if self improvement loops for your setup skills, agents, project instructions actually work? I have a feeling this is a risk for garbage piling up - the How does one do it ...
skill
by Safe-Analysis-5804 Jul 24, 2026 7/10
skill GitHub
DotNet Episteme Skills - a curated, manual-first .NET AI skills library rooted in systematic knowledge (episteme) and shaped by disciplined craft (techne), designed for engineers who prioritise pre...
skill
by Metalnib Jul 24, 2026 5/10
skill GitHub
Claude Code plugin — manage and diagnose EasyPanel services via Playwright and the trpc API
skillapi
by rodrigopg Jul 24, 2026 8/10
skill GitHub
Claude Code plugin — protect GitHub branches against direct pushes: native protection (paid plans) or GitHub Actions workaround (free)
skillgit
by rodrigopg Jul 24, 2026 8/10
skill GitHub
An agent that builds, plays, and verifies its own game ? a colony-sim prototype gated by 15-scenario input-level repro tests + isolated-grader rubric verdicts ? plus production media skills: music-...
skill
by MelonS Jul 24, 2026 6/10
skill GitHub
AI 寫作痕跡清除技能,台灣在地強化版。涵蓋 46 種模式,含中國用語偵測、中文標點保護、語域對照,可用於任何支援 skill 的 agent。
skill
by nagameTW Jul 24, 2026 6/10
skill GitHub
Free Fair-Housing-compliant Claude skills for real estate agents: listing copy, MLS integration with Claude Code, compliance, quick-start. By Al & Victoria Pinder.
skill
by TheProsperityAgent Jul 24, 2026 9/10
skill GitHub
A package manager for agent tooling: meld git repos of skills, agents, rules, and tools into Claude Code, Gemini, and Codex
skillgit
by jaemk Jul 24, 2026 9/10
skill GitHub
Per-project skill manager for Claude Code. Organize hundreds of skills into domain profiles, load only what each session needs. Stops context bloat. Zero-dep bash TUI.
skill
by grooverLab Jul 24, 2026 8/10
skill GitHub
Execution blueprints and code templates for fitting genomic prediction models, including GBLUP, GFBLUP, MultiBLUP, Bayesian methods (BayesA, BayesB, BayesC, BayesCpi, BayesRC, Bayesian Lasso), and ...
skillreview
by scicrow Jul 24, 2026 5/10
skill GitHub
A Claude Code plugin for reselling secondhand items — live eBay pricing, buyer-optimized photo order, and ready-to-post Facebook Marketplace & eBay listings.
skill
by hansohn Jul 24, 2026 8/10
skill GitHub
Skill: 把密集 Markdown 重构为认知降维的工业级 HTML 文档(3 秒/30 秒/3 分钟原则 + 6 类信息分层 + 13 条反模式)
skill
by beihai23 Jul 24, 2026 5/10
skill GitHub
Private, local-first second brain for AI agents, with shared memory and governed skills across Claude Code, Codex, and your Tailnet.
skill
by Chulinuwu Jul 24, 2026 9/10
skill GitHub
Muzi Going 的 Claude skills 商店 — Claude Code plugin marketplace
skill
by goingli0324 Jul 24, 2026 8/10
skill GitHub
Claude skill: 未來學研究方法分析器 — turn qualitative & trend data into rigorous futures-studies analysis (Six Pillars, Delphi, CLA, scenario planning, futures triangle/wheel, backcasting and more)
skill
by goingli0324 Jul 24, 2026 6/10
skill GitHub
Compare multiple skills on the same task and pick the winner.
skill
by Jayden-X-L Jul 24, 2026 5/10
skill GitHub
基于 13 本投资经典的 AI 辅助投资决策系统,覆盖大盘扫描/行业跟踪/组合复盘/深度研究
skill
by lj22503 Jul 24, 2026 5/10
skill GitHub
Claude Code skills for plain-language explanations and other output-reshaping patterns
skillapi
by gitsukrit Jul 24, 2026 8/10
skill GitHub
Whine, cringe, protect — emotional feedback channels for AI agents. One finding per channel at the end of substantial work. The practice Ansvar runs on its own agents, as portable Claude Code / cla...
skill
by Ansvar-Systems Jul 24, 2026 9/10
skill GitHub
叙事方法论工具箱:故事思维 × 叙事原子 × 品牌故事 | 20+叙事Skill / 模板 / 案例库
skill
by lj22503 Jul 24, 2026 5/10
skill GitHub
Neo Skills 是專為現代 AI Agent 設計的全方位能力擴充套件。本專案透過標準化的通訊架構,為 AI 代理安裝可插拔的「技能模組 (Skills)」,使其不僅僅是一個聊天機器人,而是能轉化為具備「感知-推理-行動」能力的多領域專家。
skill
by Benknightdark Jul 24, 2026 6/10
skill GitHub
Creative coding skills for Claude Code: animations, 3D, design systems, motion principles
skill
by AThevon Jul 24, 2026 8/10
skill GitHub
🦀📚 A learn-by-doing Rust workspace — pick a concept, get a ladder of 7-9 problems (easy → mastery), and implement each one yourself with staged hints, never handed the solution. Powered by a custom...
skill
by utkarsh5026 Jul 24, 2026 5/10
skill GitHub
Style gate for marketing and web copy: every claim states a feature, a number, or a mechanism. Agent skill (Claude Code / Codex / Cursor) + deterministic linter covering 9 languages + CI hook.
skillhook
by HiroHyun Jul 24, 2026 10/10
skill Reddit
I think I explained Tastemaker badly in some of my earlier posts, because a few people assumed I was trying to build something that replaces designers. That is not the goal. Tastemaker is for peopl...
skill
by Codes_with_roh Jul 24, 2026 8/10
skill Reddit
Why can’t I use auto mode on haiku? Back when I was on codex I would use 5.5 for most coding work but any smaller skill based workflows like small sql requests or writing Jira cards I would use 5.4...
skillworkflowtestingreview
by YaBoiLeeDawg Jul 24, 2026 8/10
skill GitHub
Source-aware architecture guidance for business-domain systems using Domain-Driven Design, Layered Architecture, Onion Architecture, Hexagonal Architecture / Ports and Adapters, and CQRS.
skill
by xfoundries Jul 24, 2026 5/10
skill GitHub
skill-compress:
skill
by xiaowu89 Jul 24, 2026 5/10
skill GitHub
A skillet full of agent skills that actually ship work. Production-tested SKILL.md workflows for audits, security, releases, and handoffs.
skillworkflow
by escoffier-labs Jul 24, 2026 6/10
skill GitHub
Software Development Skills — staged dev-flow, 1-issue-1-lane lifecycle, and event-driven fleet supervision for Claude Code and Codex agents
skill
by reoring Jul 24, 2026 9/10
skill GitHub
面向零基础转岗与市场新人的营销 Agent Skill:分析营销案例、训练面试表达、生成图文报告和营销方案。
skill
by susuyiyi7-droid Jul 24, 2026 6/10
skill GitHub
Self-evolving Claude Code workflow kit — 44 skills, 22 agents, 29 hooks. /plugin install vibe-flow. Karpathy principles, TDD strict, audit cycle 3.0→4.53/5.
skillhookworkflow
by SONGYEONGSIN Jul 24, 2026 10/10
skill GitHub
Ask Me by Mew Social — Thai-first Agent Skill ที่ถามทีละข้อจนได้ Working Brief พร้อมใช้ รองรับ Cowork, Claude Code, ChatGPT Work, Codex, OpenClaw, Hermes และ CLI
skill
by mewic Jul 24, 2026 9/10
skill GitHub
skill-function:
skill
by xiaowu89 Jul 24, 2026 5/10
skill Reddit
Skills are all over the place so I built a repository where you can host skills, curate skills, share. It even comes with a cli for your agent to use. Hopefully it will self rank so best ones raise...
skilltesting
by Negative_Leave5161 Jul 24, 2026 7/10
skill GitHub
🛠️ My macOS development environment — Zsh, Tmux, Vim, Git, Starship, Alacritty, Ghostty, VS Code, Claude Code, AI Skills Manager and more.
skillgit
by unix2dos Jul 24, 2026 8/10
skill GitHub
Agent skills for VillageSQL - gemini-cli-extension; claude-code-plugin
skill
by villagesql Jul 24, 2026 9/10
skill GitHub
Hook, skill, and CLI script for agents to take screenshots and visually check their work
skillhook
by mickzijdel Jul 24, 2026 8/10
skill GitHub
Agent tools and skills to read docx/xlsx/pdfs
skill
by mickzijdel Jul 24, 2026 6/10
skill GitHub
Airtable Scripting agent skill and tools for schema dump, schema diff, and user check
skill
by mickzijdel Jul 24, 2026 6/10
skill GitHub
Research-first scouting agent skill for dependency, API, SaaS, prior-art, and build-versus-buy decisions before writing code.
skillapi
by fahrellgiovanny Jul 24, 2026 6/10
skill GitHub
Build UX and design skills for AI agents to improve research, heuristics, and design decisions in Claude Code, Cursor, and Codex
skill
by justinqwerty Jul 24, 2026 9/10
skill Reddit
I've got Claude Code running a personal project in unattended blocks via a scheduled/cron task (i am relative newbie to claude code but have some programming experience in a past life) — every few ...
git
by Escobar747 Jul 24, 2026 7/10
skill Reddit
Hi, What's the best skill for Claude code with Unity? I've checked a few skills on skills.sh and they're basically wrappers for "use best practices, you're a skilled programmer". I'm looking for ma...
skill
by game-dev2 Jul 24, 2026 8/10
skill GitHub
13 Claude Code skills + 1 hook: full engineering discipline (TDD, root-cause debugging, verification) with zero narration. Measured, not imagined.
skillhook
by StarchyBomb Jul 24, 2026 10/10
skill GitHub
Agency-grade full-stack website skills for coding agents — kills the default AI look. framer-motion motion, shadcn components, Supabase + Vercel deploy. 8 art directions.
skill
by StarchyBomb Jul 24, 2026 6/10
skill GitHub
Claude skill: PDCA 流程檢視 — apply the Deming cycle to review and improve any recurring process, with honest evidence-based Check and standardize-or-adjust Act
skillreview
by goingli0324 Jul 24, 2026 6/10
skill GitHub
Claude Code + Codex skill that roasts your repo's design system with real data. A deterministic scanner counts every colour, spacing value and duplicated component, benchmarks you against 27 public...
skill
by pencilrebel Jul 24, 2026 8/10
skill GitHub
Drop-in Agent Skills, subagents, output styles, hooks & config templates for Claude Code (~/.claude) and OpenAI Codex CLI (~/.codex). Copy, restart, done.
skillhookconfig
by dayfinggg Jul 23, 2026 10/10
skill GitHub
Proof repo: a commerce API with atomic checkout battle-testing the rust-fp-skill — axum + sqlx, 58 tests, architecture enforced by the build
skillapitesting
by mikezupper Jul 23, 2026 5/10
skill GitHub
Claude Code skill: functional, railway-oriented Rust — typed error tracks, illegal states unrepresentable, parse-don't-validate, architecture enforced by cargo
skill
by mikezupper Jul 23, 2026 8/10
skill GitHub
Bootstraps PHARN into your project. npx pharn init to set up your stack, pharn add to install modules later, pharn update to bump skill versions. Targets Claude Code today; Codex and Cursor next.
skill
by pharn-dev Jul 23, 2026 8/10
skill GitHub
アジャイル/スクラムの規律を、AIとの協働に適用する — Claude Code / Agent Skills を活用したAI駆動開発(AIDD)の実践ガイド
skill
by mryo0826 Jul 23, 2026 9/10
skill GitHub
Claude Code skills for managing multi-step tasks as GitHub issues. Create, implement, update, and close execution plans that survive across sessions.
skillgit
by gjoranv Jul 23, 2026 8/10
skill GitHub
Portable SKILL.md library for Claude Code, Codex-compatible agents, BACH, and local-first LLM workflows
skillworkflow
by ellmos-ai Jul 23, 2026 9/10
skill GitHub
A Claude Code skill for visual, coaching-first DSA learning.
skill
by swapnil5053 Jul 23, 2026 8/10
skill GitHub
Skills from a working AI operating system. Five layers you own: Constitution, Memory, Skills, Tools, Focus.
skill
by arete-aios Jul 23, 2026 5/10
skill Reddit
I've build a series of different skills, and after the first iteration I'm trying to think of ways I can improve. One obvious way is to improve how long the skill file is because I don't want it ho...
skillapi
by StrikingSkill573 Jul 23, 2026 5/10
skill GitHub
Privacy-first Codex skill for building explicit assistant preference configs across Codex, Claude Code, Cursor, and Gemini.
skillconfig
by stannum2 Jul 23, 2026 9/10
skill GitHub
Composer plugin enabling universal Agent Skill distribution and management for PHP projects
skill
by netresearch Jul 23, 2026 6/10
skill GitHub
Skill do Claude Code para a API do Asaas: cobrancas, Pix, split, subcontas (BaaS), webhooks e transferencias. Documentacao oficial completa navegavel sem estourar o contexto.
skillhookapi
by augustotecnos Jul 23, 2026 10/10
skill GitHub
Agent skills, 15 original character cards and a calibrated AI-flavor detector for roleplay card authors. Skills run in Claude Code / Cursor / Codex / Gemini CLI; cards import into SillyTavern and F...
skill
by foreverse-app Jul 23, 2026 9/10
skill GitHub
Custom agent skills for GitHub Copilot & Claude Code, from Microsoft-ecosystem dev experience (Azure, .NET, M365, Graph).
skillgit
by ericsche Jul 23, 2026 9/10
skill GitHub
Agent skills for Claude Code and other coding agents
skill
by Enverge-Labs Jul 23, 2026 9/10
skill GitHub
Taste-Skill - gives your AI good taste. stops the AI from generating boring, generic slop
skill
by Leonxlnx Jul 23, 2026 5/10
skill GitHub
394 free, quality-tested Claude skills for TV producers, journalists, podcasters, YouTubers & media professionals.
skill
by ur-grue Jul 23, 2026 6/10
skill GitHub
A collection of custom skills for my workflows with AI-agents
skillworkflow
by denysdovhan Jul 23, 2026 6/10
skill GitHub
Open-source Claude Code skills from the Cornell AI Hub. Grounded web search via Gemini, more coming.
skill
by cu-aaii Jul 23, 2026 8/10
skill GitHub
Agent Skills for NVIDIA products — install into Claude Code, Codex, and other coding agents to run Physical AI, robotics, simulation, CUDA, and RAG workflows end to end.
skillworkflow
by NVIDIA Jul 23, 2026 9/10
skill GitHub
The FlowLeap Plugin Marketplace — curated, free-to-install skill packs for patent and IP work.
skill
by abdullahatrash Jul 23, 2026 5/10
skill GitHub
Reusable agent skills for AI coding assistants—senior-level planning, architecture, auditing, optimization, implementation, and diagramming.
skill
by akshay-diwadkar Jul 23, 2026 6/10
skill GitHub
Learn the thing, don't paste it. A Claude Code skill that guides but never implements: "if you could paste what Claude wrote and have the task done, it wrote too much."
skill
by melsayedx Jul 23, 2026 8/10
skill GitHub
13 Claude Code skills for video production (transcribe / translate / dub / multicam / subtitles / reframe) + WeChat publishing. Compatible with Claude Code, OpenAI Codex CLI, Cursor, Gemini.
skill
by jianshuo Jul 23, 2026 8/10
skill GitHub
AI skills for content creation, SEO, advertising, image prompting, and strategy. Works standalone with Claude Code — works better with Genfeed.ai. Install: bunx skills add genfeedai/skills
skill
by genfeedai Jul 23, 2026 8/10
skill GitHub
Agent skills for agentic coding tools. Extremely opinionated. Updated (almost) daily.
skill
by JHostalek Jul 23, 2026 7/10
skill GitHub
Claude Code skills for auditing, managing, and improving GitHub repositories
skillgit
by Atypical-Consulting Jul 23, 2026 8/10
skill Reddit
I implement a feature and review (skill or plugin) a several times my code. It finds a lot of issues again and again and it just gets more code. I finally push to gitlab merge request and the revie...
skillgitreview
by Strawberry7352 Jul 23, 2026 5/10
skill GitHub
The Agent Skill for cross-browser extension development. Teaches AI coding agents to build, debug, and publish for Chrome, Edge, Firefox, Safari, and every Chromium- or Gecko-based browser.
skill
by extensiondev Jul 23, 2026 6/10
skill GitHub
八字排盘与解读 Claude skill — 精确排盘交给代码(lunar-python)、解读交给模型:节气到分钟、真太阳时校正、临界预警、子平法方法论知识库
skillpython
by ruthless-coder-ai Jul 23, 2026 6/10
skill GitHub
Ancient Chinese fortune telling (BaZi / Four Pillars of Destiny) as a Claude skill — exact chart calculation to the minute (solar terms, true solar time, DST), plain-English readings with zero-jarg...
skill
by ruthless-coder-ai Jul 23, 2026 6/10
skill GitHub
20 power-user skills for Claude Code: session memory and consolidation, context compression, multi-agent orchestration, adversarial bug hunting, security review, calibrated estimation and decision ...
skillreview
by irfad7 Jul 23, 2026 9/10
skill GitHub
Reusable GenAI engineering patterns, skills, and guardrails for any AI coding tool
skill
by AshrafDurjoy Jul 23, 2026 5/10
skill GitHub
Curated Claude Code skills that fight the AI-generated look — anti-generic-ui design rules + 100 CSS micro-interactions. Make front-end UI feel intentional, not cookie-cutter.
skill
by h3nryprod01 Jul 23, 2026 8/10
skill GitHub
Seedance 2.0 Shot Design Skills
skill
by woodfantasy Jul 23, 2026 5/10
skill GitHub
claude-skill-wake-sleep:
skill
by colinzyang Jul 23, 2026 6/10
skill GitHub
AI film director skills for Claude agents: cinematic dramaturgy (Murch, blocking, montage) + exact prompt syntax for Seedance 2.5, Kling 3.0 Turbo/Omni, Veo 3.1, Nano Banana 2, GPT Image 2. Claude ...
skill
by smixs Jul 23, 2026 9/10
skill GitHub
Agent Skills for buying & selling APIs, data, and compute over Bitcoin Lightning, agent-to-agent — non-custodial, accountless, settled by preimage. Works in Claude, Cursor, Codex, Hermes & ClawHub.
skillapi
by hypawave Jul 23, 2026 7/10
skill Reddit
Opus 4.8 has terrible context management it loses the thread of conversation, doesn't do what you actually asked, wastes tokens, and produces walls of text instead of getting the job done. Opus 4...
skill
by Big-Reason-2976 Jul 23, 2026 7/10
skill Reddit
Hey. I'm new to Claude Code, coming from Antigravity and Gemini models. Is there any advice, tips, or skills I should know about to ensure good rate limits, and overall experience? I'm a beginner, ...
skill
by Primatronus Jul 23, 2026 8/10
skill GitHub
Agent-Skills fuer Claude Code — bijektiver Spezifikationsvergleich und mehr
skill
by Xindaan Jul 23, 2026 9/10
skill GitHub
A toolkit of reusable agentic skills for AI agent development.
skill
by tejasashinde Jul 23, 2026 6/10
skill Reddit
I have recently been burning through my Max 5x plan in about 3 days, even when using skills that delegate tasks to Sonnet and Opus, the plan just doesn't seem to go very far anymore. I was consider...
skill
by Spooknik Jul 23, 2026 5/10
skill Reddit
submitted by /u/lyndon050516 [link] [comments]
skill
by lyndon050516 Jul 23, 2026 5/10
skill GitHub
Capture Douyin links into verified Obsidian knowledge notes with Codex or Claude Code.
skill
by quziwen Jul 23, 2026 8/10
skill GitHub
Claude Code skills purpose-built for Solidity security auditing and protocol research.
skill
by mnedelchev-vn Jul 23, 2026 9/10
skill GitHub
Claude Skills for UI psychology analysis and rapid prototyping
skillapi
by TecCat Jul 23, 2026 6/10
skill GitHub
Curated Seedance 2.5 video prompts (100+ full 30s storyboards, 20 languages) + an installable Agent Skill for controllable storyboard/reference-driven video. Real previews via Atlas Cloud.
skillreview
by AtlasCloudAI Jul 23, 2026 6/10
skill GitHub
One canonical catalog for Skills, Plugins, Hooks, Settings, and Schedules across Codex and Claude Code on Windows and Linux.
skillhookconfig
by ReS0421 Jul 23, 2026 10/10
skill GitHub
Claude Code Skill that turns any idea into a cinematic, model-ready video prompt — Sora · Kling · Veo · Seedance. 21 genre templates, 5-stage structure, eval-tested. Distilled from the AI short Hol...
skill
by jnMetaCode Jul 23, 2026 8/10
skill GitHub
Claude Code skill that explains the mental model behind any technical mechanism — who issues the token, who verifies whom, and why it's designed that way. 点破技术机制背后的信任拓扑。
skill
by jyuwaaw Jul 23, 2026 8/10
skill GitHub
A Claude Code plugin marketplace bundling 12 plugins and 54 skills across PKM, project planning, DevOps, content writing, language, design, and productivity — install with a single command and star...
skillcommand
by natthasath Jul 23, 2026 8/10
skill GitHub
Evidence-backed UX and AI-agent case study skills for Codex and Claude
skill
by jpoindexter Jul 23, 2026 7/10
skill GitHub
Self-evolving skills lib for coding agents
skill
by SkillNerds Jul 23, 2026 6/10
skill GitHub
The open, vendor-neutral toolchain + registry for AI agent skills - scaffold, validate, test, install & publish skills for Claude Code / Cursor / Codex / OpenCode / Cline from one CLI.
skill
by NSBen Jul 23, 2026 9/10
skill GitHub
Claude Code skill: Playwright scenarios as automated tests + video walkthroughs with per-step subtitles, voice narration (ru/en), click highlighting and clean walkthrough screenshots for UX analysi...
skill
by Avatechdir Jul 23, 2026 8/10
skill GitHub
RunAPI Kling skill for Claude Code, Codex, Gemini CLI, Cursor, and 50+ agents
skillapi
by runapi-ai Jul 23, 2026 9/10
skill GitHub
Opinionated engineering pipeline for Claude Code with 10 skills, 5 agents, 2 hooks. Replaces ad-hoc agent sprawl with brainstorm → story → plan → build → review → ship.
skillhookreview
by nicodiansk Jul 23, 2026 10/10
skill GitHub
Claude agent skill that plans multi-step work as a dependency graph. Subagent fan-out, layered fan-in, model tiering, verification retry loops, human approval gates. No framework, just instructions.
skill
by VineeTagarwaL-code Jul 23, 2026 7/10
skill GitHub
Personal Claude Code skills for freelance and product engineering work
skill
by taewanu Jul 23, 2026 8/10
skill GitHub
35 portable agent skills (Agent Skills spec) for Kiro & Claude Code: Scrum DevSecOps roles, PCI-DSS/MAS TRM compliance, AWS Well-Architected reviews — each with evals and a 4-layer tested methodology
skillreview
by timwukp Jul 23, 2026 9/10
skill GitHub
Claude/AI agent skill for assets/images optimization for your web development projects
skill
by pedrovelasquez9 Jul 23, 2026 7/10
skill GitHub
AI code reviews by Elon Musk, Steve Jobs & Linus Torvalds. Three personas debate your code until consensus. Claude Code skill — install in 10 seconds.
skillreview
by Atypical-Consulting Jul 23, 2026 8/10
skill GitHub
AI agent skills for Studio LXD libraries — Claude Code, Cursor, Codex/ChatGPT and generic agents (@studiolxd/scorm, @studiolxd/xapi)
skillapi
by studiolxd Jul 23, 2026 9/10
skill GitHub
A Claude Code workspace template with AI skills for JIRA, PRs, code review, estimation, and daily standups
skillreview
by HsuanYuLee Jul 23, 2026 8/10
skill GitHub
Executable biomedical workflows for AI assistants — literature analysis, biomarker discovery, and Mendelian randomization through reproducible agent skills.
skillworkflow
by Alim430 Jul 23, 2026 6/10
skill GitHub
Five Claude Code skills distilled from a solo consultant's daily practice: plain-language explanations, PRD planning and execution, project bootstrap, safe copy-paste.
skill
by cobuchan Jul 23, 2026 8/10
skill Reddit
I've been using the superpowers skills for writing the specs, plan and executing it via subagent-driven-development. However, the execution time takes about 1 hour. Life seems Life seems much simpl...
skill
by Jealous-Mammoth-5526 Jul 23, 2026 6/10
skill GitHub
A Claude Skill that coaches AI-anxious professionals from anxiety to AI-native — a 6-rung literacy ladder fusing "Open to Work" (LinkedIn) and "Agents, Robots, and Us" (McKinsey).AI 时代职场跃迁教练 S...
skill
by GimboPan Jul 23, 2026 7/10
skill GitHub
本地 AI 能力管理器 — Claude Code / Codex 技能一张表管完:symlink 挂载 · 源式套装 · 内容哈希更新 | Local AI capability manager for Claude Code & Codex
skill
by maojiebc Jul 23, 2026 8/10
skill GitHub
Agent Skills that teach Claude to build Rails 8.1 apps — vanilla-first stack, pure RSpec, Hotwire (Turbo/Stimulus/Native), OpenAPI via rswag, ruby_llm AI, Kamal 2 deploys
skillapi
by fmanimashaun Jul 23, 2026 7/10
skill GitHub
Collection of useful skills, prompts, tools and best practices for engineers when building and working with AI Agents
skill
by d0hx4n2503 Jul 23, 2026 6/10
skill GitHub
System design knowledge for AI coding agents — a Claude Code plugin. 1 skill, 10 commands, 14 self-contained reference files. State the constraint, pick the option, name the tradeoff.
skillcommand
by MKAbuMattar Jul 23, 2026 9/10
skill GitHub
This repository packages 12 Claude Code skills for B2B GTM teams that want to move from isolated AI prompts to a governed workflow. It turns market changes into sourced account research, commercial...
skillworkflow
by forma-norden Jul 23, 2026 10/10
skill GitHub
Agent Skill for building stunning, performant web UIs with modern platform-native CSS — no JS hacks
skill
by mikezupper Jul 23, 2026 6/10
skill GitHub
AndroidX Media3 1.10.1 skill pack for AI coding agents: ExoPlayer migration, Compose player UI, streaming, DRM, ads, analytics, and tests.
skill
by sunnat629 Jul 23, 2026 6/10
skill GitHub
Proof repo: three working apps battle-testing the effect-fp, modern-css, and lit-web-apps Claude Code skills — Effect backends, atomic checkout, Lit SSR storefront
skilltesting
by mikezupper Jul 23, 2026 8/10
skill GitHub
Production Postgres survival skills for Claude Code — schema design, safe migrations, query performance, connection pooling, autovacuum/bloat, and queue/partitioning patterns.
skill
by pumarogie Jul 23, 2026 8/10
skill Reddit
I made a Claude Code skill for the "show me a couple versions of this screen" case. It's intended for use before coding, but you can invoke it any time you want to see a set of options that help vi...
skillapigitreview
by tribat Jul 23, 2026 9/10
skill GitHub
Evidence-preserving multilingual review-and-rewrite skill for AI agents
skillreview
by songhai-dg Jul 23, 2026 6/10
skill GitHub
An orientation protocol for LLM sessions — plus a curated Claude skills collection
skill
by JustMichael-80 Jul 23, 2026 6/10
skill GitHub
A governed AI organization for Claude Code — a 24-agent development team + a 12-seat executive advisory council, with shared skills (Excellence Pass, research-integrity, gate reviews). Install via ...
skillreview
by BlackRaptorAI Jul 23, 2026 9/10
skill Reddit
How do you approach understanding new codebases? If you are new to a codebase and you want to understand it better based on existing components, services, controllers and repos (also maybe git log?...
skillgit
by devmaterialized Jul 23, 2026 8/10
skill GitHub
Agent skills for intentional code: clear domain meaning, honest failures, comments that earn their place.
skill
by yakoshiq Jul 23, 2026 6/10
skill GitHub
Forensic Writing Style Analysis & Cloning Claude Skill - Clone an Author tone and style and have Claude code write in that style.
skill
by TABARC-Code Jul 23, 2026 8/10
skill GitHub
Portable AI-engineering skills for Claude Code, Codex, and coding agents: bounded scope, mini-specs, vertical slices, verification, ship gates, and handoff.
skill
by tmusser Jul 23, 2026 9/10
skill GitHub
Claude Code skill for stunning, animation-rich HTML presentations — 88 layout presets + 34 bold templates. Build slides from scratch or convert PowerPoint into a single self-contained HTML file. No...
skill
by dreamid27 Jul 23, 2026 8/10
skill GitHub
Author, scaffold, and debug multi-agent workflows for Claude Code's Workflow tool — a skills-only plugin plus @workflow-toolbox, a compile-time TypeScript pattern library. Research preview.
skillworkflowtypescriptreview
by home-dev-lab Jul 23, 2026 9/10
skill GitHub
🦖Curated Cursor AI agent skills, slash commands, MCP configs, subagents & rules for full-stack dev — React 19, Next.js 15, Supabase, Tailwind v4, TypeScript
mcpskillcommandtypescriptconfig
by kensaurus Jul 23, 2026 8/10
skill GitHub
A coding-agent skill for creating stunning, interactive HTML presentations — from scratch or by converting PowerPoint (`.pptx`) files.
skill
by helloyxs Jul 23, 2026 6/10
skill Reddit
Please respond with objective experience, I'm not looking to fuel judgement. Setting aside "skill issue" entirely as a variable, is it possible the complaints about Fable allotment being used up in...
skill
by KSSLR Jul 23, 2026 8/10
skill GitHub
Quality gates for Claude Code: review-panel, focus-group pretesting, STORM research, extract-approach, and the advisor agent. The foundational skill pack behind an AI-operated multi-business setup.
skilltestingreview
by josherau Jul 23, 2026 10/10
skill GitHub
Personal Claude Code skills — self-orchestrated task execution and more.
skill
by thititongumpun Jul 23, 2026 8/10
skill GitHub
Claude Skills for Perl SDET & Architecture
skill
by nigelhorne Jul 23, 2026 6/10
skill Reddit
This is pretty much all I'm using Fable for anymore. I'm never switching an entire workflow to Fable, and it seems to be working okay. I get the benefits of having a curmudgeonly but very observant...
skillworkflowreview
by kckern Jul 23, 2026 6/10
skill GitHub
Research-first Agent Skill that runs long-horizon paper pipelines with evaluator gates, heartbeat watchdogs, resume controls, and manifest cleanup.
skill
by WdBlink Jul 23, 2026 6/10
skill GitHub
Agent Skills for character LoRA dataset tagging: booru tag auditing (keep/delete/replace with visual verification, dual-character support) and visual-weight prompt ordering. Production prompts of B...
skill
by storyAura Jul 23, 2026 6/10
skill GitHub
A go-to-market operating system for founders without a marketing team. Plug in your project and get specific help - audits, positioning, copy, conversion, launches - from the command line. Built on...
skillcommand
by adaptico Jul 23, 2026 8/10
skill GitHub
Facebook Pages marketing skills for Claude Code and Codex: high-share posts, hooks, engagement replies, and a weekly plan. Publish via Publora. Open source, MIT.
skillhook
by sergebulaev Jul 23, 2026 10/10
skill GitHub
claude-code-docs-skill:
skill
by mehmetbaykar Jul 23, 2026 8/10
skill GitHub
📬 Write investor updates your investors actually read — a Claude Code skill template for founders, by Pitchdrive
skill
by Pitchdrive Jul 23, 2026 8/10
skill GitHub
Copy-paste AI skills for Claude Code, Cursor, and any AI agent: SEO, automation, CRM, and inbox triage. Paste one prompt, your agent sets it up.
skillautomation
by donatassimkus Jul 23, 2026 9/10
skill GitHub
Practical Agent Skills for source-backed research, controlled browser sessions, idea critique, and reliable AI workflows.
skillworkflow
by xonika9 Jul 23, 2026 6/10
skill GitHub
Claude Code skill: five-layer documentation quality standards (ASD-STE100, Google/Microsoft style, ISO 24495, AI readability) with a machine-checkable lint gate
skill
by JuanMarchetto Jul 23, 2026 8/10
skill GitHub
Claude Code skills for non-technical founders, solopreneurs & one-person companies running an AI engineering team — no coding experience required. Six battle-tested skills + a real token-burn postm...
skill
by lightarktech Jul 23, 2026 8/10
skill GitHub
Hooks, rules, skills, and instructions for use with Claude Code
skillhook
by chancegraff Jul 23, 2026 10/10
skill GitHub
Zuvo plugin marketplace for Claude Code. 49 skills, 26 agents.
skill
by greglas75 Jul 23, 2026 9/10
skill GitHub
Auto-activating, multi-agent skill ecosystem for Claude Code, Codex, and Cursor. 51 skills, 26 agents, quality gates, knowledge store, adversarial review, content writing & optimization.
skillreview
by greglas75 Jul 23, 2026 9/10
skill GitHub
An action-first AI skill for work, research, life, and every tab you forgot was open.
skill
by zgbrenner Jul 23, 2026 5/10
skill GitHub
Claude Code skill: turn a keyword into presentation-ready PNG icons — 3 concepts, 1:1, transparent, recolorable
skill
by ruthless-coder-ai Jul 23, 2026 8/10
skill Reddit
i haven't even finished testing one feature and they’ve already dropped four more. managed agents, ios simulator, screen recording agent skills, security scanner... slow down guys i'm not an ai (ye...
skilltesting
by Several-Lemon-3381 Jul 23, 2026 7/10
skill GitHub
Production-grade Agent Skills from Evil Martians — drop-in expertise for your AI coding agent
skill
by evilmartians Jul 23, 2026 6/10
skill GitHub
Evidence-first bilingual patent disclosure workflow for engineering teams and patent professionals
skillworkflow
by soarsky1991 Jul 22, 2026 5/10
skill GitHub
Claude Code skills for sales, marketing, and GTM — CRM, outbound, note-takers, enrichment, email marketing, influencer marketing, social listening, directories, and more. Install: npx skills add ...
skill
by sales-skills Jul 22, 2026 8/10
skill GitHub
Claude skill: turn your current conversation into a complete handoff document so any LLM can pick up exactly where you left off
skill
by ToolMonsters Jul 22, 2026 6/10
skill GitHub
A skill for trying to disprove theories and fixes.
skill
by Lum1104 Jul 22, 2026 5/10
skill GitHub
A skill for proving the feature works—not just the tests.
skill
by Lum1104 Jul 22, 2026 5/10
skill GitHub
A skill for pausing before high-risk changes.
skill
by Lum1104 Jul 22, 2026 5/10
skill GitHub
A skill for predicting before changing code.
skill
by Lum1104 Jul 22, 2026 5/10
skill GitHub
A skill for reading Git history before changing old code.
skillgit
by Lum1104 Jul 22, 2026 5/10
skill GitHub
Claude Code skill for pressure-testing consequential decisions: five independent advisers, anonymous peer review, independent synthesis.
skilltestingreview
by dandanmarcovici Jul 22, 2026 8/10
skill GitHub
My personal collection of AI agent skills; the *kit family. Portable, one install away.
skill
by mimukit Jul 22, 2026 6/10
skill GitHub
Sharpen the axe before cutting wood - fool-proof requirement clarification skill for AI agents (Claude Code / Cursor / any LLM)
skill
by LucioLiu Jul 22, 2026 9/10
skill GitHub
Teach your AI agent to acquire capabilities on its own - find existing skills before building one (Claude Code / any LLM)
skill
by LucioLiu Jul 22, 2026 9/10
skill GitHub
分级开发工作流路由(L0–L4)的 Claude Code / Codex / Cursor 插件:判级加固、跨 session 续行、跨项目自主进化、codegraph 判级集成。skill 命令 /dev-workflow。
skillworkflow
by whrjunluo Jul 22, 2026 8/10
skill GitHub
Agent skill for authoring production jsonspecs rule packages
skill
by jsonspecs Jul 22, 2026 6/10
skill GitHub
Agent Skills 技能集合,将各领域经验打包为可复用的 AI 能力 | A collection of Agent Skills that turn AI agents into reusable domain experts.
skill
by xiehuacheng Jul 22, 2026 6/10
skill Reddit
Did someone test this? submitted by /u/Due-Cup9574 [link] [comments]
skill
by Due-Cup9574 Jul 22, 2026 8/10
skill GitHub
Public agent skill for display.dev — publish HTML or Markdown behind company auth from your AI assistant. Works across Claude Code, Cursor, Codex, OpenCode, Hermes, Pi, and OpenClaw.
skill
by display-dev Jul 22, 2026 9/10
skill GitHub
A Claude Code skill that writes consistent onboarding docs — README, wiki, contributing, security — for any repository, and cuts versioned releases with a changelog, tag, and GitHub release.
skillgit
by tjdwls101010 Jul 22, 2026 8/10
skill GitHub
Pre-code crucible, a Claude Code skill (/bastion) that interrogates your plan against the Developer Vault before you write code.
skill
by tolvi-labs Jul 22, 2026 8/10
skill GitHub
Substrate-grounded brainstorming & planning engine for Tolvi work — a Claude Code skill that grounds the 'how' in your codebase substrate and Developer Vault, keeps the engineer in the loop on ever...
skill
by tolvi-labs Jul 22, 2026 8/10
skill GitHub
Claude Code skill: Effect-first functional TypeScript — railway-oriented programming, designing with types, property-based testing, production-ready by default
skilltypescripttesting
by mikezupper Jul 22, 2026 8/10
skill GitHub
Save links you'll forget; surface them when you actually need one. Two portable Agent Skills that build a searchable tool library from plain markdown notes.
skill
by Ranveersingh1113 Jul 22, 2026 6/10
skill GitHub
把金融級 PRD 方法論工程化成四個 Claude Skills:找洞 → 寫規格 → 產測試。含交易所提現、自營交易挑戰賽的完整 PRD 範例。
skill
by skinnerlee1225 Jul 22, 2026 6/10
skill GitHub
A doctor for your Claude Code agent skills — find the SKILL.md files Claude silently can't see (over the discovery-char budget), plus naming, routing & hygiene issues. Whole-system, deterministic, ...
skillcommand
by gulmezeren2-byte Jul 22, 2026 9/10
skill GitHub
Claude Code skills that audit and cut token bloat from your sessions - trim CLAUDE.md, add .claudeignore, and load specs on demand instead of every time.
skillclaude.md
by jawadmjn Jul 22, 2026 10/10
skill GitHub
Claude skill that strips machine tells from writing: banned AI vocabulary, structure symmetry, burstiness, hedging density. Authentic writing, no detector tricks.
skill
by marian-kamenistak Jul 22, 2026 6/10
skill GitHub
Skills, hooks e regras reutilizaveis do Claude Code: padroniza revisao de PR, abertura de issues, commits atomicos e documentacao de decisoes entre projetos.
skillhook
by PPrauchner Jul 22, 2026 10/10
skill GitHub
Two Agent Skills that make code understandable: turn a concept into staged, runnable learning code — or turn source code into a self-contained, annotated HTML walkthrough.
skill
by yumeiriowl Jul 22, 2026 6/10
skill GitHub
A Claude Code skill that compresses a conversation into one small image for a clean handoff to a new chat. Built on pxpipe.
skill
by QbyxStudio Jul 22, 2026 8/10
skill GitHub
Persistent project-scoped knowledge base for Claude Code and Codex: deep research findings with progressive disclosure, contrarian-pass and insight-extraction investigation. Survives /compact. Inst...
skillgit
by hec-ovi Jul 22, 2026 8/10
skill GitHub
Deterministic Claude Code postmortems with measured evidence and shell quality gates
skill
by VoidLight00 Jul 22, 2026 8/10
skill GitHub
Ready-to-install agent skills, each wrapping a nanoodle visual AI workflow — poster, photo restyle, jingle, narrated poem, video teaser
skillworkflow
by nanoodlecom Jul 22, 2026 6/10
skill GitHub
Reusable Claude Code skills for agentic software development workflows.
skillworkflow
by shaunczubkowski Jul 22, 2026 9/10
skill GitHub
ruff for SKILL.md: catch bad triggers, token bloat, and structural mistakes before you publish a skill.
skill
by aneesh-a7 Jul 22, 2026 5/10
skill GitHub
A Claude Code skill bundle for bug hunting and external red-team work — 71 skills, 15 slash commands, 681 disclosed-report patterns curated across 24 core vulnerability classes, plus enterprise ide...
skillcommand
by elementalsouls Jul 22, 2026 8/10
skill GitHub
Shareable Claude Code skill toolkit that builds and maintains an LLM wiki — companion to compounding-llm-wiki
skill
by hmbseaotter Jul 22, 2026 8/10
skill GitHub
GitHub 账号管家 Skill — 审计、分类、整理仓库
skillgit
by wampeeHuang Jul 22, 2026 5/10
skill GitHub
Production-ready AI coding skills and agents for Claude Code, OpenCode, and Pi. Covers TDD, .NET, Python, Rust, edge AI, and more.
skillpython
by michaelalber Jul 22, 2026 9/10
skill Reddit
r/ClaudeAI didn't appreciate my genius, thought you guys could submitted by /u/G3nghisKang [link] [comments]
skill
by G3nghisKang Jul 22, 2026 7/10
skill GitHub
Tracks upstream drift for skills I rewrote from scratch, so I know when to review changes.
skillreview
by mimukit Jul 22, 2026 5/10
skill GitHub
GL.iNet GL-MT3600BE 开箱设置 skill:地区代码 CN→US、gl管理页面风扇温度滑块补丁、拨动开关自定义、SSH 免密、zram、隐私收尾。默认只读,逐项确认后执行。
skill
by bdhwrsh Jul 22, 2026 6/10
skill GitHub
硯台 — Claude Code skills for creative and design workflows. Ink painting prompts from classical Chinese verse, bilingual verse explanations, and UI/UX auditing.
skillworkflow
by augchan42 Jul 22, 2026 8/10
skill GitHub
A comprehensive set of 36 slash commands that enforce a structured Product Development Lifecycle in Claude Code — PRD → TDD → implement → review → ship. Hard contracts force the AI to persist artifacts, write failing tests first, and run self-checks before claiming completion.
slash-commandstddworkflowpdlcquality-gateslifecycle
by kanfu-panda Jul 22, 2026 9/10
skill GitHub
A comprehensive skill containing 547 animated website sections, app templates, backgrounds, gradients, and design-system recipes accessible through Claude Code. Provides production-quality animation patterns via natural language prompting.
animationuidesignskillcomponentstemplates
by Samin12 Jul 22, 2026 6/10
skill GitHub
A comprehensive modpack that bundles skills, memory systems, tools, and workflows into a single harness for AI coding agents. Provides a batteries-included starting point for setting up a capable AI coding environment from scratch.
skillsmemorytoolsworkflowsstarter-packmodpack
by pat-browne Jul 22, 2026 6/10
skill GitHub
A skills collection with 36 Claude skills covering answer engine optimization, agentic engineering patterns, and security practices. Includes playbooks, automations, and an agentic ladder framework requiring no paid APIs.
skillsseoaeosecurityagentic-engineeringplaybooks
by search-atlas-group Jul 22, 2026 6/10
skill Reddit
A Claude Code skill that assigns one tab as the PM owning the project roadmap while worker tabs handle specialized tasks in parallel. Tabs communicate through a shared internal board, eliminating manual copying of updates between sessions. Works best with 4-5 worker tabs on a single repository.
multi-agentcoordinationpmshared-boardparalleltabs
by The___Storyteller Jul 22, 2026 7/10
skill GitHub
A Claude Code skill that enforces setting up a proper frontend project structure before implementing any individual pages. Prevents the common anti-pattern where AI generates pages ad-hoc, leading to growing inconsistency and complexity in frontend codebases.
frontendscaffoldingskillstructurearchitecture
by Byron569 Jul 22, 2026 6/10
skill GitHub
The largest known aggregation of Claude Code skills, collecting over 3,900 skills from 12+ sources with an online search interface and trend analysis dashboard. A one-stop reference for discovering and evaluating community-contributed Claude Code skills.
skillsaggregationsearchcommunityindexdashboard
by bg-szy Jul 22, 2026 9/10
skill GitHub
A collection of custom Claude Code skills targeting academic writing workflows, task automation, and specialized use cases beyond standard coding assistance. Covers domain-specific tasks that fill gaps in the standard Claude Code skill set.
skillsacademic-writingautomationworkflowsspecialized
by xjsongphy Jul 22, 2026 5/10
skill GitHub
A Claude Code skill that follows README setup documentation literally in a clean environment, reporting every setup step that is wrong, missing, or silently assumed. Turns README validation from a manual chore into an automated, reproducible test.
readmedocumentationtestingonboardingvalidationskill
by tokyubevoxelverse Jul 22, 2026 8/10
skill GitHub
A Claude Code skill that takes broken repositories that no longer build and fixes the dependencies, patches breaking changes, and brings them back to life. Automates the tedious work of modernizing stale or abandoned codebases.
dependencieslegacyrepairmodernizationskilldead-repos
by tokyubevoxelverse Jul 22, 2026 8/10
skill GitHub
A set of reusable skills for AI coding agents focused on organizing the agent folder into a clean, filesystem-first layout. Provides structural conventions for managing skills, memory, and configuration across multiple projects.
skillsorganizationfilesystemstructureconventions
by bowtiefunnel Jul 22, 2026 5/10
skill GitHub
A collection of battle-tested skills for Claude Code and Cowork that claims to double usage at the same quality level. Targets power users looking to maximize throughput from their AI coding sessions.
skillscoworkproductivity
by M4NUSH7 Jul 22, 2026 5/10
skill Reddit
A Claude Code skill that prevents the AI from generating SVG icons from scratch. Instead, it pulls production-quality icons from the Iconify library, improving output quality and eliminating token waste on iterative icon attempts.
svgiconsiconifyskillui
by Dependent-Cake-8034 Jul 22, 2026 7/10
skill Reddit
A set of Claude Code skills that make pull requests and repository documentation more visual and informative. Includes staleness checks to automatically flag outdated docs and specs so project documentation stays current as code evolves.
documentationpull-requestsspecsstalenessvisual
by scottyroges Jul 22, 2026 6/10
skill GitHub
Semantic Kernel extensions for Claude Code that add skills, hooks, context compaction, and semantic memory. Allows Claude Code agents to store and retrieve semantically relevant context across sessions using vector memory. Useful for long-running projects where persistent knowledge is important.
semantic-kernelmemorycontextskills
by JerrettDavis Jul 21, 2026 7/10
skill GitHub
A headless product design skill for AI coding agents that separates the design phase from implementation. It helps agents reason about how a feature should work before writing any code, then verifies that what ships matches the design intent. Reduces drift between spec and implementation.
designverificationworkflowskills
by aryaniyaps Jul 21, 2026 7/10
skill GitHub
A collection of open Claude Code skills targeting sales and marketing workflows—HubSpot, Salesforce, Clay, cold email, LinkedIn, and outbound automation. Skills install via npx or by copying into .claude/skills/. Targets GTM engineers and revenue teams who want AI-native tooling.
gtmsalesmarketingskillshubspotsalesforce
by Growth-Today Jul 21, 2026 6/10
skill GitHub
Reusable Claude Code skills covering the go-to-market engineering stack: ICP research, brand voice, signal-driven outbound, positioning, lead scoring, and RevOps automation. Built in Claude Code skill format for direct installation. Targets revenue teams building AI-native GTM workflows.
gtmrevenuesalesskillsoutbound
by esmefong Jul 21, 2026 6/10
skill GitHub
A community-maintained registry of Claude Code skills, subagents, and MCP servers. Serves as the data store backing the skilldex CLI tool. Centralizes discovery of community-built extensions rather than requiring searches across individual GitHub repos.
registryskillsmcpdiscoverycommunity
by drewn-ed Jul 21, 2026 7/10
skill GitHub
A CLI tool for searching, installing, validating, and auditing Claude Code skills, subagents, and MCP servers from the skilldex community registry. Makes it easy to discover and safely add community extensions without manual copy-paste. Includes validation to catch broken or malformed skills before installation.
cliskillsinstallvalidationmcp
by drewn-ed Jul 21, 2026 8/10
skill GitHub
A skill that gives Claude Code access to a live camera feed so it can see real hardware, displays, and wiring. Enables verification of rendered UI on physical screens, wiring checks before power-on, and catching bugs that only manifest on glass rather than in logs. Novel capability for embedded and electronics projects.
visioncamerahardwaredebuggingskills
by fcavalcantirj Jul 21, 2026 8/10
skill GitHub
A CLI and self-hostable control plane for sharing agent skills and behaviors across a team. Keeps every agent up to date with the latest shared conventions without manual file copying. Useful for organizations where multiple developers run Claude Code and need consistent agent behavior.
teamskillssyncworkflowcollaboration
by topos-sh Jul 21, 2026 7/10
skill Reddit
A set of Claude Code skills with Avengers character personalities for autonomous, consistent development workflows. Highlights include /assemble (idea → spec → plan → build → PR) and /loki (full codebase analysis producing a MECHANICS.md file). Battle-tested in open-source projects.
skillsmulti-agentworkflowautomationorchestration
by Far_Noise_5886 Jul 21, 2026 7/10
skill GitHub
A Claude Code plugin with 26 skills for reading companies, sectors, and personal trading journals. Backed by live market data from The Balanced Investor Club. Explicitly educational—never buy or sell advice. Useful for investors who want AI-assisted fundamental research without building their own data pipeline.
financeinvestingskillsmarket-data
by the-balanced-investor-club Jul 21, 2026 6/10
skill GitHub
A Claude Code skill that reviews how a session went—not what code it produced. It identifies mistimed questions, regressions introduced, and wasted tool calls so you can improve prompting and CLAUDE.md configuration. Unique meta-review perspective that complements code review.
metareviewsessionskillsimprovement
by Wavez Jul 21, 2026 8/10
skill GitHub
A tool that converts a YouTube video or PDF into a ready-to-use Claude Code skill. Transcript-first approach: Claude selects only video frames that carry information not conveyed in the transcript. Useful for packaging tutorial content or documentation as reusable agent skills.
skillsyoutubepdfcontentconversion
by MrEmanAhmad Jul 21, 2026 8/10
skill GitHub
A Claude Code plugin for structured first-principles thinking with a 5-phase methodology: identify essence, challenge assumptions, establish ground truths, reason upward, and validate. Every conclusion traces back to a verified ground truth. Comes with 13 companion skills for specific reasoning tasks.
reasoningskillsmethodologyfirst-principles
by chrisdavidson Jul 21, 2026 8/10
skill GitHub
A Claude Code skill that builds a module-oriented blueprint with interface contracts, schema validation, and cross-consistency checks before any implementation code is written. Prevents the common failure mode of coding toward a poorly specified interface. Produces a structured plan the agent can execute against.
planningarchitectureskillscontractsdesign
by motodigitalguru-beep Jul 21, 2026 7/10
skill GitHub
A collection of production-ready skills for Claude Code and multi-agent systems. Targets developers who want battle-tested skill building blocks rather than starting from scratch. Covers common patterns for reliable agent behavior in production environments.
skillsproductionmulti-agentworkflow
by AreteDriver Jul 21, 2026 6/10
skill Reddit
A comprehensive walkthrough of a real-world Claude Code configuration covering CLAUDE.md structure, custom skills, permission settings, and automation hooks. Useful as a reference for practitioners assembling their own setup.
CLAUDE.mdskillspermissionshookssetup
by Distinct_Setting558 Jul 21, 2026 6/10
skill GitHub
A collection of reusable Claude Code slash command skills covering Express microservice scaffolding, OWASP security audits, security hardening checklists, and TTS generation. Drop-in skills for common development and security workflows.
skillsecurityexpressowaspttsmicroservice
by lantisprime Jul 21, 2026 7/10
skill Reddit
A 24-line Claude Code skill (Task With Questions) that makes Claude study your request, ask multi-round clarifying questions to surface assumptions, and only then execute. The author reports using it more than any other skill.
skillclarificationquestionsworkflowux
by fabpub Jul 21, 2026 8/10
skill GitHub
An agent skill that reads project evidence and generates polished READMEs with selectable voice/tone, editable SVG banners, social preview images, and content validation.
skillreadmedocumentationsvgbanner
by thuanvd378 Jul 21, 2026 6/10
skill GitHub
A Claude Code skill for when you've tried the same fix three times and it keeps failing. It forces the model to explore genuinely different approaches rather than iterating on the same failed idea.
skilldebugginglateral-thinkingproblem-solving
by SunnyKTuladhar Jul 21, 2026 7/10
skill GitHub
A Claude skill that strips characteristic AI writing patterns from Russian, Ukrainian, Belarusian, Bulgarian, and German text. Based on verified linguistic sources rather than vibes.
skillwritingmultilingualai-patternsediting
by Romyleads Jul 21, 2026 6/10
skill GitHub
A personal skills marketplace framework: install once and add any plugin for terminal operations, devops workflows, and other use cases as they come up. Single entry point for managing your Claude Code skill collection.
skillmarketplaceterminaldevopsplugin
by gfargo Jul 21, 2026 7/10
skill GitHub
An agent skill that generates a brand guidelines document in a Paper format, plus a companion brand skill that the agent references during coding sessions to keep product output visually and tonally consistent.
skillbranddesignguidelinesconsistency
by ordinarynerds Jul 21, 2026 6/10
skill GitHub
A set of Claude Code skills for DooTask plugin development: scaffold a new plugin, publish to the app store, and write an optimized CLAUDE.md. Install via /plugin install dootask@dootask-skills.
skilldootaskpluginscaffold
by dootask Jul 21, 2026 5/10
skill GitHub
Outline-Driven Development for Claude Code - 46 agents, 25+ skills, diagram-first methodology, AST-based editing, atomic commits.
skill
by OutlineDriven Jul 21, 2026 9/10
skill GitHub
Personal Claude code plugin and skills.
skill
by esond Jul 21, 2026 8/10
skill GitHub
SkillBridge installs and manages portable Agent Skills (SKILL.md) from GitHub for VS Code GitHub Copilot Chat / Agent Mode.
skillgit
by amazingcreationsltd Jul 21, 2026 6/10
skill GitHub
AI agent skill for cross-vendor model review and tiered task dispatch.
skillreview
by keros68 Jul 21, 2026 6/10
skill GitHub
Production-ready AI coding skills for APIs. Installable skills for Claude Code, Cursor, Codex CLI, Gemini CLI, and modern AI coding agents.
skillapi
by ashish7802 Jul 21, 2026 9/10
skill GitHub
GMP/GSP 药企仓库管理 AI 助手 | Claude Code Skill | 覆盖温湿度、批次追溯、色标、五距、不合格品处置十大模块
skill
by xiao-shi-feng Jul 21, 2026 8/10
skill GitHub
Agent skills for social media intelligence, powered by Xpoz. Compatible with Claude Code, Codex CLI, and ChatGPT.
skill
by XPOZpublic Jul 21, 2026 9/10
skill GitHub
Comprehensive AI prompt engineering skills for Claude Code, ChatGPT (GPTs & Codex CLI plugin), and Gemini Gems. Model-specific patterns for Claude Fable 5 / Opus 4.8, GPT-5.6 Sol (5.5/5.4 legacy), ...
skill
by treylom Jul 21, 2026 8/10
skill GitHub
Free source-grounded landing-page skill for Claude Code and Codex, with honest copy, media consent, AEO, RTL, policy pages, and verification.
skill
by guycoful Jul 21, 2026 8/10
skill GitHub
Production-ready Claude Code Skill Pack for LinkedIn outreach.
skill
by faiz-sayyad Jul 21, 2026 8/10
skill GitHub
Official HiAPI AI Agent skills directory — image, video, and OpenAI-compatible API skills for Claude Code, Codex, OpenClaw, and Cursor.
skillapi
by HiAPIAI Jul 21, 2026 9/10
skill GitHub
CI for Claude Skills — lint, eval, and regression-test SKILL.md files across a model matrix, with a self-growing eval loop that turns uncovered regressions into permanent test cases.
skill
by kabirnarang39 Jul 21, 2026 6/10
skill GitHub
Deterministic quality scorer for AI agent instruction files — 8-dimension scoring with security, multi-format (SKILL.md, CLAUDE.md, .cursorrules, AGENTS.md), anti-gaming detection, zero dependencies
skillclaude.md
by Zandereins Jul 21, 2026 9/10
skill GitHub
Skill Claude + CLI Python pour freelances dev en micro-entreprise (BNC, France) : rentabilité de mission, trésorerie, retrait mensuel safe, seuils TVA et plafond micro. Les scripts calculent, Claud...
skillpython
by deuwi Jul 21, 2026 6/10
skill GitHub
Index of my agent skills — each skill lives in its own repo
skill
by Wang-Cankun Jul 21, 2026 6/10
skill Reddit
I write Claude Skills and kept hitting the same problem: a skill works today, then a new model ships, and something quietly breaks, stops triggering as often, or triggers fine but ignores instructi...
skillworkflowapigit
by LawFamiliar3588 Jul 21, 2026 6/10
skill GitHub
mission control for agent skills
skill
by alvinunreal Jul 21, 2026 6/10
skill GitHub
Independent Claude Skills for the whole smart home: Home Assistant, ESPHome, Node-RED, custom integrations, dashboards, and fab-ready hardware design.
skill
by tonylofgren Jul 21, 2026 6/10
skill GitHub
A coherent, opinionated toolkit for documentation-driven development with twin-model adversarial checks.
skill
by supermodo Jul 21, 2026 5/10
skill GitHub
Created to support my ADHD, probably useful for everyone. Always-on Claude Code working-mode skill that helps you stay in-flow, action-first, one step at a time. Transparent by default.
skill
by dlectronique Jul 21, 2026 8/10
skill GitHub
Composer plugin that installs Jardis Skills and aggregates AGENTS.md for AI-assisted development (Claude Code, Cursor, Continue, Aider)
skill
by jardisTools Jul 21, 2026 9/10
skill GitHub
Claude Code skill that escalates blocked web fetches (WebFetch -> Jina Reader -> Firecrawl -> your browser) so primary sources get read instead of silently skipped.
skill
by belschak Jul 21, 2026 8/10
skill GitHub
Four AI skills that write the hardest parts of your economics paper - introduction, abstract, conclusion, and title - without ever making anything up. Distilled from classic writing guides (Cochran...
skill
by mimaowang Jul 21, 2026 5/10
skill GitHub
Agent Skills for shipping Swift/macOS apps: .icns icons, .app/DMG packaging, CI portability traps, OSS readiness audit, release flow. Claude Code plugin marketplace.
skill
by chsistrying Jul 21, 2026 9/10
skill GitHub
LLM Council skill for Claude Code — parallel opinions, blind peer review, chairman synthesis. Built to disagree with you when warranted.
skillreview
by ddanninger Jul 21, 2026 8/10
skill GitHub
Claude Code skills I built for my own stack — Obsidian, Notion, capture/handoff, and session workflow utilities.
skillworkflow
by ozlar34 Jul 21, 2026 10/10
skill GitHub
Exasol skills for AI agents. Optimized for Claude Code and OpenAI Codex 🤖
skill
by exasol-labs Jul 21, 2026 9/10
skill GitHub
Problem-first knowledge-work skills for Claude Code, Cowork, Codex, ChatGPT desktop, and Cursor: validate, shape, draft, review, and learn.
skillreview
by rohitgehe05 Jul 21, 2026 8/10
skill GitHub
Human + AI music production workflow for Suno - skills, templates, and tools
skillworkflow
by bitwize-music-studio Jul 21, 2026 6/10
skill GitHub
76 audit-ready Claude skills automating the industrial robot, cobot, AMR, ROS2, V&V, AI/ML, and IEC 62443 lifecycle. 38 builder + reviewer pairs anchored to ISO 10218, 13849, 62061, 12100, 9283, 15...
skillreview
by jherrodthomas Jul 21, 2026 6/10
skill GitHub
343 AI skills, 76 expert agents, and 835 stdlib Python tools for every team: engineering, PM, marketing, C-level, compliance, and more. Installs on Claude Code, Cursor, Codex, Gemini, Copilot, and ...
skillpython
by borghei Jul 21, 2026 9/10
skill GitHub
A pack of skills for AI coding agents (Claude Code, Cursor) that lets them operate Adapto CMS end-to-end: scaffold projects, design schemas, seed content, translate, run SEO, audit content, roll back.
skill
by adaptocms Jul 21, 2026 9/10
skill GitHub
My collection of Claude Code skills
skill
by unbias38 Jul 21, 2026 8/10
skill Reddit
Hello! I like many of you have been messing around with Fable. I optimized my workflows, updated my skills, and built a programming interface to brush up on my Python and SQL skills. But my favouri...
skillworkflowpythonreview
by CanaryHorror2404 Jul 21, 2026 5/10
skill GitHub
Browser automation CLI built for AI agents. Break through anti-bot walls, hand off to humans across platforms when stuck. Parallel multi-task execution, independent multi-session operation, isolate...
skillautomation
by browser-act Jul 21, 2026 6/10
skill GitHub
AST-powered codebase indexer skill for coding agents. Parses repositories with Tree-sitter into a local SQLite index so agents trace dependency trees and locate symbols instantly instead of scannin...
skill
by roypriyanshu02 Jul 21, 2026 6/10
skill GitHub
Agent skill that evaluates AI deployment plans against 8 veto conditions before they reach a live workflow. Works with Claude Code, Cursor, and Codex. Good guardrail for teams wanting an adversarial review step before shipping AI-powered features.
red-teamsecurityskilldeploymentai-safety
by Anonymousyz Jul 21, 2026 7/10
skill GitHub
Skill for tracing and documenting how code executes, compatible with Claude, Gemini, and GitHub Copilot. Helps agents understand call chains and control flow before making changes. Useful for onboarding agents to unfamiliar codebases.
skillcode-analysisdocumentationexecution-flowmulti-platform
by plearaj Jul 21, 2026 5/10
skill GitHub
Skill that facilitates structured discussions about what you know, what you know you do not know, and what you do not know you do not know — based on the Rumsfeld Matrix. Helps articulate vague ideas and surface blind spots when starting a project or debugging complex issues.
skillknowledge-managementproblem-solvingideation
by Wang-Cankun Jul 21, 2026 5/10
skill GitHub
Password-protect a static HTML page with no backend: encrypt with AES-256-GCM before upload, decrypt in the browser. Standalone Node tool + Claude Code skill for Cloudflare Pages & GitHub Pages.
skillgit
by MarceloCajueiro Jul 21, 2026 8/10
skill GitHub
Profile a shop's engineering culture from public sources and install develop-like-<target> agent skills. /dev-like Every
skill
by marcusrbrown Jul 21, 2026 6/10
skill GitHub
Teach your coding agent robotics — 22 versioned, battle-tested skills for ROS 2, Gazebo, Nav2, LeRobot, Isaac Sim, MuJoCo and more. npx robium-ai install
skill
by robium-ai Jul 21, 2026 6/10
skill GitHub
API platform info for agents-skills
skillapi
by api-evangelist Jul 21, 2026 6/10
skill GitHub
My personal directory of AI Agent skills
skill
by tkolleh Jul 21, 2026 6/10
skill GitHub
Run Anthropic Agent Skills (SKILL.md) as governed Databricks jobs. Deployed as a Databricks Asset Bundle, powered by a Foundation Model served inside the workspace (no external API key). Runs on Fr...
skillapi
by dzivkovi Jul 21, 2026 7/10
skill GitHub
Design-token skill for Oracle APEX Universal Theme 42 (Vita) — 300+ CSS tokens, 45 component types, and a new Theme Style, built for AI-assisted UI.
skill
by raju-bd Jul 21, 2026 5/10
skill Reddit
It It takes short clips from captioned YT videos and turns them into dictation or fill-in-the-blank exercises. You replay a clip, type what you heard, and it highlights the differences :) If you wa...
skillgit
by nice-to-meet-you-bro Jul 21, 2026 5/10
skill GitHub
Claude Code & opencode plugin marketplace — agent-behavior, workflow & data-engineering skills.
skillworkflow
by bim-ba Jul 21, 2026 9/10
skill GitHub
Coding-agent plugins and skills for Boardwalk
skill
by boardwalk-labs Jul 21, 2026 6/10
skill GitHub
Claude skill that humanizes AI-flagged academic & professional text (ES/EN) to pass stylometric detectors like Compilatio, Turnitin & GPTZero — keeping meaning, data and citations intact. Reads the...
skill
by ljmor Jul 21, 2026 6/10
skill GitHub
Drop-in Cursor & Claude Code templates — agents, skills, and rules that teach AI your domain invariants. Ship ERP, fintech, and healthcare apps without the model inventing business logic.
skill
by rajurayhan Jul 21, 2026 9/10
skill GitHub
A set of skills including RAWeb, RAM, and RAPDF coverage for AI (targeting Claude Code)
skill
by geoffreycrofte Jul 21, 2026 8/10
skill GitHub
Lean personal Claude Code skills pack — my conventions, task flow, and quality lenses. Requires the superpowers plugin.
skill
by Endika Jul 21, 2026 8/10
skill GitHub
Claude skill on a repeatable, evidence-based gap analysis of a code repository against the EU AI Act, GDPR, and the NIS2 Directive (EU 2022/2555)
skillreview
by leodisa Jul 21, 2026 6/10
skill GitHub
Stop defaulting to the same stack. Interview-driven system design skill for Claude Code that emits interactive architecture diagrams and buildable specs.
skill
by ChiFungHillmanChan Jul 21, 2026 8/10
skill GitHub
A Claude Code skill that makes agents do the UX work before writing UI code. Enforced process, sourced rules, measured with/without validation.
skill
by TarekAwwad Jul 21, 2026 9/10
skill GitHub
Security-audit agent skills before installing: static scanner (~38 rules for prompt injection, exfiltration, credential access, obfuscation, persistence) + semantic review. Vet new skills, fleet-sc...
skillreview
by joshphoenix1 Jul 21, 2026 9/10
skill Reddit
submitted by /u/No_Nerve_1329 [link] [comments]
skill
by No_Nerve_1329 Jul 21, 2026 8/10
skill GitHub
Claude skill: script → Seedance 2.0 production board in one prompt | Клод-скилл: сценарий → продакшн-борд для Seedance 2.0 — режиссёрские промпты, ENDS ON склейки, @ассеты, риск-бюджет кредитов, тр...
skill
by afloy011-spec Jul 21, 2026 6/10
skill GitHub
Claude Code skillek: többmodelles tudományos tanács (R + DuckDB), lokális modellel működő kontextus-tömörítés, és dokumentum-kinyerő eszközök
skill
by szilikaroly Jul 21, 2026 8/10
skill GitHub
Agent skill (SKILL.md) that makes Claude and other coding agents write prose without AI tells — puffery, fake analysis, 'not just X but Y', overused vocabulary, formatting spam.
skill
by n-eriksson Jul 21, 2026 7/10
skill Reddit
I want you guys to flame the two skills I built with ClaudeCode: https://github.com/AnayDhawan/components https://github.com/AnayDhawan/oss-launch Please Flame as accurately as possible, as I wanna...
skillgit
by NKFBF Jul 21, 2026 6/10
skill GitHub
Claude Code skills — starting with token-efficiency, a cross-cutting skill for terser reasoning, prose, and code
skill
by denfry Jul 21, 2026 8/10
skill GitHub
AI video skill for Claude Code & Codex — cinematic product videos with Remotion: 106 shot recipe cards, 161 motion previews, a production-ready template
skillreview
by Vincentwei1021 Jul 21, 2026 8/10
skill GitHub
Generalized templates for a multi-agent Claude Code pipeline: a supervisor skill dispatching specialist agents through spec -> implement -> test -> adversarial-audit -> PR, and the design principle...
skill
by yahordauksha Jul 21, 2026 9/10
skill GitHub
A Claude skill for implementing changes on a git repo (or a bare set of files) and delivering the result as verified `git format-patch` files you apply with `git am`.
skillworkflowgit
by 6543 Jul 21, 2026 6/10
skill GitHub
Maps any directory into an LLM-readable taxonomy — a Claude Code skill with an AgentIngress XML block for agent context injection
skill
by Idadabhai Jul 21, 2026 9/10
skill GitHub
Turn messy software ideas into production-ready roadmaps with AI: 10-phase vibe coding framework + Claude skill for consistent project docs (PRD, tech stack, prompts & more).
skill
by nisargpatel1906 Jul 21, 2026 6/10
skill GitHub
AI agent orchestration kit for Windows, Linux/MacOS with Codex skills, hooks, routing rules and profiles for Claude, OpenCode, Cursor, Gemini and Windsurf.
skillhook
by FernandoBolzan Jul 21, 2026 9/10
skill GitHub
能做吗?勇哥 — 门头一拍,红黄绿判生死。勇哥方法论 × 高德/百度 POI 的 Agent Skill
skill
by turnerzhan Jul 21, 2026 6/10
skill GitHub
Agent skills for Qdrant vector search: scaling, performance optimization, search quality, monitoring, deployment, model migration, version upgrades, and SDK usage across Python, TypeScript, Rust, G...
skillpythontypescript
by qdrant Jul 21, 2026 6/10
skill GitHub
AI agent skill for searching flights, tours & excursions with real prices and booking links. Works with Claude Code, Cursor, Gemini CLI, Copilot and 30+ AI agents.
skill
by MissiaL Jul 21, 2026 9/10
skill GitHub
《极简创业者》(The Minimalist Entrepreneur) Claude Code 技能集 - 中文本地化版。17 个技能分两部分:Part 1 Mindset(心态)+ Part 2 Playbook(AI 打法)。
skill
by kalias Jul 21, 2026 8/10
skill GitHub
An AI writing skill that turns agent-generated drafts into clearer, warmer, more human documents by removing templated phrasing, markdown clutter, and generic AI tone.
skill
by weijt606 Jul 21, 2026 6/10
skill GitHub
The AI skill to manipulate books in fb2 format
skill
by nikolaygekht Jul 21, 2026 5/10
skill GitHub
Portable Agent Skills (SKILL.md) for Claude Code, OpenAI Codex, and other AI coding agents
skill
by mdorf Jul 21, 2026 9/10
skill GitHub
Agent Skills for EUDI Wallet and European Business Wallet integrations: credential issuance (OpenID4VCI), verification (OpenID4VP + DCQL), DC API and consent management on the iGrant.io Organisatio...
skillapi
by L3-iGrant Jul 21, 2026 6/10
skill GitHub
Governed Claude Agent Skills for engineering delivery maturity analysis: deterministic KPIs, rule-based pattern detection, and catalog-only intervention recommendations from Jira data.
skill
by kamkate Jul 21, 2026 7/10
skill Reddit
I have a bunch of skills in my claude skillset, and I came across https://github.com/HKUDS/OpenSpace which acts a sefl evolving engine for skills, anybody have used it or at least can see the long ...
skillgit
by jiii95 Jul 21, 2026 6/10
skill Reddit
Im wondering if its bad to have one huge claude md file and if i should have multiple md files per task/language/project. I already have task specific skills. submitted by /u/XAckermannX [link] [co...
skill
by XAckermannX Jul 21, 2026 6/10
skill GitHub
Define agent profiles, skills, docs, and configuration once—then export consistent instructions to Codex, Claude Code, Cursor, and OpenCode.
skillconfig
by prettyletto Jul 21, 2026 10/10
skill GitHub
Free agent skills for Claude Code and SKILL.md agents. Add with: /plugin marketplace add justhandledlabs/skills. Eleven focused tools by JustHandled Labs.
skill
by justhandledlabs Jul 21, 2026 9/10
skill GitHub
Open-source AI CMO for Claude Code: marketing agent skills for SEO, content, email, ads, launches, CRO, AEO/GEO, and AI-search visibility.
skill
by cgallic Jul 21, 2026 9/10
skill GitHub
Agent skill + spectrograph 7-layer human analysis for Grok · Claude · Hermes. Independent OSS toward Physical AI.
skill
by YangKangSung Jul 21, 2026 7/10
skill GitHub
Skills and agents for Claude and Gemini
skill
by AnaCataVC Jul 21, 2026 7/10
skill GitHub
General Skills Development Pipeline - Claude Code & Codex
skill
by huangwb8 Jul 21, 2026 8/10
skill GitHub
免費開源 Claude Code Skill:AI 自動跑白帽 SEO/AEO/GEO 網站健檢,抓孤兒頁、誤用 schema、sitemap 缺漏、CWV 誤判,並自動生成修復建議。
skill
by jacky6658 Jul 21, 2026 8/10
skill Reddit
https://preview.redd.it/f757xid75beh1.png?width=2056&format=png&auto=webp&s=4d1c4de4f51c841d0ed1762f7418650a6f3b4ae6 Kimi K3 (China AI model that distilled the anthropic model that doesn't even exi...
skillreview
by pakalumachito Jul 21, 2026 6/10
skill GitHub
Universal AI Agent OS — audited skills, governance rules, replayable state. One contract, every host agent.
skillconfig
by event4u-app Jul 21, 2026 7/10
skill GitHub
A bilingual, drafting-first Agent Skill for ready-to-send executive correspondence in Arabic and English, using Minto Pyramid rigor scaled to message weight.
skill
by ArabianCowboy Jul 21, 2026 6/10
skill GitHub
Give an executive a team of AI digital employees, run as Claude Code skills — research analyst, strategic advisor, comms expert, ops powerhouse, chief of staff — all grounded in a living, interlink...
skillgit
by ggoosen Jul 21, 2026 8/10
skill GitHub
Open-source toolkit for AI agent security — autonomous attacker + static engine + scanner + red-team skills. Exploit-validated. trust-shell.com
skill
by William2333ZZ Jul 21, 2026 6/10
skill GitHub
Reusable Claude Code skills for AI-agent-driven Swift / Apple-platform development — composable via git submodule; aggregates other specialist skill repos
skillgit
by wei18 Jul 21, 2026 9/10
skill GitHub
小优AIGC(抖音小优与AIGC的奇妙冒险)的 AI 摄影剧组 skill —— 电影摄影级生图提示词生成器,可装入 Claude Code / Codex / Hermes
skill
by wubo0927 Jul 21, 2026 8/10
skill GitHub
A structured knowledge base and reference guide for mastering the .NET ecosystem, covering core fundamentals, advanced architecture, WPF, and interview preparation.
skill
by heyashishsaini Jul 21, 2026 5/10
skill GitHub
Portable agent skills. Point Kit at a project, install a pack, wire Claude Code, Grok Build, and Codex.
skill
by Zwin-ux Jul 21, 2026 9/10
skill GitHub
benai-skills:
skill
by naveedharri Jul 21, 2026 5/10
skill GitHub
Instagram marketing skills for Claude Code and Codex: captions, carousels, hooks, hashtag strategy, and a weekly plan. Draft, humanize, and publish via Publora. MIT.
skillhook
by sergebulaev Jul 21, 2026 10/10
skill GitHub
Agent Skills Collection 2026 – Curated library of 200+ AI agent skills for Claude, Gemini, Cursor, and Copilot. Setup.exe included.
skill
by naturalcasterspot Jul 21, 2026 8/10
skill GitHub
Distills eight upstream knowledge bases — covering design, motion, 3D, and video — into a single super skill for AI coding agents. Includes automated upstream drift tracking so the skill stays current as its sources evolve. Aimed at agents that need deep creative-toolchain context without juggling multiple skill files.
skilldesignmotion3Dvideoknowledge-basedrift-tracking
by leobbaroni Jul 20, 2026 7/10
skill GitHub
Collection of reusable agent skills and custom commands covering common software engineering tasks. Designed to be pulled into Claude Code projects as a portable skill library, reducing repetitive setup across projects.
skillsoftware-engineeringcommandsreusableagent
by wesleyegberto Jul 20, 2026 6/10
skill GitHub
Personal portable context repository with agent skills and role-based guidance designed to work across different AI coding agents, not just Claude Code. Drop it into any new project to bootstrap consistent agent behavior without reconfiguring from scratch.
skillcontextportableagnosticroles
by Jean-PierreGassin Jul 20, 2026 5/10
skill GitHub
Official Claude Code skills from the Merge team for working with their Unified API, which normalizes integrations across ATS, HRIS, CRM, and other HR and business tool categories. Lets agents interact with dozens of third-party platforms through a single skill interface.
skillmerge-apiintegrationsunified-apihrisats
by merge-api Jul 20, 2026 6/10
skill GitHub
Single-source skill repository designed for portability across both Codex CLI and Claude Code, with validation-first design and CC Switch integration for seamless management. Provides a home for reusable skills that work identically across coding agents without duplication.
skillportablecodexcross-clivalidationcc-switch
by reagin Jul 20, 2026 5/10
skill GitHub
Claude Code / Codex skill that generates verified referee-style feedback on economics, finance, and social science papers before they go to a real reviewer. Produces verifiable comments, editing notes, and a revision plan that agents can implement. Free for noncommercial use, built for iterative revision cycles.
skilleconomicspaper-reviewacademicrefereerevision
by hanlulong Jul 20, 2026 6/10
skill GitHub
Massive cross-CLI skill collection (Claude Code, Codex, Gemini CLI) themed around twelve Greek gods, each covering a domain of the full SaaS lifecycle from design to ship. A single command runs the entire pipeline — design, build, inspect, test, deploy — with cross-CLI persistent memory and no manual steps. The largest known public skill collection for AI coding agents.
skillagenthooksaaspipelinecross-clicomprehensive
by Dannykkh Jul 20, 2026 8/10
skill GitHub
Claude Code skill collection for Traditional Chinese (Taiwan) writing tasks: de-AI editing, business document templates, and professional writing guidance. Also includes English infographic and knowledge-doc skills. Useful for teams working in Traditional Chinese who want agent-assisted document production.
skillchinesewritingbusiness-docstaiwantraditional-chinese
by leoluyi Jul 20, 2026 5/10
skill GitHub
A Claude Code skill that generates personalized printable coloring books for children ages 3-6. Supports parametric character creation, a story mode, a shape cookbook for simple designs, and vector PDF output. Creative demonstration of using Claude Code skills for media generation workflows.
skillPDFcreativekidsvector
by bedardandy Jul 19, 2026 6/10
skill GitHub
A ready-to-clone template that turns a single GitHub repo into a full personal job-search assistant using Claude Skills. Covers guided onboarding, persistent profile storage, multi-source job sourcing, fit evaluation, tailored CV generation, and application tracking — all version-controlled and inspectable. No personal data included in the template.
skilljob searchtemplateworkflowCV
by FynePool Jul 19, 2026 7/10
skill GitHub
A Claude Code agent skill focused on Django and Django REST Framework performance. Follows a measure-first, fix-second approach, with deep coverage of ORM query optimization, serializer efficiency, caching strategies, async patterns, and connection pooling. Complements the separate secure-code-auditor skill and works with Claude, Codex, Cursor, and Gemini.
skillDjangoDRFperformanceoptimizationPython
by n-shadloo Jul 19, 2026 7/10
skill GitHub
A Claude Code skill that takes a reference screenshot and produces a pixel-faithful HTML mockup. Uses a census-first approach — cataloguing all visual elements before rendering — to improve fidelity. Useful for design-to-code handoff workflows where visual accuracy matters.
skilldesignmockupHTMLscreenshot
by humbleteam Jul 19, 2026 6/10
skill GitHub
A Claude Code skill for design teams that generates three distinct ASCII wireframe layout hypotheses before committing to Figma or HTML. Encourages divergent thinking early in the design process, letting teams compare layout directions cheaply before investing in higher-fidelity tools.
skilldesignwireframeASCIIlayoutUX
by humbleteam Jul 19, 2026 7/10
skill GitHub
A Claude Code skill that performs structured UX critiques of your UI, producing scored findings with Before/After/Why fixes and citations to Nielsen heuristics and WCAG accessibility guidelines. Bridges the gap between AI-generated interfaces and design quality standards.
skillUXaccessibilityWCAGNielsendesign review
by humbleteam Jul 19, 2026 8/10
skill GitHub
Write YAML test cases for your Claude Code skills and run them through `claude -p` to verify each skill triggers as expected. Fills the gap in skill development — you can now test skill activation behavior the same way you test code.
testingskillsyamlciskill-development
by junghwan16 Jul 19, 2026 8/10
skill GitHub
A Claude Code skill that interrupts late-night coding sessions, saves current work state into TOMORROW.md, and firmly tells you to go to bed — without accepting counter-offers. Practical context-preservation wrapped in a bit of humor.
skillsworkflowcontextproductivitysession-management
by moudrkat Jul 19, 2026 7/10
skill GitHub
Claude Code skill that enforces spec-derived tests, mandatory boundary coverage, and evidence-gated done reports before marking work complete. Every rule is TDD-tested against real baseline failures on Opus, Sonnet, and Haiku to ensure the enforcement actually holds.
skillstddtestingspecquality
by NTCHz Jul 19, 2026 8/10
skill GitHub
A skill that inspects Claude Code SKILL.md files for quality issues and fixes them. Useful for auditing and cleaning up skill libraries — especially when skills have grown stale, ambiguous, or poorly scoped.
skillsdiagnosticstoolingskill-developmentquality
by napoler Jul 19, 2026 7/10
skill GitHub
Claude Code skill that records project state, design decisions, and dead ends that live outside the codebase itself. A new session can resume with full context by reading the lore file instead of re-reading code to reconstruct intent.
memorycontextskillsession-managementknowledge
by sh008 Jul 19, 2026 6/10
skill GitHub
A shell-native tool that enforces a think-first, review-first approach where Claude Code and Codex typically jump straight to writing. Combines a code reviewer, security scanner, root-cause debugger, and code generator in one loop. Slows down to produce more reliable output.
skillreviewsecuritydebuggingcode-qualityshell
by Pythoughts-labs Jul 19, 2026 7/10
skill Reddit
A full SKILL.md for Claude Code that stress-tests system architectures across failure domains, scalability, data consistency, security, operability, and cost — prioritizing findings by blast radius. Includes test-driven validation: the author planted 8 deliberate flaws and it found all 8. Ready to drop into ~/.claude/skills.
skillarchitecturesecurityscalabilityreview
by Swimming_Year5735 Jul 19, 2026 9/10
skill GitHub
Syncs AI coding agent configuration from a single .ai directory to Claude Code, Codex, and Kiro. Maintains one source of truth for agent configuration and distributes it to all installed agents. Reduces drift when using multiple coding agents on the same machine.
skillconfigurationsynccodexkiromulti-agent
by dialguiba Jul 19, 2026 6/10
skill GitHub
A gated research protocol for Claude Code built on the MaxFusion AI MCP that pulls real TikTok and Meta Ad Library creatives, analyzes them against Eugene Schwartz's 5 Stages of Awareness, mines voice-of-customer signals, and compiles everything into a persistent research memory tree plus an HTML dossier with personas.
skillmarketingresearchmcppersonasstrategy
by holy-templar Jul 19, 2026 5/10
skill Reddit
Rewrites prompts using the official Anthropic guide for the specific target model (Fable 5, Opus 4.8, etc.) rather than a generic template. Classifies the task type and applies model-specific idioms — less prescription for Fable 5, tight scope for Opus. Install via npx skills add mfarzanansari/prompt-polish.
skillprompt-engineeringfable5opus
by imfarzann Jul 19, 2026 8/10
skill GitHub
Maintains one AISkills folder with every skill source and symlinks them on demand into any project's .agents/skills or .claude/skills. Works across Claude Code, Codex, OpenCode, and Pi. Eliminates duplication when sharing skills across many repos.
skillskills-managementmulti-agent
by chenweil Jul 19, 2026 6/10
skill GitHub
A /baseline slash command skill that audits a project against 69 readiness rules with no external dependencies. Installs into ~/.claude/skills/baseline. Surfaces gaps like missing README, untested modules, or missing CI configuration before work begins.
skillproject-healthqualityaudit
by AdarGit008 Jul 19, 2026 7/10
skill GitHub
Packages Zotero developer documentation — Web API v3 (read/write, sync, streaming, OAuth), client JS API, Zotero 7 plugins, translators, and CSL citation styles — as a coding-agent skill. Enables agents to write Zotero integrations without hallucinating the API.
skillzoteroapidocumentation
by Agents365-ai Jul 19, 2026 6/10
skill GitHub
Provides one configuration layer covering Claude Code, Codex, Cursor, Gemini, Aider, and more, plus a cognitive substrate for memory, blast-radius tracking, and guardrails. Reduces per-agent setup overhead when using multiple coding agents on the same project.
skillmulti-agentconfigurationguardrails
by CodeWithJuber Jul 19, 2026 7/10
skill GitHub
A collection of nine Claude Code skills targeting multi-repository development: audit builds, tame CI, sync docs to code, and keep sister repos in lockstep. Useful for monorepo-adjacent setups where consistency across repos matters.
skillmulti-repocidocumentation
by ajbarea Jul 19, 2026 6/10
skill GitHub
Reads local Claude Code and OpenAI Codex session history and writes an HTML report on what you build, where you lose time, and concrete workflow improvements. Surfaces patterns like repeated tool failures or overlong context usage. Works with Claude Code, Codex, and any skills-capable agent.
skillanalyticsproductivitysession-analysis
by smixs Jul 19, 2026 7/10
skill GitHub
A meta-skill for Claude Code that helps manage the growing collection of skills, MCP servers, and plugins by organizing them into categories. Useful as the Claude Code ecosystem grows and managing dozens of installed skills becomes difficult.
skillskills-managementmcporganization
by Xue-Sir Jul 19, 2026 6/10
skill GitHub
A Claude Code skill that scans a codebase for AI-writing tells — overused phrases, filler words, passive constructions — to ensure human-quality prose in comments, docs, and strings. Grounded in common AI writing anti-patterns.
skillcode-qualitywritingai-detection
by Lucasli6833 Jul 19, 2026 5/10
skill GitHub
Twelve Claude Code skills distilled from actual usage sessions, covering Docker/SSH/VPS operations, data and ML pipeline gotchas, model-specific prompting guides for four models, a 10-category bug audit, and a persistent project wiki with slash commands. Real-world extraction means these address actual pain points.
skilldockersshvpsmlprompting
by aksheyw Jul 19, 2026 8/10
skill GitHub
A collection of portable skills, agents, hooks, and Pi extensions for Claude Code, Codex CLI, Copilot, Cursor, Grok, and Pi. Cross-tool design means the same skills work regardless of which AI coding agent you're using.
skillmulti-agenthooksportable
by alexei-led Jul 19, 2026 6/10
skill GitHub
A Claude Code skill for generating iOS Liquid Glass design components in Swift and React Native. Helps developers implement Apple's Liquid Glass aesthetic with AI assistance. Platform-specific but covers two of the main mobile development ecosystems.
skilliosswiftreact-nativedesign
by zakisheriff Jul 19, 2026 5/10
skill GitHub
An enhanced fork of OpenWolf that adds bounded storage, self-maintenance via an 'openwolf doctor' command, .wolfignore scoping for excluding files from context, and tunable retention policies. Addresses the original OpenWolf's lack of storage limits. AGPL-3.0.
skillmemorycontexttoken-optimization
by bassprofressor-lab Jul 19, 2026 7/10
skill GitHub
A Claude Code skill and diagnostics-first wrapper around Build123d for LLM-driven 3D CAD iteration. Surfaces Build123d error messages in a form the model can act on, enabling back-and-forth CAD design workflows. For developers who work on parametric 3D modeling.
skillcadbuild123d3d-modeling
by cyberchitta Jul 19, 2026 6/10
skill GitHub
A coding-standard skill that enforces a fixed architecture for ML/DL research repositories: uniform structure, naming conventions, configuration standards, FAIR data practices, and review via machine-executable Rule Cards. Prevents the common drift in research code as multiple contributors (human and AI) add to it.
skillmlresearchcode-standardsfair-data
by SaltGardenia Jul 19, 2026 7/10
skill GitHub
A Claude Code skill that takes messy project inputs (stakeholder notes, Figma links, PDFs) and distills them into a structured 5-bullet design brief plus a gap report identifying missing information. Useful at the start of any design or product project.
skilldesignuxproduct
by humbleteam Jul 19, 2026 6/10
skill GitHub
Converts a UI mockup into a developer-ready handoff specification covering design tokens, component states, accessibility notes, and open questions. Bridges the gap between designers and developers in AI-assisted workflows. Part of the humbleteam design skill collection.
skilldesignhandofftokensaccessibility
by humbleteam Jul 19, 2026 7/10
skill GitHub
A Claude Code skill that performs WCAG 2.2 accessibility audits on web UIs, returning severity-ranked findings with success-criterion citations. Integrates accessibility review into the coding agent workflow without requiring a separate tool.
skillaccessibilitywcagauditweb
by humbleteam Jul 19, 2026 7/10
skill GitHub
A small Claude Code plugin marketplace with its first entry: loadout, which lets you activate a different set of plugins per git worktree. Useful when different branches or projects need different skill/agent configurations without global setting changes.
skillpluginsworktreeconfiguration
by TerryHong97 Jul 19, 2026 6/10
skill GitHub
Five lightweight skills providing an Obsidian vault health checker, connection discovery, brain dump, session notes, and an email bridge. CLI-first with no prescribed taxonomy — works with any knowledge structure. Bridges Claude Code sessions to a persistent Obsidian knowledge base.
skillmemoryobsidiannotespersistence
by jojoprison Jul 19, 2026 7/10
skill GitHub
Claude Code skills for homelab administration emphasizing safety: Tailscale ACL validation with anti-lockout protection, and Proxmox snapshot-before-write for any destructive operation. Adds judgment (not just tools) to prevent accidental self-lockout during AI-assisted homelab management.
skillhomelabtailscaleproxmoxsafety
by Enzojol Jul 19, 2026 7/10
skill GitHub
A Claude Code plugin that adds multi-specialist code reviews, architecture audits, QA traceability, smart git commits, and GitHub release preparation. Project-specific rules in claudedocs/ take precedence over built-in guidelines. Language-agnostic.
skillcode-reviewarchitectureauditrelease
by mka-codelake Jul 19, 2026 7/10
skill GitHub
Discovers documentation sources for a given technical skill, scores them for authority and freshness anchored to a model's knowledge cutoff, synthesizes them into an Agent Skills SKILL.md using a local LLM, and vets the result with NVIDIA SkillSpector. Automates the creation of skills from live docs.
skilldocumentationauto-generationjavalocal-llm
by PIsberg Jul 19, 2026 7/10
skill GitHub
A portable QA skill pack covering frontend and API test-case preparation (AC/EC + Swagger coverage review), Playwright ticket testing, defect filing, and Jira retest. Works across Claude Code, Cursor, Codex, GitHub Copilot, Gemini CLI, Windsurf, Cline, and other Agent Skills-compatible tools.
skillqaplaywrightjiraswaggertesting
by Thitic9203 Jul 19, 2026 7/10
skill GitHub
A collection of skills, rules, code snippets, templates, and smoke-gated runnable examples for Blender Python development, targeting Blender 5.1 with 4.5 LTS fallback. Enables Claude Code to write verified Blender Python without hallucinating the API.
skillblenderpython3dcreative-coding
by TMHSDigital Jul 19, 2026 6/10
skill GitHub
A local web UI that reads Claude Code, Codex, and OpenCode session logs to count which skills actually get triggered in practice. Surfaces underused skills and helps prioritize which ones to maintain. Zero-dependency, local-only.
skillanalyticsusage-trackingsession-logsoptimization
by Liang-HZ Jul 19, 2026 8/10
skill GitHub
A curated collection of AI tools, Claude skills, MCP servers, and growth playbooks for solopreneurs and indie hackers — structured as a feed-to-Claude-Code context package. Covers the one-person-company AI stack from product to marketing.
skillsolopreneurcuratedmcpgrowth
by yerdaulet-damir Jul 19, 2026 5/10
skill GitHub
A comprehensive business operating system built on Claude Code with 57 skills, 21 agents, and a smart daemon. Covers unified inbox (WhatsApp/Email/Slack/Telegram), autonomous PR merge, full-AWS monitoring, Stripe, Shopify, Klaviyo, Meta, GA4, voice (Bland/ElevenLabs), and APM (Datadog/NewRelic/OTEL).
skillbusinesssaasmonitoringintegrationsautomation
by Lifecycle-Innovations-Limited Jul 19, 2026 8/10
skill GitHub
A tool for selecting and installing only the AI coding skills relevant to your specific tech stack, from a vetted collection compatible with Claude Code, Codex, OpenCode, and Antigravity. Reduces noise from installing large skill packs that include irrelevant skills.
skillcurationtech-stackmulti-agent
by uzysjung Jul 19, 2026 5/10
skill GitHub
A 2026 senior engineer AI toolkit implementing Clean Architecture principles for Go, Rust, and TypeScript development. Provides structured patterns for AI-assisted development in these three languages with architecture-first guidance.
skillgorusttypescriptclean-architecture
by amoh7209-dot Jul 19, 2026 6/10
skill GitHub
A Claude Code skill that instructs the model to stop burying the answer — lead with the conclusion, then the reasoning. Practical for any user who finds Claude Code's verbose, reasoning-first responses hard to skim. MIT-licensed, single-file skill.
skilladhduxconcisenessoutput-format
by ayghri Jul 19, 2026 7/10
skill GitHub
A specification and testing framework for AI agent skill cards — a standard format for describing, testing, and distributing agent skills. Provides a structured way to ensure skill cards are complete, testable, and portable across agents.
skillstandardtestingskill-cardsportability
by vinsonconsulting Jul 19, 2026 6/10
skill GitHub
A capability layer for coding agents emphasizing reviewability: portable skills, delivery gates, workflow patterns, and verification-first engineering. Designed so every agent capability can be inspected and its outputs verified before acceptance.
skillverificationdelivery-gatesportablequality
by markoblogo Jul 19, 2026 6/10
skill GitHub
A Claude Code skill that encodes the Stripe design system in a color-agnostic form, letting you apply Stripe's spacing, typography, and component patterns to any brand palette. Drop it in and Claude Code follows Stripe's UI conventions without being locked to Stripe's specific colors. Useful for building polished dashboards and payment UIs quickly.
stripedesignuiskilldesign-systemcomponents
by victoryoalli Jul 19, 2026 6/10
skill GitHub
Harness-neutral Agent Skills for recovering from VS Code crashes and cleaning up project-scoped build artifacts on macOS without data loss. Works with any agent that supports Skills (Claude Code, etc.). Handles the edge cases — zombie processes, locked files, stale build caches — that make crash recovery error-prone manually.
skillvscodecrash-recoverymacoscleanupagent
by ariellephan Jul 19, 2026 5/10
skill GitHub
Per-project todo tracking combined with a project brain and autonomous plan-then-build workflow for Claude Code, with a local broadsheet dashboard. Integrates task management directly into the agent workflow rather than as a separate tool.
todostask-managementskilldashboardplanning
by unknown Jul 18, 2026 7/10
skill Reddit
Skill that renders Markdown documents using RSVP (Rapid Serial Visual Presentation) speedreading, enabling up to 6x faster reading with practice. Settings (colors, fonts, speed, ramp-up, markdown tweaks) are saved across sessions. Useful when reviewing long agent-generated reports.
readingrsvpspeedskillproductivity
by heisdancingdancing Jul 18, 2026 6/10
skill GitHub
Production-grade paid-media agents and skills for Claude Code that generate complete ad campaigns for any industry and region from a 4-line client brief, covering Meta, Google, YouTube, and TikTok. Designed for agencies and marketers running ad operations through Claude Code.
marketingadvertisingskillmetagoogle-ads
by rghrmkr1993 Jul 18, 2026 6/10
skill GitHub
Agent skills distilled from real-world usage featuring the codex-implementation-loop: delegate coding to Codex while keeping review, gate, and ship judgment in Claude hands. A practical pattern for pairing the two most popular coding agents with clear separation of responsibilities.
codexpairingskillreviewdelegation
by olddonkey Jul 18, 2026 6/10
skill GitHub
Claude Code skill that turns Apple App Store reviews into App Store Optimization and product feedback insights. Automates the process of reading and categorizing user reviews at scale to surface actionable product insights.
asoapp-storereviewsskillproduct
by johnisanerd Jul 18, 2026 6/10
skill GitHub
Claude Code skill that tracks newly filed US Congress trading disclosures on a schedule via CLI, installed via npx skills add. Automates monitoring of congressional stock trading activity for research and alerting workflows.
financecongressdisclosureskillmonitoring
by johnisanerd Jul 18, 2026 6/10
skill GitHub
Claude Code skill that retrieves US Congress stock trade disclosures as structured JSON via CLI. Complementary to the congress-trading-tracker, providing a data access layer rather than a monitoring scheduler.
financecongressjsonskillapi
by johnisanerd Jul 18, 2026 6/10
skill GitHub
Claude Code plugin providing a harness for event-driven architecture with event sourcing on Azure Functions. Pre-built scaffolding and conventions for this specific backend pattern, reducing the time needed to set up a correct EDA implementation from scratch.
azureevent-sourcingedaserverlessskill
by augusto-romero-arango Jul 18, 2026 6/10
skill GitHub
Integrates AI-powered image generation using Google Gemini into Claude Code as a skill, or into Claude.ai via MCP. Lets agents generate images as part of their workflow without switching tools.
image-generationgeminimcpskill
by guinacio Jul 18, 2026 6/10
skill GitHub
Audits web and mobile UI code to detect layout failures, responsiveness errors, and design system drift before deployment. Catches the class of issues that code linters miss but visual inspection would catch, giving agents a way to self-audit UI quality.
uiauditresponsivenessdesign-systemskill
by Xza2792 Jul 18, 2026 6/10
skill GitHub
Configures Claude to deliver damage-ranked findings with evidence per criticism, calibrated confidence, and no politeness padding. Useful when you need direct critical feedback rather than diplomatically softened analysis, especially in code review or debugging scenarios.
honestyfeedbackskillcode-reviewdirectness
by edward-sh88 Jul 18, 2026 6/10
skill GitHub
Open-source enterprise content production plugin with 21 skills, 13 agents, 11 quality gates, a 29-pattern AI humanizer, fact-checker, and real .docx output with C2PA signing for EU AI Act Article 50 compliance. Works across Claude Code, Cowork, Codex, Cursor, and Copilot CLI.
contententerpriseskillcompliancedocx
by indranilbanerjee Jul 18, 2026 6/10
skill GitHub
Establishes a two-layer reasoning discipline where clauses carry explicit output obligations and failures are auditable clause by clause. Makes Claude reasoning more transparent and verifiable by separating internal reasoning from external output commitments.
reasoningtransparencyskillauditclauses
by duncan806 Jul 18, 2026 6/10
skill GitHub
Claude Code skill for high-conversion landing pages covering strategy, copy, design, motion, runnable HTML, with built-in SEO and GEO support including llms.txt, FAQ JSON-LD, and AI-crawler readiness. Includes bilingual support (English/Chinese).
landing-pageseogeoskillhtml
by laixi969-coder Jul 18, 2026 6/10
skill Reddit
Post exploring how insights from a 176k+ starred GitHub repository changed the approach to writing CLAUDE.md configuration files. Demonstrates how ideas from adjacent communities can meaningfully improve Claude Code configuration practices.
claude-mdconfigurationtipsbest-practices
by Single-Cherry8263 Jul 18, 2026 6/10
skill Reddit
How to make a single plugin repository work on Claude Code, Codex, OpenCode, Hermes, and Antigravity at once without duplicating skill definitions. Addresses the growing need to maintain skills across multiple agent runtimes as developers use more than one tool.
plugincross-agentcodexhermescompatibility
by No_Skill_8393 Jul 18, 2026 6/10
skill GitHub
Claude Code skill that automates claiming AWS new-account exploration-activity credits (up to $100) for under $0.05 in token costs via CLI. Practical time-saver for developers spinning up new AWS accounts.
awscreditsskillcli
by guzus Jul 18, 2026 6/10
skill GitHub
Skill and configuration that removes human-oriented behaviors from Claude: no time estimates, no asking for accessible data the agent can fetch itself, no emotional labor. Designed for autonomous agent workflows where human-like hedging and hand-holding wastes tokens and slows execution.
skillbehaviorautonomousefficiency
by ssplug Jul 18, 2026 6/10
skill GitHub
A USER.md file with two lanes: hand-written and agent-curated, with no silent rewrites from the agent side. The AI builds up its understanding of you in a file you own and control, that moves when your folder moves. Gives the agent persistent user context without surrendering control.
memoryuser-profilemarkdownagent-memory
by LucioLiu Jul 18, 2026 6/10
skill GitHub
Imports Excel and PowerPoint skills into Claude Code to automate spreadsheets and presentations using local filesystem access. Useful for developers who need to generate or modify Office documents as part of automated workflows.
excelpowerpointofficeautomationskill
by Borjani1577 Jul 18, 2026 6/10
skill GitHub
Builds a dynamic knowledge system for Claude Code agents that evolves over time with the ability to test and manage information. Designed to give agents a persistent second brain that improves with use rather than starting from scratch each session.
knowledgememorydynamicskill
by benizlerken Jul 18, 2026 6/10
skill GitHub
Syncs your complete Claude Code setup across machines: skills, settings, and session history, with path remapping and per-host overrides. Addresses the pain of maintaining consistent Claude Code configuration when working across multiple machines or cloud environments.
synccross-machinesettingsskillshistory
by funkadelic Jul 18, 2026 8/10
skill GitHub
Claude Code and GitHub Copilot skills implementing an expensive head/cheap hands pattern — a master decision-maker on a frontier reasoning model that never touches the repository, commanding subagent workers that do all reading, running, and writing with adversarial gates at both ends.
multi-agentorchestrationadversarialcost-efficiency
by rhawk117 Jul 18, 2026 7/10
skill GitHub
A factory for Claude Code skills where nothing ships without being tested. Enforces a review and testing process for every skill before publication, addressing the quality problem in the growing ecosystem of unvetted skill packages.
skilltestingqualityfactory
by proluct Jul 18, 2026 7/10
skill GitHub
Compiles patterns from MDX lessons, Jupyter notebooks, or custom sources into SKILL.md files via a type-safe pipeline with local atomic writes to ~/.claude/skills/. Three pluggable ingestors let you convert any learning material into Claude Code skills.
skillcompilerjupyterautomationmdx
by akaieuan Jul 18, 2026 8/10
skill GitHub
Agent skills covering the full SaaS lifecycle: product definition, secure build-and-launch, and safe maintenance on Next.js, Supabase, and Stripe. Works with Claude Code, Codex, and Antigravity. Opinionated toward security and correctness at each stage.
saasnextjssupabasestripeskill
by Naveen-95 Jul 18, 2026 7/10
skill GitHub
Hand-verified catalog of working Claude Code skills covering marketing, SEO, dev, and MCP — with no dead links. Also ships a built-in 19-sub-skill SEO/GEO agent ready to use. Addresses the frustration of finding skill collections where half the links are broken or unmaintained.
skillcatalogseoverifiedmarketplace
by nurdamiron Jul 18, 2026 7/10
skill GitHub
Based on Anthropic official skill-creator but with bug fixes, working Cowork support, and official best practices baked in. A Claude skill for creating, testing, and improving other Claude skills. Useful when the original has issues that prevent it from working properly with Cowork.
skillmetaskill-creatorcowork
by yaniv-golan Jul 18, 2026 8/10
skill Reddit
Implementation of Andrej Karpathy LLM Wiki pattern as an installable Claude skill plus BLUEPRINT.md spec. Instead of RAG, the LLM builds and maintains a persistent Markdown wiki from your sources — read once, cross-reference forever, flag contradictions. Key rule: if the brain has no coverage, it says so rather than inventing an answer.
knowledge-basewikiskillmarkdownkarpathy
by PromptFiction Jul 18, 2026 8/10
skill GitHub
Minimal-process, constant-quality alternative to Superpowers for coding agents. Focuses on minimum necessary workflow to maintain consistent output quality, avoiding the complexity and overhead that accumulates in larger skill frameworks. Available in both English and Chinese.
skillworkflowsuperpowerslightweight
by blackstone2333 Jul 18, 2026 7/10
skill GitHub
Directional, cross-platform, transport-agnostic sync for Claude Code settings, memory, plans, and skills driven by an in-Claude skill. Supports up/down/status operations and works regardless of the underlying transport mechanism.
synccross-platformsettingsskills
by JonMcMillan Jul 18, 2026 7/10
skill GitHub
Curated plugin collection for Claude Code and Claude Cowork featuring fresh-eyes code review agents, workflow orchestrators, and specialized skills. Emphasizes independent review — agents that have not seen the original implementation evaluate the output from a fresh perspective.
plugincode-reviewmarketplaceworkflow
by aliasunder Jul 18, 2026 7/10
skill GitHub
Analyzes shell, git, browser, and Claude logs to spot recurring patterns and convert them into installable slash commands in your AI tools. Automates the process of turning repetitive workflows into reusable agent skills.
skillautomationslash-commandpatterns
by izzidescendent834 Jul 18, 2026 7/10
skill GitHub
Local-first desktop app that syncs Codex, Claude Code, and Agent Skills across machines through your private GitHub repository. Solves the problem of maintaining consistent skill configurations when working across multiple development machines.
syncskillscross-machinegithub
by TreatTrick Jul 18, 2026 7/10
skill GitHub
Production-ready Docker and Kubernetes tooling packaged as Claude Code skills with built-in validators. Install once and use everywhere for container management and Kubernetes operations from within your agent workflows. Modular and independently verifiable.
dockerkubernetesskilldevopscontainers
by obeone Jul 18, 2026 7/10
skill Reddit
Tiny Claude Code plugin adding /onebreath:1s for one-sentence responses and /onebreath:1p for one-paragraph responses. Solves the common problem of Claude producing walls of text when you just need a quick answer. Especially useful in multi-session setups where brevity matters.
skillconcisecommandux
by louixs Jul 18, 2026 7/10
skill GitHub
Persistent memory for AI coding agents that learns which files go together and what you usually edit next, the same way a senior engineer builds intuition. Works with Claude Code, Cursor, Cline, and Continue, running 100% locally. Reportedly reduces code question costs by 40-70x.
memorycodebaselocal-firstcostcontext
by dfrostar Jul 18, 2026 7/10
skill Reddit
Collection of strict skill.md files that kill the generic glassmorphism and rounded-corner spam in AI-generated UIs. Enforces viewport-scale typography, brutalist design, and extreme whitespace, forcing the agent to think like an Awwwards-tier designer before writing code. Works with Claude, Cursor, ChatGPT, Codex, and Gemini.
uidesignskillbrutalismcss
by AudienceNo2554 Jul 18, 2026 7/10
skill GitHub
Local-first persistent memory for Claude Code, Cursor, ChatGPT, and any MCP client — one Markdown vault shared across every AI tool. Keeps all context in files you own and control, with no vector database or cloud service required.
memorymarkdownlocal-firstmulti-tool
by n0mad-ai Jul 18, 2026 7/10
skill GitHub
Drop-in replacement for standard GitHub skills that makes bounded, targeted calls: one call each for PR state, review threads, and CI failures. Reduces context burned and cost compared to naive approaches that over-fetch GitHub data. Works with any coding agent.
githubskilltokensefficiencypr
by AVGVSTVS96 Jul 18, 2026 7/10
skill GitHub
Single binary tool for storing action-driven specs and append-only decision records that AI agents can evaluate code changes against. Includes a built-in viewer and Claude Code skills for integration. Keeps product intent inside git alongside the code it governs.
memoryspecdecision-recordsgit
by nkenji09 Jul 18, 2026 7/10
skill GitHub
Persistent, multi-tier, measurably-faithful memory backend for Claude Code on Windows and WSL2, combining mem0, Qdrant, EmbeddingGemma, and Codex. Self-contained operator-agnostic installer skill. Designed for Windows-first environments where other memory setups fall short.
memorywindowswsl2qdrantskill
by dmmdea Jul 18, 2026 7/10
skill GitHub
Comprehensive one-install foundation for Claude Code providing memory, accountability, journaling, knowledge graphs, and pattern recognition. Designed so every session compounds on the last by building up persistent understanding of projects and decisions. Installs everything in one command.
memoryknowledge-graphjournalingskillclaude-code
by mycelium-hq Jul 18, 2026 8/10
skill GitHub
Claude Code skill marketplace for attaching to a logged-in Chrome over CDP and harvesting JSON/GraphQL data that pages already fetch. Includes anti-block hygiene and resumable state. Designed for authorized scraping scenarios where you control the browser session.
web-scrapingcdpchromeskill
by brightstone111 Jul 18, 2026 7/10
skill GitHub
Stores structured Claude Code memory in markdown files tracked by git — no extra infrastructure required. Provides cross-session memory with the simplicity of plain text and the history of version control. Zero dependencies and works on any machine with git already installed.
memorymarkdowngitclaude-codeno-infrasimple
by huckaby1847 Jul 18, 2026 6/10
skill GitHub
Gives AI coding agents full control over videos — download with yt-dlp (MP4/MP3), watch with claude-real-video, and transcribe with speaker diarization via WhisperX. All local, Portuguese-language documentation. Claude Code skills and compatible agent skills included.
skillvideotranscriptionyt-dlpwhisperxclaude-code
by JohnsonChenx Jul 18, 2026 6/10
skill GitHub
A single governance.md bedrock layer for AI coding agents that works across any project and never goes stale. Compiles to Claude, Cursor, Codex, Gemini, and Aider-compatible formats from one source. Universal skills mean you write the governance rules once and they work everywhere.
governanceCLAUDE.mduniversalskillsclaude-codecodexcursor
by WhitehatD Jul 18, 2026 7/10
skill GitHub
A pipeline-first Claude Code skills pack with 19 composable skills for structured feature delivery from shape to ship. Each skill fits into a delivery pipeline stage so you can chain them together. Designed for teams who want an opinionated but flexible feature delivery process.
skillspipelinefeature-deliverycomposableclaude-code
by chrislacey89 Jul 18, 2026 7/10
skill GitHub
Curated, polished agent skills for building calm native apps and running AI coding agents well. Works with Claude Code, Codex, and Cursor. Focused on native app development patterns and calm, deliberate workflows rather than rapid vibe coding.
skillsnative-appsclaude-codecodexcursorquality
by aka-kika Jul 18, 2026 6/10
skill GitHub
An agentic OS for Claude Code featuring compounding memory you own, token discipline, and governed autonomy — all in a plain-markdown wiki as your single source of truth. Named after the Chinese concept of benevolence, it focuses on thoughtful, deliberate agent behavior rather than speed.
memoryAI-OSclaude-codetoken-efficiencymarkdowngovernance
by hazarsozer Jul 18, 2026 7/10
skill GitHub
Automatically analyzes your codebase to learn conventions, then guides AI-generated code to follow team idioms, architectural patterns, and best practices — keeping auto-generated code in sync with evolving standards. A living conventions engine that updates as your codebase evolves.
skillconventionscode-qualitystandardsclaude-codeteam
by crisnahine Jul 18, 2026 8/10
skill GitHub
A documentation-discovery telemetry skill for Claude Code that generates heat/cold maps, health grades, and evidence-backed router fixes for your documentation system. Runs 100% locally with zero tokens. Helps you understand which parts of your CLAUDE.md are actually being used.
skilldocumentationtelemetryCLAUDE.mdlocalanalytics
by Hedde Jul 18, 2026 7/10
skill GitHub
Ten production Claude skills covering the full Google Ads diagnostic lifecycle — waste detection, spend spikes, Quality Score analysis, budget management, and reporting. Built from real campaign management experience. Useful for marketers and agencies who want AI-assisted Google Ads analysis.
skillgoogle-adsmarketingdiagnosticsPPCanalytics
by kochellenk-afk Jul 18, 2026 7/10
skill GitHub
Production Claude skills from a working fractional CMO practice covering client sweeps, critique layers, decision councils, and Meta ad engines. Built from real consulting engagements. Useful for marketing practitioners and agencies who want AI-assisted marketing strategy and execution.
skillmarketingCMOstrategymeta-adsconsulting
by kochellenk-afk Jul 18, 2026 6/10
skill GitHub
Claude skills and read-only CLIs for the marketing-technology stack — covers martech teardown, Google Ads, Microsoft Ads, and Google Merchant Center. Built for practitioners who want AI-assisted analysis of their marketing tech without giving write access to ad accounts.
skillmarketinggoogle-adsmartechanalyticsclaude-code
by almoretti Jul 18, 2026 6/10
skill GitHub
A one-command shakedown skill for Claude Code that checks architecture, security, performance, resilience, and docs before you ship. Surfaces what breaks before your users find it. Useful as a final gate before merging or deploying.
skillauditsecurityperformancepre-shipclaude-code
by belousov-petr Jul 18, 2026 7/10
skill GitHub
A shared real-world Claude Code setup — global CLAUDE.md instructions and the skills built and used daily by the author. Good reference for what production Claude Code configuration looks like from an experienced user. MIT licensed for copying and adapting.
CLAUDE.mdsetupskillsconfigurationreferenceclaude-code
by cozren Jul 18, 2026 6/10
skill GitHub
Scaffolds README, CHANGELOG, and community health files from published standards (Keep a Changelog, standard-readme, Contributor Covenant) and keeps them accurate with a committed, dependency-free linter and CI gate. The linter runs without Claude so standards are enforced in CI as well.
skilldocumentationreadmechangelogstandardsCI
by runverdict Jul 18, 2026 7/10
skill GitHub
A zero-dependency Claude Code plugin that simplifies and removes bloat from AI-generated code while preserving behavior, then benchmarks the speedup. Measures code weight, trims it, verifies equivalence, and benchmarks the result. Useful for cleaning up verbose AI output that works but is heavier than it needs to be.
skillrefactoringoptimizationclaude-codecode-quality
by 88plug Jul 18, 2026 7/10
skill GitHub
A read-only two-pass parallel sweep that discovers, catalogs, and ranks every project or sketch on your machine by novelty and leverage. Helps you find forgotten projects that are worth continuing or extracting ideas from. Good for developers with many scattered experiments who want an inventory.
skilldiscoveryprojectsrankingproductivityclaude-code
by 88plug Jul 18, 2026 6/10
skill GitHub
A document-driven AI development framework with 14 skills covering the full cycle from brainstorm through PRD, design, engineering, QA, review, shipping, and retrospective. Bilingual (English/Chinese). Provides a complete structured process for product development using AI agents.
skillworkflowproduct-developmentTDDPRDclaude-code
by yike-gunshi Jul 18, 2026 7/10
skill GitHub
A stack-agnostic Claude Code skill acting as a strict code reviewer, pair programmer, debugger, and mentor for Python, Bash, Apps Script, and JavaScript. Security-first with a spec→plan→TDD→verify workflow and phase-aware engineering discipline. Useful for solo developers who want a senior engineer perspective on their work.
skillcode-reviewmentorshipTDDsecurityclaude-code
by bjgreenberg Jul 18, 2026 7/10
skill GitHub
A comprehensive collection of 15 Claude Code skills for cybersecurity professionals covering offensive security, defensive operations, reverse engineering, threat hunting, CSOC automation, and more. Built for practitioners who want AI-assisted security workflows. Covers the full security operations lifecycle.
skillsecuritycybersecurityoffensivedefensiveclaude-code
by Masriyan Jul 18, 2026 7/10
skill GitHub
A shared, persistent memory system for AI assistants built on the Zettelkasten method — creates interconnected notes with backlinks rather than isolated memory entries. Implements slip-box-style knowledge management that grows more useful as your agent adds to it. Useful for research-heavy workflows.
memoryzettelkastenknowledge-baseAI-assistantspersistent
by mrosnerr Jul 18, 2026 6/10
skill GitHub
A Claude Code skill for auditing iOS and iPadOS apps before App Store Review, recovering from rejections, and catching low-effort craft signals that reviewers flag. Helps developers pass App Store review faster by catching common rejection reasons before submission.
skilliOSapp-storereviewauditmobile
by ElxMaj Jul 18, 2026 6/10
skill GitHub
A comprehensive plug-and-play collection of AI skills and prompts for Claude Code, Claude Desktop, Cursor, Antigravity, OpenAI Codex, Gemini CLI, and every major AI coding agent. All in portable SKILL.md format with a browser-based Prompt Builder. Single repository that works everywhere.
skillscross-agentportableSKILL.mdpromptsclaude-code
by Amey-Thakur Jul 18, 2026 7/10
skill GitHub
A falsification-first investigation and invention workflow for Claude Code featuring hypothesis ledgers, controlled experiments, REFUTE-first verification, and provable invention. Encodes the scientific method into an agent skill so Claude approaches problems empirically rather than jumping to conclusions.
skillscientific-methodhypothesisverificationclaude-code
by 88plug Jul 18, 2026 7/10
skill GitHub
A skill for driving an interactive full-screen TUI on a remote machine over tmux/screen + SSH using a type-wait-screenshot-read loop. Enables Claude Code to operate remote applications that do not expose an API. Useful for AI-assisted sysadmin tasks on remote machines with terminal-only interfaces.
skillremoteSSHTUItmuxautomationsysadmin
by 88plug Jul 18, 2026 7/10
skill GitHub
Open-source agent skills for Claude Code, Codex, GitHub Copilot, and other coding agents — features GPT-5.6-style rigor, delegation patterns, linear probes, and self-evolving workflows. A general-purpose skill collection that covers common development tasks across multiple agent runtimes.
skillsclaude-codecodexcopilotopen-source
by anshmajumdar121 Jul 18, 2026 6/10
skill GitHub
A minimal Agent Skills runtime implementing the Google/Kaggle whitepaper pattern behind Claude Skills — folders of SKILL.md, cheap catalog routing, progressive disclosure, and bundled deterministic scripts. Also runs free local Ollama models. Good for understanding how Claude Code skills work under the hood.
skillsruntimeskill.mdclaude-codeollamawhitepaper
by syedahmad0786 Jul 18, 2026 7/10
skill GitHub
A lightweight agentic memory system specifically for Claude Code that gives your agent persistent recall across sessions. Simple to set up with minimal dependencies. Good starting point for users who want session memory without the complexity of a full MCP-based solution.
memoryclaude-codepersistenceskill
by laiso Jul 18, 2026 6/10
skill GitHub
A tool for recovering Claude Code sessions after an Anthropic API output-classifier false positive. JSON-aware JSONL log surgeon that removes the triggering message and refusal turn, re-stitches the parent UUID chain so the session resumes cleanly. Also installs a per-repo CLAUDE.md framing guard.
recoveryfalse-positivesessionjsonlclaude-codeCLAUDE.md
by 88plug Jul 18, 2026 7/10
skill GitHub
A skill that makes Claude Code judge task complexity from its own training and ground itself before acting — then hard-blocks the irreversible step until grounding is complete. Prevents rushed execution on complex tasks by enforcing a think-first gate. Useful for high-stakes automated workflows.
skillsafetygroundingclaude-codecomplexity
by 88plug Jul 18, 2026 6/10
skill GitHub
Cross-session, cross-CLI memory for AI coding assistants with data-driven operator discovery from your own transcripts. Includes 23 MCP tools, 5 hooks, 15 commands, and 8 CLI adapters. One of the most comprehensive memory systems available for Claude Code users who switch between tools.
memorycross-sessionmcphooksclaude-codetranscripts
by 88plug Jul 18, 2026 8/10
skill GitHub
A plugin for Claude Code and Codex that captures non-obvious learnings as you code and automatically recalls relevant ones the next time you hit a similar situation. Builds a personal knowledge base of hard-won insights without requiring you to manually document them. Passive and lightweight.
memorylearningskillclaude-codecodexknowledge-base
by aoc81 Jul 18, 2026 8/10
skill GitHub
An agent skill plus a one-file RSVP reader for markdown reports — your AI agent reads the codebase and you speedread the report using rapid serial visual presentation. Makes consuming long AI-generated codebase analysis much faster. Useful for large codebases where the analysis output itself is substantial.
skillreadingRSVPcodebasereportsproductivity
by jordan-gibbs Jul 18, 2026 6/10
skill GitHub
A sprint conductor skill for Claude Code that drives one sprint from a markdown backlog to a merged branch — fresh context per stage, three human gates, all state stored on disk. Provides structure for multi-day or multi-session sprints without losing progress. Inspired by physical sprint ceremonies.
skillsprintworkflowbacklogclaude-codegit
by bessavagner Jul 18, 2026 7/10
skill GitHub
A collection of Claude Code skills for Rails development and consulting with emphasis on learning, communication, and client success. Built by the thoughtbot team with production Rails consulting experience. Useful for Rails developers who want battle-tested patterns encoded into skills.
skillrailsrubyconsultingthoughtbotdevelopment
by thoughtbot Jul 18, 2026 6/10
skill GitHub
Hold the middle mouse button to dictate voice-to-text input into Claude Code on Windows. A zero-friction way to add voice input without switching apps or using hotkeys. Useful for accessibility or for users who prefer speaking prompts over typing.
voiceinputwindowsclaude-codeaccessibilityplugin
by Pr1m4lc0d3 Jul 18, 2026 7/10
skill GitHub
A memory OS and governance layer for AI agents covering workflows, dispatch, proof, and context continuity. Provides structured memory management that goes beyond simple file storage to include governance policies and proof mechanisms. Useful for teams building auditable AI workflows.
memorygovernanceAI-agentsworkflowcontext
by lac5q Jul 18, 2026 6/10
skill GitHub
A collection of senior-level .NET review rules for AI coding agents compiled from a single source into Claude Code skills, Cursor rules, and Copilot instructions. Covers Spring AI, threading, performance, and security patterns. Useful for .NET teams who want consistent, expert-level code review across their AI tools.
skilldotnetcode-reviewclaude-codecursorcopilot
by Sarmkadan Jul 18, 2026 6/10
skill GitHub
Generates README.md, LICENSE.md, SECURITY.md, and llms.txt from a scan of your repo — never inventing facts, no guessed licenses, no fabricated benchmarks. A Claude Code skill with 8 modes, 7 protocols, and 4 bundled figlet fonts. Solves the tedious task of writing accurate public-facing repo documentation.
skilldocumentationreadmelicensesecurityllms.txt
by ndisisnd Jul 18, 2026 7/10
skill GitHub
A quality pipeline skill for Claude Code where the AI reviews, scores, revises, and blind-checks its own output before delivering it to you. Implements a structured self-review loop that catches common mistakes the model would otherwise miss. Particularly useful on high-stakes outputs where a second pass matters.
skillqualityself-reviewclaude-codepipeline
by gavinzzc Jul 18, 2026 7/10
skill GitHub
Shared infrastructure for AI-assisted research workflows including Claude Code skills, conventions, methodology documents, and tools. Provides a structured starting point for researchers using AI coding agents in academic or analytical work. Designed to be composable with other skill sets.
skillresearchacademicworkflowclaude-code
by hsigstad Jul 18, 2026 6/10
skill GitHub
A multi-agent orchestration skill for Claude Code designed for unattended, long-running engineering tasks. Manages task delegation, coordination, and completion across multiple sub-agents without requiring a human to stay in the loop. Useful for overnight or weekend agent runs.
skillmulti-agentorchestrationunattendedclaude-code
by Azure99 Jul 18, 2026 7/10
skill GitHub
A lexicon, linter, and rewrite gate for the private dialect AI coding agents develop on long runs — scores, blocks, and rewrites AI jargon into plain language. CC0 dictionary so anyone can contribute. Addresses the real problem of model outputs becoming increasingly opaque and unreadable over long sessions.
skilllinterjargonlanguagequalityclaude-code
by YunyueLi Jul 18, 2026 6/10
skill GitHub
A skill that acts as your CTO for evaluating AI skill repos — paste a link, get a straight verdict: install it, cherry-pick parts, or skip it entirely. Reads every file in the repo so you do not have to evaluate raw skill quality yourself. Saves time when browsing the growing skill ecosystem.
skillevaluationcode-reviewclaude-codecuration
by wallmage Jul 18, 2026 7/10
skill GitHub
A MIF-first documentation skill suite for Claude Code covering eight document genres: Diataxis, ADR, RFC/PEP, runbook, PRD, Kiro, arc42/C4, and changelog. Implements structured documentation from MIF Level 1 to Level 3. Provides one skill per genre so you can generate well-structured docs without switching tools.
documentationskillclaude-codeadrrunbookprd
by modeled-information-format Jul 18, 2026 7/10
skill GitHub
A curated daily-driver collection of skills for agentic coding, managed with the vd CLI tool. Designed to be portable and agent-agnostic so the same skills work across different AI coding assistants. The companion vd CLI makes it easy to install, update, and manage skills as versioned packages.
skillsclaude-codecodexvd-cliportable
by vanducng Jul 18, 2026 7/10
skill GitHub
A domain-agnostic LLM-wiki template for Claude Code where the AI agent maintains and updates the knowledge base as you work. MIT licensed, it gives your agent a living reference document that stays current without manual upkeep. Solves the problem of context files drifting out of date.
memoryknowledge-baseclaude-codecontextskill
by JX-29 Jul 18, 2026 6/10
skill GitHub
An agent skill that turns messy notes into rendered strategy-consulting-style visuals with SVG output and validation. Produces McKinsey-style charts and frameworks from plain text input. Useful for product managers, consultants, and analysts who want polished visualizations without manual design work.
skillvisualizationSVGstrategyconsulting
by kgraph57 Jul 18, 2026 6/10
skill GitHub
An agent skill that translates dense coding-agent plans into plain, decision-focused language with everyday analogies. Strips jargon and technical framing while keeping the stakes clear so non-technical stakeholders can follow along. Useful when you need to communicate AI-generated plans to a broader audience.
skillcommunicationplanninglanguagesimplification
by breadoncee Jul 18, 2026 6/10
skill GitHub
A cross-model adversarial review skill for Claude Code where Fable orchestrates and GPT (via Codex CLI) probes for weaknesses. Verdicts are ratified through a structured disagreement process. Works without an API key using your ChatGPT subscription, making multi-model code review accessible.
code-reviewmulti-modeladversarialskillclaude-codegpt
by raichominev Jul 18, 2026 7/10
skill GitHub
A universal agent skill that converts vague requirements into structured, bounded, execution-ready plans. Optimized for Codex but works across agent runtimes including Claude Code. Helps avoid the common problem of agents building in the wrong direction because the spec was underspecified.
skillplanningspeccodexclaude-code
by xscanzm Jul 18, 2026 6/10
skill GitHub
A meta-skill suite for building better Claude Code skills — covers creation, installation, auditing, releasing, regression testing, and sediment removal. Provides a structured lifecycle for skill development so your skills do not rot over time. Essential for anyone building and maintaining a skill library.
skillmetadevelopmentlifecycletestingclaude-code
by Songhonglei Jul 18, 2026 7/10
skill GitHub
A starter kit that keeps Claude Code on course across sessions with repo-based memory that survives context compaction, enforced hooks and permissions, and a phased workflow. Designed for teams who want consistent, traceable, secure AI coding sessions. Can be cloned standalone or installed as a plugin.
starter-kitsecurityhooksmemoryclaude-codeworkflow
by muratsilahtaroglu Jul 18, 2026 8/10
skill GitHub
Provides four slash commands for Claude Code — tag, save, summary, and audit — that rename messy AI chats and remember what they did. Stores session records as plain markdown on your Desktop so you can find past work without digging through JSONL files. Simple and zero-dependency.
skillsessionmemoryclaude-codecommandsmarkdown
by youkistudios Jul 18, 2026 7/10
skill GitHub
Thirty modular skills covering the full academic research workflow — topic selection, literature search and analysis, research design, data analysis, and full draft writing. Each skill can run independently or be composed into pipelines; works with Claude Code and Codex.
academicresearchskillsworkflow
by qiaomiaojoe Jul 17, 2026 5/10
skill GitHub
Five-tier search that finds, scores, and ranks the best library for your specific tech stack with deterministic scoring and a built-in security gate. No Reddit threads or outdated blogs — works with Claude Code, Claude.ai, Codex, and Antigravity.
skilllibrariesscoringdiscovery
by Magithar Jul 17, 2026 7/10
skill GitHub
Encodes team standards (brand voice, API contracts, compliance, test discipline) as Markdown skills that the bot cites by name on every PR review. One-command setup via npx and project-aware without requiring a custom integration.
pr-reviewskillteamstandards
by thrillmade Jul 17, 2026 7/10
skill GitHub
Provides bounded repository memory and evidence-backed documentation intended for coding agents. Keeps agent knowledge scoped to what is verifiably true about the repo rather than allowing unbounded memory drift.
memorydocumentationboundedevidence
by Statusnone420 Jul 17, 2026 7/10
skill GitHub
Write Claude Code skills and agents as notes in an Obsidian vault using Johnny Decimal organization, then export them to a native Claude Code plugin via an Obsidian plugin and MCP server combo. Brings all the linking and search of Obsidian to skill authoring.
obsidianskillpluginorganization
by nelsonlove Jul 17, 2026 8/10
skill GitHub
Stores rules you can enforce, state you can derive, and context you can query as plain files in your repo — compatible with any coding agent. Agent-agnostic alternative to proprietary memory formats that works via standard file reads.
rulesstatecontextagent-agnostic
by mmnto-ai Jul 17, 2026 7/10
skill GitHub
Portable skill for handing off working context between AI sessions with a strict single source of truth. Works across any project and any agent. Useful for maintaining continuity when hitting context limits or switching agents.
skillcontexthandoffsession
by uchimata2 Jul 17, 2026 7/10
skill GitHub
Optimizes the description frontmatter of Claude Code skills — the text Claude uses to decide whether to invoke the skill. Both evaluation and improvement run through the claude -p CLI so no API key is required. Helps skills fire reliably without manual tuning.
skilloptimizationdescriptionautomation
by netopsengineer Jul 17, 2026 8/10
skill GitHub
Provides a reusable Python project harness with CLAUDE.md scaffold, hooks, agents, and skills, plus an optional plugin. Drop it into any Python project for an instant Claude Code-ready setup with best-practice structure.
pythonharnessscaffoldhooks
by brunovicco Jul 17, 2026 7/10
skill Reddit
Overdrive is a one-command installer that packages 160 curated skills (each pinned to a reviewed commit with licenses checked), a custom skill router that loads only what the current task needs, global instructions adapted from Karpathy's Claude prompt, and a .overdrive/ project state system that persists decisions and progress across sessions. Works with Claude Code, Codex, Gemini CLI, Cursor, and Antigravity.
skillssetupskill-routerstate-managementworkflow
by StefanDumitru Jul 16, 2026 8/10
skill GitHub
A Claude Code skill that identifies and removes 16 specific patterns that mark code as AI-generated, making the output read as human-authored. Research-backed detection of AI coding tells, designed to be model-agnostic. Aimed at developers who need to blend AI-generated code into existing codebases without stylistic friction.
skillcode-styleai-detectionhumanize
by avi-dev-user Jul 16, 2026 6/10
skill Reddit
Think Before Code is a suite of 8 Claude Code skills turning the agent into a Socratic DSA tutor — one focused question at a time, graduated hints, required manual dry runs, and refusal to replace the learner's code during debugging. Covers problem decoding, dry runs, debugging, complexity analysis, test design, pattern transfer, and mock interviews. Drop a skill directory into Claude Code or paste the SKILL.md.
skillsdsatutoringlearningsocratic
by Agitated_Crew_368 Jul 16, 2026 7/10
skill GitHub
A skill and CLI that lets LLM agents (Claude Code and others) manage Google Jules coding sessions via REST API — checking status, sending instructions, retrieving reports, merging results, and closing sessions. Useful for orchestrating Jules as a sub-agent in a larger multi-agent workflow from Claude Code.
skillgoogle-julesrest-apimulti-agentorchestration
by Laurenfeminine36 Jul 16, 2026 6/10
skill GitHub
An experimental toolkit using Claude Code skills and deterministic Python executors to handle non-billable administrative work at German law firms — tasks that consume associate time without generating revenue. Demonstrates domain-specific Claude Code applications in a regulated professional context. Not intended for legal advice.
legalskillsgermanylaw-firm
by eliasreiche Jul 16, 2026 5/10
skill GitHub
product-playbook is a principle-driven Claude Code skill set with 18 sequential commands covering each phase of product development, from initial spec through shipping. Evidence-based gates between phases prevent skipping steps or drifting off track. Designed to keep both the developer and the AI disciplined through the full build cycle.
skillsproductworkflowpipelinediscipline
by kish21 Jul 16, 2026 7/10
skill GitHub
A Claude Code skill that acts as a signal radar, applying smart triage to prioritize and filter incoming signals. Useful for teams managing high-volume information streams that need intelligent routing before action. Targeted specifically at Claude Code workflows with AI-driven categorization.
signal-triageskillautomationfiltering
by Kaydevi Jul 16, 2026 5/10
skill Reddit
A Claude Code skill that scans your permissions.allow list, identifies every rule already covered by a broader one, and removes the redundant entries without narrowing what is actually allowed. Addresses the common problem of allowlists growing to hundreds of dead rules over time — particularly WebFetch per-domain rules made pointless by a single wildcard. Pairs with the built-in /fewer-permission-prompts, which stops future bloat.
skillpermissionscleanupallowlistmaintenance
by Myth_Thrazz Jul 16, 2026 8/10
skill GitHub
A Claude Code skill that simulates the toughest skeptical reader for business documents — offers, pitches, and strategy docs. It maintains a memory of where your writing has historically been weak and targets those areas first in each review. Produces critical, adversarial feedback rather than encouraging polish.
skillwritingadversarialdocument-reviewstrategypitches
by FermainPariz Jul 16, 2026 6/10
skill GitHub
A Claude configuration framework that centralizes memory files, skills, and agent definitions in a single versioned repository with a one-command installer. Lets you maintain a personal or team Claude setup that can be reproduced on any machine in seconds. Covers CLAUDE.md, skill files, and agent prompts in a structured layout.
configskillsmemoryagentsversionedinstall
by RemiAsselin42 Jul 16, 2026 6/10
skill Reddit
A Claude Code skill that runs at the end of each session: verifies all factual claims made during the session, greps for loose ends in the written code, produces a handoff.md, and then spawns a cold review agent to audit all of it independently. Designed to catch the common pattern of an agent hallucinating success — including catching a prior Opus session going off-rails.
skillsession-auditclaim-verificationhandoffquality-controlreview
by Mammoth_Pain2075 Jul 16, 2026 7/10
skill Reddit
A Claude Code skill filling what agents typically miss in React Native: exact App Store Connect and Google Play field character limits, correct EAS Build profiles, iOS vs Android permission configs side by side, and fixes for 8 common terminal errors. Works with Claude Code, Cursor, and Windsurf.
react-nativeskillsapp-storeeas-buildiosandroid
by Direct-Attention8597 Jul 16, 2026 8/10
skill GitHub
A drop-in context system built around seven structured files that give AI coding agents consistent, organized context across sessions. A minimal CLAUDE.md-adjacent approach to keeping agents oriented.
contextCLAUDE.mdskillsstructureagents
by thegreenanchor Jul 16, 2026 6/10
skill Reddit
A free skill that forces Claude Code to try to prove you wrong before it gives you an answer. Counters the "you're absolutely right!" problem where Claude agrees too readily, turning 3-hour decision debates into minutes.
sycophancyskillscritical-thinkingreasoning
by AccomplishedCut6374 Jul 16, 2026 7/10
skill Reddit
A write-up and skill set for connecting a Linux AI agent to a macOS machine via SSH to boot Tart VMs, take screenshots, click, type, and record video — enabling macOS-specific testing (Gatekeeper, TCC prompts) from a Linux agent. Uses a one-seam CLI design with stdout for data and stderr for logs.
macosvmtartsshskillstestinglinux
by jonnyzzz Jul 16, 2026 7/10
skill GitHub
Safely audits and synchronizes coding-agent instruction files (CLAUDE.md, AGENTS.md, .cursorrules, etc.) across Codex, Claude Code, Cursor, Copilot, Gemini CLI, and OpenCode. Keeps your rules consistent when using multiple coding agents on the same project.
AGENTS.mdCLAUDE.mdsyncrulesmulti-tool
by starinzlob Jul 16, 2026 7/10
skill GitHub
A privacy-conscious macOS file inbox workflow using SwiftBar, Claude Code, safe file moves, a ledger, and undo support. Automates the organization of an incoming file folder while keeping all data local.
macosfilesautomationswiftbarprivacy
by shaowen-ye Jul 16, 2026 6/10
skill GitHub
Free add-ons for Claude AI that teach it new skills — including finding hidden-gem YouTube videos and converting PDFs and Word docs into clean editable text. No coding required to install or use.
skillsyoutubepdfno-codeclaude
by ErickRamirezAU Jul 16, 2026 5/10
skill GitHub
A living library of B2B marketing Claude skill files built from expert insights on the Exit Five podcast. Auto-updates with new episodes — practical marketing skills sourced directly from practitioner-level discussions.
marketingb2bskillspodcastauto-update
by the-nam-shub Jul 16, 2026 5/10
skill GitHub
A lifecycle-first operating system for AI-assisted engineering, architecture, research, UX, infrastructure, and decision-making. Provides a unified framework for managing the full agent-assisted software development lifecycle.
operating-systemlifecycleengineeringresearchskills
by ignazio-ingenito Jul 16, 2026 7/10
skill GitHub
A skill workflow based on mattpocock/skills that guides agents from planning through verifiable goal definition to fresh-session implementation. Ensures each session starts with clear, testable objectives.
skillsplanninggoalsworkflow
by tt-a1i Jul 16, 2026 6/10
skill GitHub
A lightweight agent skill that records deferred follow-up checks in a repository-local WATCHLIST.md file. No daemon, no cron — just structured pending-check notes that agents can read and update across sessions.
skillstasksfollow-upmarkdownlightweight
by dd3ok Jul 16, 2026 6/10
skill GitHub
A backend security Agent Skill that helps AI audit code for vulnerabilities and generate secure-by-default backend applications. Provides deep Django/DRF coverage and guidance for other backend stacks — covers OWASP and common injection patterns.
securityauditdjangobackendskillsowasp
by n-shadloo Jul 16, 2026 7/10
skill GitHub
A comprehensive open-source handbook covering AI coding tools, coding agents, MCP servers, AGENTS.md, prompts, engineering workflows, security, and team adoption. A reference resource for teams adopting AI-assisted development.
referencemcpAGENTS.mdsecurityteamhandbook
by AnkitParekh007 Jul 16, 2026 7/10
skill GitHub
Provides thin AGENTS.md templates and modular skills to quickly make any repository agent-ready. A minimal, composable starting point for projects that want to work well with Claude Code and other coding agents.
AGENTS.mdtemplatesskillsagent-ready
by ek0212 Jul 16, 2026 6/10
skill GitHub
Like npm audit but for agent skills: pins skills to verified versions, verifies integrity, and gates execution through audit checks. Prevents unreviewed or tampered skills from running in your Claude Code sessions.
securityauditskillspinningintegrity
by FirstCastSolutions423 Jul 16, 2026 7/10
skill GitHub
A persistent context manager for multi-feature development with AI coding agents (Cursor, Claude Code, Codex). Maintains structured context across sessions so agents stay oriented on the right feature when context switches.
contextpersistencemulti-featureclaude-codeskills
by radhakishan404 Jul 16, 2026 6/10
skill GitHub
Provides long-term, cross-project memory for AI coding agents using your Obsidian vault as the source of truth. Daemonless, no opaque databases — your memory files are plain Markdown you own and can edit directly.
memoryobsidiancross-projectlong-termlocal-first
by ccf Jul 16, 2026 8/10
skill GitHub
Inverts short, unpolished prompts into Principal-level engineering directives aligned to the right discipline, then executes them. Built for vibe coders and lazy prompters who want better output without writing detailed prompts themselves.
promptsskillsengineeringclaude-codecodex
by Wishmeh Jul 16, 2026 7/10
skill GitHub
A Claude Code skill for creating, managing, and operating macOS virtual machines using the Orka3 CLI from MacStadium. Enables agents to provision and control cloud macOS VMs programmatically.
macosvmorka3skillsmacstadium
by macstadium Jul 16, 2026 6/10
skill GitHub
A multi-source drug-target due diligence pipeline for biomedical research: takes a ranked gene list and generates per-gene dossiers across UniProt, OpenTargets, and PubMed with cross-lineage DE scanning and composite re-ranking. A Claude Code/OpenClaw/SkillsMP skill.
biomedicalresearchskillsdrug-discoverymcp
by Agents365-ai Jul 16, 2026 5/10
skill GitHub
Open-source agent skills for building Markdown knowledge vaults with deterministic validation and research workflows. Keeps knowledge bases scope-safe and structured for AI agent use.
knowledge-basemarkdownvaultskillsresearch
by pariyar07 Jul 16, 2026 6/10
skill GitHub
A structured session framework for AI-assisted design: casts a stable brief first, then explores against it, and ships decisions alongside the work with a check that the original brief still holds. Prevents design drift during long agent sessions.
designframeworkskillsbriefsessions
by iruhdam1 Jul 16, 2026 5/10
skill GitHub
A plugin containing skills for AI-assisted project orchestration — structured for coordinating multiple workstreams and managing project state within Claude Code sessions.
orchestrationproject-managementskillsclaude-code
by jrjsmrtn Jul 16, 2026 6/10
skill GitHub
Provides architecture guidelines and code templates for AI agents to scaffold and maintain production-ready React Native (Expo) projects consistently. Keeps agents on the right structural path across long development sessions.
react-nativeexpoarchitectureskillsmobile
by Fredjuel Jul 16, 2026 5/10
skill GitHub
Fourteen invocable skills that carry a change from brainstorm through shipping, with an embedded harness deciding how careful to be at every step based on risk assessment. Provides a structured, risk-aware workflow for feature delivery.
skillsrisk-gatesdeliveryworkflowclaude-code
by minhtran3124 Jul 16, 2026 7/10
skill GitHub
A skill suite for writing STEM textbooks using Understanding by Design (UbD) reverse-design methodology. Guides agents through teaching positioning, chapter tree gating, chapter-by-chapter writing, and verified example calculation — with interrupt-and-resume support.
educationtextbookskillsstemwriting
by cabbage2000-lab Jul 16, 2026 5/10
skill GitHub
A curated marketplace of everything built for Claude Code — organized by category into plugins, skills, commands, and agents. A single-stop collection for extending Claude Code functionality.
pluginsskillsmarketplaceclaude-code
by smk-labs Jul 16, 2026 6/10
skill GitHub
Teaches design judgment to Claude Code, Codex, and Cursor — not just data. Includes 74 rules, 48 components, 7 brand skins (Toss/Stripe/Linear/Notion/Raycast/Arc/Vercel), a named motion system, and 15 /ss-* skills to stop shipping AI-generated-looking UI.
designuiskillsbrandcssfrontend
by bitjaru Jul 16, 2026 8/10
skill GitHub
A collection of skills for agentic coding, creator, and automation workflows maintained by geekjourneyx. Compatible with Claude Code and other agent-compatible systems.
skillsautomationcodingworkflows
by geekjourneyx Jul 16, 2026 5/10
skill GitHub
A design skill for Claude Code, Cursor, and any coding agent that transforms AI-generated UI into shippable, tasteful frontend. Install via npx skills add. Powered by superdesign.dev.
designuifrontendskillsclaude-code
by superdesigndev Jul 16, 2026 7/10
skill GitHub
An open-source Claude Code skill that takes screenshots of an existing mobile app and generates a working Expo/React Native project from them. Useful for rapid prototyping and learning from existing UI patterns.
mobilereact-nativeexposkillsclone
by Birkenpapier Jul 16, 2026 7/10
skill GitHub
Create YouTube Shorts, TikTok, Instagram Reels, and long-form videos from within Claude Code or Cursor. Supports 1,300+ voices and 27+ visual styles for automated video production workflows.
videoskillstiktokyoutubemedia
by aituberapp Jul 16, 2026 6/10
skill GitHub
A local-first agent skill for searching lecture materials with citation awareness, generating Q&A, creating flashcards, and building study guides from academic content. Designed for students and researchers.
educationflashcardsresearchskillsstudy
by haixinnn05 Jul 16, 2026 6/10
skill GitHub
A Claude Code skill for sourcing technical candidates — automates and structures the candidate research and outreach workflow for engineering recruiters.
recruitingsourcingskillshr
by Da6ka Jul 16, 2026 5/10
skill Reddit
A practitioner shares key insights from extended Claude Code use: always document before running loops, use DAGs for structured task flows, build custom hooks for prompt validation and memory injection, and treat prompt engineering as a multi-hour collaborative project. Includes specific skill examples for session behavior.
best-practicesloopsskillshooksdags
by Competitive-Net-5306 Jul 16, 2026 7/10
skill Reddit
Discussion of how Claude Code handles skills that conflict on ordering — specifically when two skills both want to run "first." Raises the question of priority resolution and unpredictable behavior when multiple skills install competing step-zero instructions.
skillsorderingconflictsbest-practices
by NoBarber4287 Jul 16, 2026 5/10
skill Reddit
A kanban skill for Claude Code that converts rough goals into structured tasks, does keyword research for content, learns from feedback via auto-pruning memory, and generates daily prioritization reports. Built for solo founders managing product, marketing, and engineering in one agent loop.
kanbanskillsmemoryproductivitysolo-founder
by void_tao Jul 16, 2026 7/10
skill GitHub
A set of Claude Code skills for internationalizing and localizing applications. Provides structured workflows for handling translations and locale management within coding agent sessions.
i18nl10nskillsglobalization
by globalize-now Jul 16, 2026 6/10
skill GitHub
Automates research card creation in the style of Hung-yi Lee — supports plain Markdown, Obsidian, and Heptabase backends with bidirectional sync. Driveable by Claude Code or Codex for systematic academic and technical research workflows.
researchobsidianskillsknowledge-management
by SungFeng-Huang Jul 16, 2026 7/10
skill GitHub
A thin Claude Code skill that triages 15 specialized data domains and auto-configures the right MCP sources for market intelligence. Includes a deterministic refresh pipeline with adversarial verification, companion-config auto-registration, and citation guardrails.
market-researchskillsmcpdata
by DaizeDong Jul 16, 2026 7/10
skill GitHub
A curated collection of practical, portable skills designed for agentic coding workflows. Focused on real-world utility that transfers across different projects and coding agent environments.
skillsportablecoding-workflows
by kyungseo Jul 16, 2026 6/10
skill GitHub
A lean, project-neutral operating system for Claude Code featuring auto-maintained docs, deterministic hooks, an independent evaluator, watchable and headless autopilots, and portable skills. Designed for solo engineers who want a structured, reusable Claude Code baseline.
claude-codesetuphooksskillsautopilot
by jaimeberdejo Jul 16, 2026 8/10
skill GitHub
A Claude Code plugin that connects AI strategy generation to backtesting and live trading. Enables coding agents to participate in the full trading development loop — from strategy ideation through execution.
tradingskillsbacktestingfinance
by multiwave-co-ltd Jul 16, 2026 6/10
skill GitHub
A personal skill collection compatible with any AI agent that supports ~/.agents skills, including Claude Code, Cursor, and OpenCode. Covers common coding, automation, and workflow tasks.
skillsportableclaude-codecursor
by itsgitz Jul 16, 2026 5/10
skill GitHub
A skills marketplace with backend and frontend engineering conventions plus step-by-step integration recipes for Stripe, Singpass/Keycloak OIDC, Twilio SMS, Docker, and CI/CD. Covers NestJS/TypeScript and React in a language-flexible format.
skillsbackendfrontendintegrationsnestjsstripe
by kennguyen887 Jul 16, 2026 7/10
skill GitHub
A skill + MCP server that converts rough notes into schema-validated slide decks and exports native PowerPoint, Keynote, and Google Slides. Works with Claude Code, Cursor, Codex, Gemini CLI, and Copilot — letting any AI agent produce presentation-ready output.
skillmcppresentationspowerpointkeynotegoogle-slides
by isatimur Jul 16, 2026 7/10
skill GitHub
trackbed provides roadmap, status, and orchestration as pure agent skills — no framework required. Works with Claude Code, OpenCode, and GitHub Copilot CLI. Keeps the project management rails lightweight and portable across AI coding tools.
skillsroadmaporchestrationproject-management
by Orfi Jul 16, 2026 6/10
skill GitHub
An agent skill that generates and refreshes an internal architecture wiki with decisions anchored to source files and PRs. Works with Claude Code and any agent supporting the Agent Skills format. Keeps documentation in sync as the codebase evolves.
skillwikidocumentationarchitecturepr-tracking
by sirius-zuo Jul 16, 2026 7/10
skill GitHub
An agent skill for ML/AI/CV/NLP researchers: point your coding agent at code, experiment logs, and a venue template to produce an evidence-backed LaTeX draft and submission package. Focused on auditable, evidence-backed output rather than generated fiction. Works with Claude Code and compatible agents.
skillresearchlatexmlacademic-writingpaper
by jin-s13 Jul 16, 2026 7/10
skill GitHub
Composable agent skills paired with project-scoped Nix environments. Provides reproducible, hermetic dev environments alongside agent skills — useful for teams that use Nix and want both reliable toolchains and agent workflow conventions in one package.
skillnixenvironmentsreproduciblecomposable
by 0xc000022070 Jul 16, 2026 7/10
skill GitHub
Curated knowledge files that accelerate server-side Swift development and Xcode Cloud automation when used with Claude Code. Brings Claude Code up to speed on Vapor, SwiftNIO, and Xcode Cloud conventions without repeated context-setting.
skillswiftserver-side-swiftxcode-cloudvaporknowledge-files
by Insolvent-pyrene754 Jul 16, 2026 6/10
skill GitHub
Integrates Hermes Agent skills directly into Claude Code for in-process agentic operations — no external process spawning or file locking. Lets Claude Code use Hermes-format skills as native first-class capabilities.
skillhermesintegrationagenticin-process
by Arseni6361 Jul 16, 2026 7/10
skill GitHub
A skill-based security framework for auditing Claude Code agents in adversarial environments. Detects vulnerabilities, social engineering attempts, and supply chain threats in agent sessions — based on SlowMist's security research methodology.
securityauditskilladversarialsupply-chainslowmist
by Leontynestirredup43 Jul 16, 2026 7/10
skill GitHub
A skill for managing Zenodo research artifacts directly from Claude Code or OpenClaw: automate deposits, generate citable DOIs, and manage research data releases through the Zenodo REST API.
skillzenodoresearchdoiacademicapi
by Georgiannebedded725 Jul 16, 2026 6/10
skill GitHub
A Claude Code plugin and Agent Skills pack that separates concerns by verb: distinct skills for design, review, TDD, and PR flow. Backed by deterministic git hooks as safety floors — so conventions are enforced even if the agent skips reading the skill.
skilltddcode-reviewgit-hookspr-flowdesign
by hayashiii-ghub Jul 16, 2026 8/10
skill GitHub
A Claude skill that maps inherited Excel models into an interactive HTML showing how every sheet, block, and line item connects — plus an audit of hardcodes, error cells, and circular references. Invoke with /sheet-happens in any chat, or ask naturally. Runs fully locally.
skillexcelauditspreadsheethtmlreverse-engineering
by Felixx1502 Jul 16, 2026 7/10
skill GitHub
An official Backblaze skill for managing B2 cloud storage from the terminal using natural language. Covers bucket management, file listing and search, storage auditing, security posture review, and safe cleanup of stale or large objects. Built on the Agent Skills specification and compatible with Claude Code.
skillcloud-storagebackblazeb2devops
by backblaze-labs Jul 16, 2026 7/10
skill GitHub
A curated set of 172 production-ready Claude Code skills from OneWave AI spanning sales, marketing, design, engineering, and AI agent architecture. Skills are maintained as a living collection, making it a broad starter toolkit for teams wanting coverage across business and technical workflows.
skillcollectionsalesmarketingengineeringagent-architecture
by OneWave-AI Jul 16, 2026 6/10
skill GitHub
slop-cop is a Claude Code skill that detects and rewrites generic AI patterns across multiple content types: prose, social posts, UI/design, and code. It grades drafts for slop markers (vague claims, repetitive rhetoric, happy-path-only logic) and rewrites them with specificity. Useful for de-slopping any AI-generated output before publishing.
skillcontent-qualityai-slopwritingcode-review
by howshannon Jul 16, 2026 6/10
skill GitHub
agbox is a local CLI that captures instructions you repeatedly give to AI agents (Claude Code, Codex, Cursor) and promotes them into AGENTS.md or CLAUDE.md memory files that agents actually follow. Reduces the "why won't it remember this?" friction by automating the capture-and-codify loop. Vendor-neutral, private, and reversible.
skillmemoryclaude-mdproductivityagent-memory
by qyinm Jul 16, 2026 8/10
skill GitHub
grok-skills lets Claude Code delegate tasks (review, reason, implement, verify) to xAI's Grok model via a sandboxed companion. Supports both hardened and direct modes. Useful for getting a second-opinion from a different model family without leaving your Claude Code workflow. Not affiliated with xAI.
skillgrokmulti-modelcode-reviewreasoning
by sfourdrinier Jul 16, 2026 6/10
skill GitHub
reflect is a Claude Code skill that runs your decisions through 23 compacted mental models drawn from Jeff Bezos, Charlie Munger, and the Farnam Street framework. It gives an opinionated call with reasoning and keeps a score of your predictions. Useful for high-stakes product, architectural, or strategic decisions.
skilldecision-makingmental-modelsproductivity
by seldonframe Jul 16, 2026 5/10
skill GitHub
tax-sarathi is a Claude Code skill for Indian income tax and ITR filing covering FY2025-26, with calculators for tax liability and live read-only verification against the e-filing portal via Playwright over CDP. The agent guides but does not submit — you retain control. Useful for Indian developers managing their own tax filings.
skilltaxindiaitrplaywrightcdp
by kumarrahul85 Jul 16, 2026 6/10
skill GitHub
A shareable Claude Code and Codex skill/agent infrastructure tailored for academic workflows. Includes skills, agents, hooks, and rules designed specifically for PhD research tasks. Targets the academic use case that generic setups often miss.
academicresearchPhDcodexskills
by flonat Jul 15, 2026 6/10
skill GitHub
A curated set of Claude Code skills covering git workflows, GitHub automation, security audits, code refactoring, and general project tooling. Each skill is ready to drop in and handles common developer tasks that benefit from repeatable AI-driven workflows.
gitgithubsecurityrefactoringautomationskills
by tartinerlabs Jul 15, 2026 7/10
skill GitHub
A stack of Claude Code skills targeting academic economists aiming to publish in top journals like AER and AEJ. Skills cover identification-first empirics, AEA-compliant replication packages, Keith Head–style introductions, and R&R rebuttals. Covers the full pipeline from topic selection to submission.
academiceconomicsresearchempiricsskills
by brycewang-stanford Jul 15, 2026 6/10
skill Reddit
Estuary built Claude Code agent skills for interacting with real-time data pipelines — configuring sources and destinations, creating pipeline specs, checking task health, pulling logs, and investigating failures. The skills keep pipeline configuration visible to the operator throughout. Demo covers both what Claude handles well and where human guidance is still needed.
data-pipelinesreal-timeestuarydevopsskills
by dani_estuary Jul 15, 2026 6/10
skill GitHub
A Claude Code skill that converts long videos into vertical 9:16 captioned short clips entirely locally — no cloud service required. Functions as a self-hosted alternative to Opus Clip. Handles cropping, captioning, and output formatting as a repeatable AI-driven workflow.
videoshort-formlocalskillcontent-creation
by joe-jns Jul 15, 2026 6/10
skill GitHub
A Claude skill that detects and removes robotic AI writing patterns from Spanish-language LLM output, learning the user's personal writing style over time. Addresses the common problem of LLM text sounding unnatural in Spanish. Useful for Spanish-speaking writers using Claude for content creation.
spanishwritingstyleslop-removalskill
by mszsorondo Jul 15, 2026 5/10
skill GitHub
A meta-skill that analyzes a repository's merged pull request history to generate a custom Claude Code skill tuned to that codebase's specific patterns, business logic, and conventions. The generated reviewer knows what matters in your project specifically, not just generic best practices. Clever self-bootstrapping approach to personalized AI code review.
code-reviewprmeta-skillskill-generationcodebase-aware
by paanSinghCoder Jul 15, 2026 8/10
skill GitHub
A Claude Code skill built from real use by an adult ADHD user, focused on zero-friction task execution and continuous memory capture. Avoids hidden costs and interruptions that disrupt focus, capturing context automatically so nothing is lost between sessions. Designed from lived experience rather than theory.
adhdaccessibilitymemoryfocusproductivityskill
by lubianiec Jul 15, 2026 6/10
skill GitHub
A collection of small, focused AI agent capabilities where each skill ships with a pre-declared kill criterion (when to retire it) and real usage numbers. Takes a disciplined, data-driven approach to skill management rather than accumulating skills indefinitely. Useful as a template for teams wanting to maintain skill hygiene.
skillsmetricslifecycledisciplineagent-skills
by AdityaVasireddy Jul 15, 2026 6/10
skill Reddit
Lemma is a Claude Code plugin that adds methodological rigor to data science work via a structured persona, task-specific skills (EDA, causal inference, etc.), and live notebook kernel access. Benchmarked against DSAEval, the base agent gave confidently wrong answers in 3/5 hard cases while Lemma reduced that to roughly 1 in 7. A well-validated approach to making Claude Code a more careful analysis partner.
data-scienceskillpluginbenchmarknotebookCLAUDE.md
by Spare_Suit3701 Jul 15, 2026 8/10
skill GitHub
A Claude Code plugin (also Codex-portable) that turns Claude into a personal editorial studio with a filesystem-based content board. Its voice memory learns from your own edits rather than relying on humanizer tools, so your distinctive style is preserved across AI-assisted writing sessions. Designed for writers who want consistent voice without cloud dependencies.
writingeditorialpluginvoice-memorylocal-firstCLAUDE.md
by dhalarewich Jul 15, 2026 6/10
skill GitHub
An open directory for discovering, comparing, creating, and safely installing SKILL.md workflows for Claude Code agents. Provides a curated hub with a safety-focused installation flow to vet community skills before adding them to your setup. Fills a real gap in the Claude Code ecosystem for skill discoverability and distribution.
skillsSKILL.mddirectorydiscoverycommunityworkflowsinstallation
by CarlosJunioor Jul 15, 2026 8/10
skill GitHub
A Claude Code skill providing IFRS (International Financial Reporting Standards) guidance with cited answers and audit support. Gives AI agents the ability to answer accounting standard questions and verify compliance against up-to-date IFRS requirements. Targeted at finance and accounting teams using Claude Code.
ifrsaccountingfinancecomplianceaudit
by babu9893 Jul 15, 2026 5/10
skill Reddit
A polished, free, open-source component and blocks library (shadcn registry compatible) designed to help Claude produce Apple-quality UI. Includes real app templates, composed components, tested UX flows, and full logic — not just generic dashboard widgets. Comes with Claude Code skills and instructions to guide it toward professional design output.
uicomponentsshadcndesignfrontendopen-source
by Admirable-Canary-732 Jul 15, 2026 7/10
skill GitHub
An opinionated Claude Code scaffold tailored for computer vision and data science projects, bundling skills, subagents, and enforcement hooks. Bakes in reproducibility practices and prevents evaluation set leakage by design. A strong starting point for ML practitioners who want Claude Code aligned with data science best practices.
data-sciencemachine-learningcomputer-visionreproducibilityscaffold
by BrendenKennedy Jul 15, 2026 7/10
skill GitHub
A portable Claude Code skill that detects and rewrites "sloppy" AI-generated prose into content with a real point of view. Uses a fidelity-first approach — it flags hollow spans and rewrites them with scored self-evaluation and iteration. Great for teams publishing content written or assisted by AI who want to avoid generic output.
writingproseai-slopcontent-qualityediting
by isatimur Jul 15, 2026 7/10
skill GitHub
A meta-skill (zero dependencies) that inspects SKILL.md files and scores them across six dimensions: trigger quality, length, progressive disclosure, script externalization, portability, and security (no hardcoded secrets). Outputs a scored report with fix suggestions. A sister tool to claude-md-doctor, useful for anyone building and maintaining a library of Claude Code skills.
skill-qualitylintingmeta-toolauditskill-md
by huiyonghkw Jul 15, 2026 6/10
skill GitHub
A Claude Code skill that runs a complete Design Thinking pipeline — Empathize, Define, Ideate, Prototype, Test, and Assess — as a sequence of chained subagents. Takes a SMART goal as input and produces a VIP business assessment. Useful for product and strategy work that benefits from a structured ideation process.
design-thinkingproductstrategysubagentsideation
by hyunbean Jul 15, 2026 6/10
skill GitHub
A Claude Code agent skill that reads actual Git diffs (not just commit messages) and generates a per-day project worklog under PROJECT_WORKLOG/ with an index file. Previews every change before writing and creates one Markdown file per day. Useful for developers who need to produce accurate time-stamped activity reports from code history.
gitworklogdocumentationreportingproductivity
by g761007 Jul 15, 2026 7/10
skill GitHub
An awesome-skills skill for building and verifying polished interactive HTML artifacts and responsive prototypes. Handles the full cycle of generation and visual verification. Useful for quickly producing UI demos, design handoffs, or interactive specs without leaving Claude Code.
htmlprototypedesignartifactui
by awesome-skills Jul 15, 2026 7/10
skill GitHub
An awesome-skills skill that builds and verifies browser-native HTML presentations optimized for laptops and projectors. Generates complete slide decks without external dependencies. A quick way to produce shareable presentations directly from Claude Code.
htmlpresentationslidesprototype
by awesome-skills Jul 15, 2026 6/10
skill GitHub
Portable Python code-review skills covering type safety, error handling, anti-patterns, async usage, and code style. A router skill dispatches to the most relevant focused reviewer for each concern.
pythoncode-reviewtype-safetyasyncanti-patterns
by CodeSigils Jul 15, 2026 6/10
skill GitHub
A custom Claude Code configuration that transforms the agent into a disciplined engineering partner with structured workflows, strict guardrails, and domain-specific expertise baked into the setup.
configurationclaude.mdguardrailsengineeringworkflows
by domengabrovsek Jul 15, 2026 6/10
skill GitHub
Audits web performance using a multi-agent pipeline that turns browser data into actionable fixes for Core Web Vitals and related metrics. Structures the audit as parallel agent passes over different performance dimensions.
web-performancecore-web-vitalsmulti-agentauditingoptimization
by sa746062 Jul 15, 2026 6/10
skill Reddit
A generic Claude Code skill for building shoppable lookbook sites hosted on GitHub Pages. Demonstrated by finding large-size hats — shows how to connect product search requirements to a published, browsable site.
ecommercelookbookshoppingskillgithub-pages
by DrewHoov Jul 15, 2026 5/10
skill GitHub
Reusable AI skill kits covering Docker, Kubernetes, Zabbix, ELK, and Grafana infrastructure — with skills, rules, and templates for coding agents. Includes .NET 10 examples.
devopsdockerkubernetesinfrastructureskills
by KhaiTrang1995 Jul 15, 2026 6/10
skill GitHub
The kb-* agent skill family for building and maintaining a portable knowledge base as an Open Knowledge Format (OKF) bundle, enabling persistent, structured project knowledge that travels with agents.
knowledge-baseokfportablememorydocumentation
by stjbrown Jul 15, 2026 6/10
skill GitHub
Sweeps Douyin, Xiaohongshu, Zhihu, Bilibili, YouTube, GitHub, X, and the web for first-hand practices, verifies claims with sub-agents, and converges on one actionable plan from a single research prompt.
researchmulti-channelsubagentsverificationactionable
by Somezak1 Jul 15, 2026 6/10
skill GitHub
An open library of small, install-and-own Claude Code skills including a wording linter and a pre-public secret scanner to catch exposed credentials before pushing. Each skill is self-contained and ownership-friendly.
skillslintingsecuritysecret-scanningutilities
by JayOfemi Jul 15, 2026 6/10
skill GitHub
A skill set for education: flashcard generation, concept explanation, study plans, exam prep, and research summaries. Covers both the learner and teacher roles with separate skill entries for each.
educationflashcardsteachinglearningstudy-plans
by prvthmpcypher Jul 15, 2026 5/10
skill GitHub
A collection of 26 Claude skills covering UI/UX, brand identity, typography, frontend design, accessibility, and visual storytelling — a broad toolkit for design-focused Claude Code workflows.
designui-uxbrandingtypographyaccessibility
by prvthmpcypher Jul 15, 2026 6/10
skill GitHub
Enforces acceptance-criteria-driven development for AI agents: done is a checklist, not a feeling. Keeps agents honest about completion by requiring machine-verifiable acceptance criteria before signoff.
acceptance-testingquality-gatestddverificationdone-criteria
by ZeusYue Jul 15, 2026 6/10
skill GitHub
Verifies AI research citations before trusting them: 4-tier source classification, re-citation chain detection, and URL/DOI/NTIS existence checking. Guards against hallucinated or misattributed sources.
fact-checkingresearchverificationcitationsquality-control
by parkjui92-tech Jul 15, 2026 6/10
skill GitHub
A curated skill collection for AI agents including first-party skills and vendored framework/CMS best practices for use with the Agent Skills ecosystem and skills.sh.
skills-collectioncmsframeworksbest-practicesagent-skills
by display-design-studio Jul 15, 2026 6/10
skill GitHub
An agent skill for producing professional academic economics slides in LaTeX/Beamer — handles paper-to-talk conversion, discussant decks, verified layouts, and accurate numbers. Designed for academic rigor.
latexbeamereconomicsacademicpresentations
by hanlulong Jul 15, 2026 5/10
skill GitHub
Agent skills for daily knowledge management: archive X tweets, threads, and articles into an Obsidian vault, with Telegram Saved Messages sync. Works with Claude Code, Codex, and Cursor.
obsidianknowledge-managementtwittertelegramarchiving
by soia-team Jul 15, 2026 6/10
skill GitHub
Agent skills for marketing on Threads: write posts, multi-post threads, hooks, replies, and weekly content plans in your voice. Publish via Publora. Open source, MIT.
marketingsocial-mediathreadscontentpublishing
by sergebulaev Jul 15, 2026 5/10
skill GitHub
Agent skills for TikTok content creation: 3-second video hooks, captions, trend mapping, and weekly content plans. Draft, humanize, and publish via Publora. MIT licensed.
marketingtiktokvideocontentsocial-media
by sergebulaev Jul 15, 2026 5/10
skill GitHub
A Claude Code skill that creates hand-drawn animated architecture diagrams — ink-on-beige-paper style with flowing dots. Exports as a self-contained HTML file or seamless-loop GIF.
diagramsanimationarchitecturehtmlvisualization
by OLDyade Jul 15, 2026 6/10
skill GitHub
A CLI and Claude Code skill that spots AI writing patterns, refines tone, and improves rhythm to rewrite AI-generated text into natural-sounding prose you can publish without detection.
writinghumanizationai-textclitone
by aprempeh-tech Jul 15, 2026 5/10
skill GitHub
A curated C# and .NET knowledge base that powers Claude with better code patterns and architecture decisions for .NET projects — injected as project context for consistently idiomatic outputs.
csharpdotnetknowledge-basepatternsarchitecture
by Myosinstringer459 Jul 15, 2026 5/10
skill GitHub
A test-gated, behavior-preserving agent skill that removes AI-generated code patterns: duplicated helpers, try-import fallbacks, broad excepts, and speculative abstractions. Only ships changes where tests still pass.
code-qualityrefactoringai-sloptest-gatedcleanup
by LeonardNJU Jul 15, 2026 7/10
skill GitHub
A portable Python project workflow skill covering greenfield bootstrap, tooling configuration, CI, packaging, mature-repo preservation, and cross-platform verification for agentskills.io-compatible agents.
pythonproject-setupcipackagingworkflow
by CodeSigils Jul 15, 2026 7/10
skill GitHub
Adds /obsidian:compress to save the current Claude Code session as a structured log in Obsidian, and /obsidian:resume to reload project context from those logs. Bridges session memory with a personal knowledge base.
obsidiansession-managementmemorypluginsknowledge-base
by ERuban Jul 15, 2026 7/10
skill GitHub
A Claude Code skill that takes one objective and runs a full gated development process using expert subagents, refusing to declare done until a machine-checkable gate passes. Bilingual (English/Korean) onboarding and live walkthrough included.
subagentsquality-gatestddworkflowverification
by cskwork Jul 15, 2026 7/10
skill GitHub
A Claude Code skill plus runbooks that put other coding models (Grok, Codex, local) on the review panel to provide independent QA for AI-written code. Cross-model review to catch what a single model misses.
code-reviewmulti-modelquality-assurancesubagents
by mattferry Jul 15, 2026 7/10
skill GitHub
A curated collection of practical patterns for agentic coding built from hundreds of Claude Code sessions — covering hooks, agents, and automation techniques with real-world examples.
best-practiceshooksagentsautomationpatterns
by anipotts Jul 15, 2026 7/10
skill Reddit
Claude loads a skill based on its description line, not its body — a vague description gets ignored while a trigger-specific one fires reliably. Covers the project vs user layer split (.claude/ in repo vs ~/.claude/), and common failure modes like hardcoding personal preferences into team CLAUDE.md files.
skillsclaude.mdconfigurationbest-practicesfrontmatter
by Bulky_Ad738 Jul 15, 2026 9/10
skill GitHub
A copy-paste-ready mirror of the agentscamp.com library, containing AI coding agent skills, commands, guides, and tools you can install directly. Makes community-published resources available as a Git-installable package. Good starting point for expanding Claude Code capabilities with curated community content.
skillscommandslibrarycommunityagents
by imtiazrayhan Jul 15, 2026 7/10
skill GitHub
A Claude Code skill for building a headless Ghost CMS blog with Next.js App Router, including Content API client, ISR with webhook revalidation, SEO configuration, and Koenig card styling. Packages a complete headless CMS stack into a reusable skill. Ideal for developers who use Ghost as a backend with modern React frontends.
skillghost-cmsnext.jsheadlessblog
by kasuncfdo Jul 15, 2026 5/10
skill GitHub
A task-launcher skill for Claude Code and Codex featuring tiered workflows, optional cross-model plan review between Claude and Codex, and PM-mode parallel sub-agents. Lets you kick off complex multi-step tasks with built-in checkpoints and model arbitration. Good for teams coordinating work across multiple AI coding tools.
skilltask-launcherworkflowcodexparallel-agents
by uniStark Jul 15, 2026 7/10
skill GitHub
Two Claude Code skills: Quick Recon for rapid research with fact-checking, and a multi-model caller for dispatching tasks across different AI providers. Useful for building Claude Code workflows that need external information gathering or want to compare outputs from multiple models. Bilingual documentation in Chinese and English.
skillresearchfact-checkmulti-modeldispatch
by GiaSip Jul 15, 2026 6/10
skill GitHub
Two decoupled Claude Code skills: one extracts lossless metadata and transcripts from YouTube videos, and a second transforms the transcript into Module → Feature → Requirement specs with every requirement linked to its exact transcript segment. Useful for turning conference talks, demos, or tutorial videos into structured specs. Ensures traceability from source material to requirements.
skillrequirementsyoutubetranscriptspecs
by alikmlsipahi Jul 15, 2026 7/10
skill GitHub
A skill navigator that helps Claude Code users discover, browse, and select the right skills for their task. Addresses the challenge of finding relevant skills in a growing ecosystem. Useful as a meta-tool for teams building large skill libraries.
skillnavigatordiscoveryclaude-code
by livevil7 Jul 15, 2026 5/10
skill GitHub
A practical guide collection with prompts and Python code for applying Claude Skills to data engineering and pipeline automation tasks. Covers common data engineering patterns adapted for use with Anthropic's Claude Skills API. Useful for data engineers who want to automate ETL, pipeline validation, and transformation logic with Claude.
data-engineeringskillpythonpipelineetl
by Methasit-Pun Jul 15, 2026 6/10
skill GitHub
Evidence-backed guide to 12 principles for writing reliable, predictable agent skills, inspired by Matt Pocock's public skills repository. Covers composition, clarity, and testability for Claude Code skill authors. A valuable reference for anyone building reusable skills who wants to avoid common pitfalls. Bilingual (Chinese and English).
skillbest-practicesguideprinciplesagent-design
by Conradgui Jul 15, 2026 7/10
skill GitHub
A Claude Code skill that automates publishing local projects to GitHub with zero-config proxy detection. Handles git init, remote setup, and push from within an agent session — designed to run unattended without manual credential configuration.
githubpublishinggitautomation
by zhongwentuo-creator Jul 15, 2026 7/10
skill GitHub
A collection of structured workflow skills for AI coding agents providing organized patterns for common development tasks. Gives agents repeatable, well-defined processes rather than ad-hoc problem solving, improving consistency across sessions.
workflowskillsstructuredcoding-agents
by tsukumogami Jul 15, 2026 7/10
skill GitHub
A Claude Code skill (also compatible with OpenCode, Copilot, Codex) that applies SOLID design principles and patterns while treating over-engineering as a bug — every abstraction needs concrete justification. Offers four configurable rigor levels from advisory to thorough.
soliddesign-patternsrefactoringskill
by FernandoJRR Jul 15, 2026 8/10
skill GitHub
A catalog of 29 free, verified agents, skills, and packs for Claude Code, installable via npx vanara install <name>. Part of the larger Vanara catalog of 206 items, released under Apache-2.0.
skillsagentscatalognpxverified
by vanara-agents Jul 15, 2026 8/10
skill GitHub
A package management system for personal AI that allows users to install, discover, and share skills, tools, agents, and prompts. Aims to create a discoverable ecosystem for AI extensions similar to how npm works for JavaScript packages.
package-managerskillsagentsdiscovery
by the-metafactory Jul 15, 2026 6/10
skill Reddit
A Claude Code skill plus macOS companion app that turns your screen into a transparent drawing canvas. Annotate live UI with circles and arrows while speaking, then Claude receives annotated screenshots plus a voice transcript. Transcription runs on-device via Apple SpeechAnalyzer — no API key, 100% local.
visualscreen-annotationmacosvoiceskillaccessibility
by obaid83 Jul 14, 2026 8/10
skill GitHub
Community-driven Claude Code plugins for managed service provider tooling covering PSA, RMM, and documentation systems. Open for community contributions — aimed at MSP engineers who want AI coding agent support for their day-to-day tools.
msppsarmmdocumentationpluginscommunity
by wyre-technology Jul 14, 2026 6/10
skill GitHub
Lets coding agents produce beautiful hand-drawn-looking diagrams authored as D2 text and rendered offline without a browser. The agent self-checks results by reading the PNG output to ensure the diagram matches the specification.
diagramsd2visualizationofflineself-checkskill
by alexander-posztos Jul 14, 2026 7/10
skill GitHub
Scans AI agent skills and MCP servers for prompt injection vulnerabilities, data leak risks, and supply-chain threats before deploying to production. Produces actionable security reports covering each detected risk category.
securityprompt-injectionmcpskillssupply-chainscanning
by salasi1204 Jul 14, 2026 8/10
skill GitHub
A Claude Code skill that assembles complete software project planning packages on demand — architecture proposals, task breakdowns, and design decisions in a structured format suitable for handoff to implementation agents.
planningdesignskillarchitecturesoftware-design
by alfred-intelligence Jul 14, 2026 6/10
skill GitHub
A curated set of production-ready Claude Code skills for developers, knowledge workers, and marketers. Includes 9 free MIT-licensed skills covering common workflows plus a Pro pack with extended capabilities.
skillsproduction-readymarketingdevelopmentmit
by moses607 Jul 14, 2026 6/10
skill GitHub
A comprehensive AI agent skill and reference guide for running any Windows application on macOS via Wine, CrossOver, Whisky, and Kegworks. Covers bottle configuration, DXVK, .NET, crash fixes, and anti-cheat limits for AI agents including Claude Code, Codex, and Cursor.
winemacoswindowsskillcompatibilitygaming
by artificialguybr Jul 14, 2026 6/10
skill GitHub
A visual interface for generating frontend project standards and local SKILL.md files for AI coding agents. Helps teams create consistent agent instructions without hand-writing specification files from scratch.
skill-mdfrontendstandardsvisualconfiguration
by Villa3650 Jul 14, 2026 6/10
skill GitHub
A comprehensive Claude Code plugin suite implementing "The Fable Method" — 12 enforceable quality gates to produce Fable-shaped results from any model. Bundles 71 plugin skills, 22 specialist agents, and 23 lifecycle hooks (39 handlers) in one installable package.
skillsagentshooksfablequality-gatesplugin-marketplace
by KevinZai Jul 14, 2026 8/10
skill GitHub
A Claude Code plugin marketplace with 40+ installable reference skills covering vLLM/SGLang inference, Kubernetes and Harvester, GPU host bring-up, observability, security hardening, and agent workflows. Targeted at ML infra and DevOps teams.
skillskubernetesgpusecurityobservabilityinfravllm
by air-gapped Jul 14, 2026 7/10
skill GitHub
A curated collection of 100+ Claude Code skills with 18 original installable skills organized by use case. Instructions in Chinese, covering common development scenarios from code review to deployment automation.
skillschinesecollectioninstallableproductivity
by laolaoshiren Jul 14, 2026 6/10
skill GitHub
A read-only scanner plus five-persona reasoning pass for AI skills, repos, MCP servers, and packages before installation. Produces a GO / GO WITH MITIGATIONS / NO-GO verdict with rationale to protect against supply-chain threats.
securityreviewmcpskillssupply-chainadversarial
by howshannon Jul 14, 2026 8/10
skill GitHub
Gives Claude Code and the macOS terminal full control over Apple Music — playback, multi-room AirPlay switching, and playlist management. Works as both a TUI and a natural-language skill invocation from Claude Code.
apple-musicmacostuicliskillairplay
by anthonymaley Jul 14, 2026 6/10
skill GitHub
A Claude Code skill for building, tailoring, and auditing resumes optimized for ATS systems (Workday, Greenhouse, Lever, Taleo, iCIMS), recruiter skim-reading, and LinkedIn recruiter search. Zero-fabrication policy enforced by the skill.
resumeatslinkedincareerskill
by artificialguybr Jul 14, 2026 6/10
skill GitHub
A Claude Code skill that applies formal-verification thinking to review PRDs and specs for structural defects before implementation begins. Every finding is traced back to its source requirement for accountability.
prdspec-reviewformal-verificationplanningskill
by happysasha18 Jul 14, 2026 7/10
skill GitHub
A single /orchestrate entry point that dispatches to nine different subagent orchestration strategies (parallel, pipeline, review-loop, etc.). Lets you pick the right strategy per task without maintaining separate skills for each pattern.
orchestrationsubagentsskillstrategiesworkflow
by gabros20 Jul 14, 2026 7/10
skill GitHub
A curated collection of 40+ Claude Code tips from basics to advanced. Includes a custom status line bash script, a guide for running Claude Code inside a container, and the dx plugin with everyday dev workflow skills.
tipsskillspluginstatus-linecontainerproductivity
by ykdojo Jul 14, 2026 7/10
skill GitHub
Adds image generation and editing to Claude Code through a skill and /imagine commands. Supports Codex CLI (no API key), OpenAI gpt-image, Gemini Nano Banana, and free FLUX models via an installable plugin marketplace.
image-generationskillcommandsfluxopenaigemini
by JashanMaan28 Jul 14, 2026 7/10
skill GitHub
Skills that give AI coding agents deep knowledge of the Arcjet security library for Node.js. Enables agents to correctly implement rate limiting, bot detection, and shield protection without manual documentation lookups.
securityarcjetnodejsskillsrate-limiting
by arcjet Jul 14, 2026 6/10
skill Reddit
Argues that framing Claude Code tasks in XML (structured task, context, constraints, output format) improves output quality more than upgrading models. Provides practical before/after examples and the technique's mechanics for formatting complex multi-step tasks.
promptingxmltechniqueskill
by reddit Jul 14, 2026 7/10
skill Reddit
Security guide covering the five key questions that determine whether a Claude agent in GitHub Actions can be hijacked: write token scope, shell access, prompt injection from issue text, OIDC vs static secrets, and rate-limiting on untrusted input. Practical checklist for CI/CD Claude setups.
securitygithub-actionsci-cdprompt-injection
by reddit Jul 14, 2026 8/10
skill GitHub
Claude Code skill that audits third-party code before installation. Runs six read-only phases and returns a SAFE / SAFE-WITH-CONDITIONS / UNSAFE verdict with evidence. Designed to catch supply chain risks, malicious payloads, and dependency traps before they enter your project.
securityauditskillsupply-chain
by belschak Jul 14, 2026 8/10
skill GitHub
Fifteen skills that interview or audit an AI coding agent into a real design system, then verify typography, OKLCH color, component states, forms, charts, accessibility, and anti-slop patterns. Raises the bar on AI-generated UI output beyond functional to genuinely polished.
frontenddesignskillui-quality
by KyaniteLabs Jul 14, 2026 7/10
skill GitHub
Give your AI coding agent taste. Decant analyzes any website and extracts its design language — colors, typography, spacing, component patterns — into a structured format that coding agents can follow when generating UI. Bridges the gap between "design a page like this" and actually matching the style.
designskillfrontendui
by Ykjc720 Jul 14, 2026 7/10
skill Reddit
Open-source skill based on Apple HIG, WWDC talks, and UX writing practice. Teaches AI agents to write human UX copy — buttons, error messages, empty states, forms — instead of generic machine-style text like "An error occurred." Includes before/after examples.
skillux-writingcopywritingfrontend
by reddit Jul 14, 2026 7/10
skill GitHub
Tool for setting up and keeping centralized CLAUDE.md rules and skill files synchronized across multiple projects. Changes to the central rules propagate automatically, ensuring consistent agent behavior across an entire repository portfolio.
skillclaude-mdsyncproject-management
by artemisia-absynthium Jul 14, 2026 7/10
skill GitHub
Agent skill for Claude Code and any SKILL.md-compatible agent. Feed it papers and half-formed ideas; it links them into a system design you can defend. Keeps a Markdown record and generates a visual canvas. Useful for architecture and technical design work.
skillarchitecturedesignsystem-design
by tigerless-labs Jul 14, 2026 7/10
skill GitHub
Production-tested skill collection covering session lifecycle management, multi-session reconciliation, worktree recovery after crashes or conflicts, and scaffolding for creating new skills. Addresses day-to-day operational pain points in Claude Code workflows.
skillsession-managementworktreescaffolding
by conorbronsdon Jul 14, 2026 7/10
skill GitHub
Reduces token waste by routing agent interactions through structured filters that strip noise without losing essential context. Works with Claude Code, Codex, Hermes, GG Coder, and other CLI agents. Aims to improve signal-to-noise while preserving judgment quality.
tokensoptimizationskillrouting
by Supersynergy Jul 14, 2026 6/10
skill GitHub
Three-skill package addressing the problem that AI agents grade their own work too generously. Skills: score (evaluate the output), close-gaps (fix what the scorer found), and verify (independent check). Evidence-capped means the scorer can't mark something correct without concrete evidence.
skillqualityself-reviewverification
by youkistudios Jul 14, 2026 7/10
skill GitHub
Opinionated, production-tested Claude Code setup: global CLAUDE.md, coding rules, per-project memory, and token optimization patterns. Provides a solid starting point for a consistent, efficient Claude Code environment across all projects.
claude-mdconfigurationtoken-optimizationsetup
by janmaaarc Jul 14, 2026 7/10
skill GitHub
Single command scaffolds conventions, namespaced skills, stack-appropriate settings, and interactive guardrails for seven AI coding environments — matching each agent's native file formats. Eliminates the work of manually adapting CLAUDE.md and settings for each tool.
scaffoldingboilerplatemulti-agentconfiguration
by steph-dove Jul 14, 2026 8/10
skill GitHub
Drop-in alternative to mcp-atlassian for AI coding agents working with Jira, Confluence, and Bitbucket on Atlassian Server/DC. Outputs compact representations with lossless XHTML-to-Markdown round-trip. Compatible with Claude Code, Codex, and GitHub Copilot.
skillatlassianjiraconfluence
by eunsanMountain Jul 14, 2026 7/10
skill GitHub
Claude Code skill + guard hooks that make Opus 4.8 or any non-frontier model plan, self-verify, and route sub-agents like Fable 5 does. Includes a plan gate that blocks implementation without a written plan, a model ceiling hook, and per-task enforcement.
skillhookplanningmodel-discipline
by cozytab Jul 14, 2026 8/10
skill GitHub
Claude Code skill that acts as a persistent router: identifies fixed-spec, machine-verifiable tasks and delegates them to lower-cost models (Haiku, Sonnet) while keeping quality tasks on the primary model. Designed so the quality floor never drops below single-model baseline.
skillroutingcost-optimizationmodels
by Laki-private Jul 14, 2026 7/10
skill GitHub
Skill + harness for agents that self-improve their own skills or projects through multiple iterations. Uses an un-gameable acceptance gate so "accepted = real improvement" not a score-up curve. Built for open-ended domains without ground truth. 521 tests.
skillself-improvementiterationquality
by DaizeDong Jul 14, 2026 8/10
skill GitHub
Claude skill that pushes back on your ideas with evidence rather than agreeing by default. Four modes (soft challenge, hard challenge, scenario simulation, devil's advocate) grounded in seven decision frameworks including pre-mortem, inversion, and steelman.
skilldecision-makingcritical-thinkingreview
by ibangtam Jul 14, 2026 7/10
skill GitHub
Claude will tell you your idea is great. Murderboard makes it try to kill it first. A structured adversarial review skill that argues against your proposal, identifies failure modes, and surfaces risks — before you commit engineering effort to it.
skilladversarialreviewidea-validation
by acost1a Jul 14, 2026 7/10
skill GitHub
Large-scale professional AI coding toolkit with 94 skills and 44 agents. Works across Claude Code, Cursor, Windsurf, Copilot, Gemini, Cline, Roo Code, Aider, Augment, Antigravity, Codex CLI, and opencode. Covers a broad spectrum of development tasks.
skillmulti-platformtoolkitagents
by softspark Jul 14, 2026 7/10
skill GitHub
Skill for grounded architecture review and design — read-only, evidence-based, grounded in Balanced Coupling principles. Reviews existing architecture and generates executable improvement plans. Designed for cases where you want architectural analysis without code changes.
skillarchitecturereviewdesign
by alexei-led Jul 14, 2026 7/10
skill GitHub
Maintains reusable skill fragments, hook gates, and settings in one source of truth, then projects them into the native format of each target tool (Claude Code, Cursor, etc.). Version-pins the distribution so you can roll back or upgrade consistently.
skillharnessdistributionconfiguration
by niksavis Jul 14, 2026 7/10
skill GitHub
Community Claude Code skill library tested with TDD (RED-GREEN-REFACTOR). Features rescue-tokens skill: 9 optimization patterns that reduce verbosity by 90% to avoid rate limits. Includes session management and productivity workflow skills.
skilltoken-optimizationtddproductivity
by valorisa Jul 14, 2026 7/10
skill GitHub
Skill that routes specific tasks from Claude Code to Gemini CLI: large-context synthesis (leveraging Gemini's 1M+ context window), English or Chinese long-form drafting, and second-opinion review. Enables a two-model workflow from within Claude Code.
skillgeminidelegationmulti-model
by WenyuChiou Jul 14, 2026 7/10
skill GitHub
Frames, diverges, attacks, and bridges product ideas into falsifiable prototype briefs. Goes beyond "yes, and" to genuinely stress-test product concepts through structured adversarial ideation. Works with Claude Code, Cursor, and Codex.
skillideationadversarialproduct
by mondaymetime Jul 14, 2026 7/10
skill GitHub
Agent skill that checks any MCP server against the PolicyLayer security registry before connecting. Returns identity verification, risk grade, tool classifications, and detected changes. Prevents connecting to malicious or compromised MCP servers.
skillsecuritymcpregistry
by PolicyLayer Jul 14, 2026 7/10
skill GitHub
Agent skill that enforces a quality loop for coding changes: plan the change, implement it minimally, verify with tests, and only commit when verified. Designed to prevent AI agents from making large untested changes in a single step.
skillqualityverificationtesting
by zaingz Jul 14, 2026 6/10
skill GitHub
A reusable Claude Agent Skill acting as a senior software architect for SvelteKit projects. Helps design structure, review existing setups, detect problems, and plan migrations. Good for teams standardizing their SvelteKit architecture.
sveltekitskillarchitectureproject-structure
by poolcamacho Jul 13, 2026 5/10
skill GitHub
A collection of Claude Code skills targeting iOS, macOS, and iPadOS development. Covers product validation, code generation, and App Store optimization. Purpose-built for Apple developers using Claude Code.
appleiosmacosskillapp-storeswift
by rshankras Jul 13, 2026 7/10
skill GitHub
A Claude Code skill that connects agents to over 1,000 real-world apps (Gmail, Slack, Linear, Notion, Firecrawl, Fal) with 27,000+ executable actions and full audit history. Bridges Claude Code to third-party integrations without custom MCP servers.
skillintegrationsgmailslacknotionautomation
by Aident-AI Jul 13, 2026 6/10
skill GitHub
A framework for writing Claude Code skills that dynamically adjust their instructions based on real-time data — running scripts at invocation time to tailor agent behavior to current conditions. Enables skills that respond to environment, config, or live state.
skilldynamicruntimecontext-awareautomation
by nkwem3002 Jul 13, 2026 7/10
skill GitHub
A Claude Skill that orchestrates PDF MCP servers to audit document trustworthiness: cryptographic signature verification, tamper detection, PAdES/PDF-A compliance, and optional Japanese-law cross-referencing. Returns a trust score with detailed findings.
skillpdfsecuritycryptographysignaturecompliance
by shuji-bonji Jul 13, 2026 7/10
skill GitHub
Free, copy-paste Claude skills for a content production pipeline: turn ideas and NotebookLM memory into Instagram reels scripts. Demonstrates using Claude skills to automate social media content workflows.
skillcontentsocial-mediainstagramautomation
by Ootto-AI Jul 13, 2026 5/10
skill Reddit
A Claude Code plugin with 12 skills and 10 reference docs that generates a complete design system in both Figma and code output, with model tiering for cost efficiency. Automates the most tedious part of starting a new design system.
skilldesign-systemfigmauipluginscaffolding
by jerpes1 Jul 13, 2026 7/10
skill GitHub
A Claude skill and plugin combo that generates complete PDF brand books and AI brand guardrail files for any business. Automates the deliverable creation step of brand identity work.
skillbrandpdfdesignplugin
by spotozkin Jul 13, 2026 5/10
skill Reddit
A Claude Code skill for sending screenshots from phone or PC to a headless Claude server. Uses a Nextcloud (or Syncthing/SFTP) sync folder and a skill that finds the newest file — works identically from any device. Solves the screenshot paste limitation in remote terminals.
skillscreenshotremoteheadlessservermobile
by karangos Jul 13, 2026 7/10
skill GitHub
A collection of AI skills for Luxembourg administrative tasks: accounting, VAT, RCS/LBR filings, eCDF, FAIA, PAdES, notary work, and co-ownership (copropriété). Published on AgentSkill.sh. Useful for professionals handling Luxembourgish compliance.
skillluxembourgcomplianceaccountingtaxlegal
by gregherbe76 Jul 13, 2026 5/10
skill GitHub
Compound V is a companion to the Superpowers skill that adds triple parallel pre-flight (code archaeology, domain-expert search, library/doc validation via Context7), a Disjoint File Partition Map, and batched parallel Opus dispatch. Auto-intercepts brainstorming-to-execution transitions.
skillparallelpre-flightcontext7opusworkflow
by procoders Jul 13, 2026 7/10
skill GitHub
A Claude Code skill set for organizing real academic research workflows. Includes literature tracing, source verification, and bilingual paper search, making research more systematic and reproducible.
academicresearchskillliterature
by gretamutualist474 Jul 13, 2026 6/10
skill GitHub
A tool to organize Claude Code projects with a clear AI index, module map, and fast codebase navigation. Helps agents and developers orient quickly in large codebases.
organizationcodebasenavigationskill
by ianpugfaced55 Jul 13, 2026 6/10
skill GitHub
Skills and prompts that let AI team members gather reflections and bring them to sprint retrospectives. A practical integration of Claude Code into agile workflows.
retrospectiveagileteamskill
by TeamRetroHQ Jul 13, 2026 6/10
skill GitHub
A Claude Code skill to automate job searching by analyzing roles, customizing resumes, drafting cover letters, and practicing interview responses. Turns Claude Code into a personal career assistant.
job-searchresumecareerskill
by Ergi8957 Jul 13, 2026 5/10
skill GitHub
A comprehensive Agent Skill for humanities writing with 11 modes spanning Socratic research-question sharpening through AI-use disclosure. Bilingual (EN/中文), discipline-aware across literature, history, philosophy, and more, with four-layer critique and voice preservation.
writinghumanitiesbilingualcritiqueskill
by tizzy916 Jul 13, 2026 7/10
skill GitHub
A design-phase reference distilling 21 agentic design patterns into concepts (no code), packaged as a Claude Code skill. Ideal for architecture planning sessions before building AI agent systems.
design-patternsarchitectureagentsskillreference
by eshwarvijay Jul 13, 2026 8/10
skill GitHub
A skill plugin for Claude Code and other AI agents providing safe, reproducible Pingouin-based workflows for psychology statistics. Includes assumption checks, S0–S5 supervision gates, and APA-style reporting.
statisticspsychologypingouinresearchskill
by Exekiel179 Jul 13, 2026 6/10
skill GitHub
A public catalog of Agent Skills covering Codex operations, repo maintenance, skill maintenance, productivity, and engineering workflows. A curated library of reusable skills for common developer tasks.
catalogcodexrepo-maintenanceskill-library
by stark-ai-de Jul 13, 2026 6/10
skill GitHub
Augmentation-only Agent Skills for fiction writers — editors, critique simulators, character work, and craft drills. Notably reads and critiques manuscripts without ghostwriting, keeping the author's voice central.
fictionwritingcritiqueeditingskill
by Calliope-Editor Jul 13, 2026 7/10
skill GitHub
Claude Code and Codex skills for LinkedIn growth: write human-sounding posts, craft comments, analyze feed, and build a publishing cadence from the terminal. Useful for founders and marketers.
linkedinmarketingsocial-mediaskill
by sergebulaev Jul 13, 2026 5/10
skill GitHub
Installable Agent Skills for government contracting, including Claude Code plugins and playbooks driving the CLEATUS MCP server. Specialized skills for navigating federal contracting workflows.
governmentcontractingmcpskill
by cleatai Jul 13, 2026 6/10
skill GitHub
Skills for writing tweets, threads, and replies in your authentic voice, stripping AI tells, and publishing via Publora. Designed for content creators using Claude Code from the terminal.
twitterxsocial-mediamarketingskill
by sergebulaev Jul 13, 2026 5/10
skill GitHub
An Agent Skill that transforms rough PRDs and product requirements into implementation-ready specifications. Bridges the gap between product thinking and developer-ready technical specs.
prdspecificationsproduct-managementskill
by wair56 Jul 13, 2026 7/10
skill GitHub
A D&D 2024 (5.5) character-builder skill pack that reads a bundled rules catalogue and uses a deterministic engine instead of hallucinating. Demonstrates grounded AI skills with verifiable outputs.
dndgamegroundeddeterministicskill
by mlabarrere Jul 13, 2026 6/10
skill GitHub
Ten terminal skills equipping Product Managers to streamline planning, execution, research, debugging, and deliverable creation using Claude Code. Bridges PM workflows with AI-assisted terminal tooling.
product-managementpmterminalskill
by SOAIF0099 Jul 13, 2026 6/10
skill GitHub
Ready-to-use CLAUDE.md templates for major technology stacks to improve Claude Code outputs and streamline project setup. A curated library of context files that give Claude the right project conventions from the start.
claude-mdtemplatesproject-setupconventionsboilerplate
by anns2rn Jul 13, 2026 8/10
skill GitHub
Agent Skills for AceDataCloud AI services covering music, image, and video generation plus web search. Compatible with Claude Code, GitHub Copilot, Gemini CLI, and agentskills.io-compatible agents.
media-generationimagevideomusicweb-searchskill
by AceDataCloud Jul 13, 2026 6/10
skill GitHub
A technique and tooling that cuts Claude Code's context window usage by approximately 90% while preserving nearly all the relevant memory. Addresses one of the most practical limitations in long Claude Code sessions.
context-managementmemoryefficiencyoptimization
by kitepon-rgb Jul 13, 2026 8/10
skill GitHub
A skill that scans your installed agent skills and generates HTML slide decks to track and present your automation tools. Useful for documenting and sharing your skill library.
documentationskill-managementhtmlslides
by Coldwavegenusthespesia630 Jul 13, 2026 5/10
skill GitHub
A Claude Code skill for extracting and summarizing social media content from Instagram, TikTok, X, and YouTube. Enables agent-driven social media research and content analysis.
social-mediascrapinginstagramtiktokskill
by expropriationhoorayhenry64 Jul 13, 2026 5/10
skill GitHub
A skill that gives Claude Code a voice using Speechify's lifelike TTS with expressions. Enables audio output from Claude Code sessions for accessibility or ambient coding workflows.
ttsvoiceaccessibilityspeechifyskill
by AnimaEcho Jul 13, 2026 7/10
skill GitHub
Two staff-level Agent Skills for Claude Code: interview-me-senior grills and scores your architectural decisions; review-me-senior is a code review copilot with auto-detected best-practice packs for C#/.NET and Blazor/Fluxor.
code-reviewinterviewdotnetblazorskill
by connorjjarvis Jul 13, 2026 7/10
skill GitHub
A free AI skill that makes any model plan first, test competing ideas, and verify its work before answering. Works with Claude, Antigravity, Codex, and Cursor as a portable reasoning scaffold.
reasoningplanningverificationfableskill
by akhilguptahub Jul 13, 2026 6/10
skill Reddit
A Claude Code skill that audits apps for production readiness across five domains (frontend, backend, auth/security, infra, ops). Runs a fixed rubric every time — catching RLS-off Supabase configs, service_role key leaks, and missing rate limits — outputting scored reports with copy-paste fixes.
securityauditproduction-readinesssupabaseskillplugin
by kemalios Jul 13, 2026 8/10
skill GitHub
Carries a full Claude chat into a fresh conversation with one paste. Chat-native and domain-adaptive, letting you continue long sessions without losing context when starting a new window.
contexthandoffsession-continuitymemoryskill
by mosuvo Jul 13, 2026 7/10
skill GitHub
Nine Agent Skills for App Store Optimization powered by the ASOScan API. Compatible with Claude Code, Cursor, and agentskills.io-compatible assistants, with two skills requiring no API key.
asoapp-storeoptimizationmarketingskill
by ASOScan Jul 13, 2026 6/10
skill GitHub
Transforms project planning in Claude Code into interactive, visual decision-making with multiple options, previews, comparisons, and a saved decision history. Improves the plan mode experience significantly.
plan-modedecision-makingvisualinteractiveskill
by LIPOKA Jul 13, 2026 7/10
skill GitHub
A skill that enables AI agents to access live web data for in-depth people and company research, lead enrichment, contact discovery, and automated workflows. Connects Claude Code to real-time web intelligence.
web-dataresearchlead-enrichmentcontactskill
by Mtjones2501 Jul 13, 2026 5/10
skill GitHub
An agent skills marketplace from Narrative I/O with interactive, AI-powered slash-command workflows for recurring data company work — NQL queries, Rosetta Stone mappings, identity graphs, and more. Follows the Agent Skills spec.
datamarketplacenqlidentityskill
by narrative-io Jul 13, 2026 7/10
skill GitHub
A Claude Code skill for finding, verifying, and prioritizing B2B leads in any city with evidence quotes, adversarial verification, 21 vertical-by-city presets, and Excel-ready output.
b2bleadssalesresearchskill
by Claudefarid Jul 13, 2026 6/10
skill GitHub
A Claude Code skill for proofreading Korean academic papers using sequential chunk checking across four axes (notation, sentences, logic, citations) with bibliography verification to flag hallucinated sources.
koreanacademicproofreadingcitationsskill
by parkjui92-tech Jul 13, 2026 6/10
skill GitHub
Claude Code skills that turn an AI agent into a meticulous QA engineer. Requires evidence for every finding — no hallucinated test results.
qatestingevidence-basedskill
by akovalion Jul 13, 2026 7/10
skill GitHub
A Claude Code toolkit whose quality gate reads your diff, scores its risk, and scales its own review depth accordingly. Includes 33 commands, 36 skills, and 14 agents.
toolkitrisk-scoringreviewcommandsagentsskill
by buildproven Jul 13, 2026 8/10
skill GitHub
A Claude Code skill that acts as a Chief of Staff — deciding what to execute rather than executing itself. Adds a strategic reasoning layer on top of your other Claude Code tools.
strategyplanningchief-of-staffdecision-makingskill
by JimmySadek Jul 13, 2026 7/10
skill GitHub
A Claude.ai Personal Skill that generates a structured seven-block session handoff so you can continue work in a new conversation without losing context, rediscovering decisions, or re-explaining project state.
contexthandoffsession-continuitymemoryskill
by thebpandey Jul 13, 2026 7/10
skill GitHub
Agent Skills implementing React Principles cookbook patterns for Claude and Cursor. Codifies established React best practices as reusable skills for consistent code generation.
reactpatternscookbookfrontendskill
by sindev08 Jul 13, 2026 6/10
skill GitHub
An end-to-end research workflow skill for turning ideas into evidence-backed, citation-supported manuscript drafts. Covers the full research pipeline from idea to polished draft.
researchmanuscriptcitationswritingskillworkflow
by mmTheBest Jul 13, 2026 6/10
skill GitHub
A caddie for your agent skills that keeps them organized, up to date, and ready for every repository. Manages skill synchronization across multiple Claude Code projects.
skill-managementorganizationsyncrepos
by sreejithraman Jul 13, 2026 6/10
skill GitHub
A collection of Claude Skills mirroring ACCESSIBILITY.md best practices. Helps AI agents produce more accessible code and content by encoding established accessibility guidelines as reusable skills.
accessibilitya11yskillbest-practices
by mgifford Jul 13, 2026 6/10
skill GitHub
A persistent memory system for AI coding agents using the TOON format, which uses 40% fewer tokens than JSON. Provides compact, efficient memory that can be passed across sessions.
memorytoon-formattoken-efficiencypersistenceskill
by LuiggiVal08 Jul 13, 2026 7/10
skill GitHub
A Flutter UI/UX design skill for Claude Code, Cursor, and AI coding agents. Covers Material 3 theming, dark mode, animations, and anti-patterns to make Flutter apps look designed rather than defaulted.
fluttermaterial-3uidesignskill
by parasvishwa Jul 13, 2026 6/10
skill GitHub
A repository structure for sharing Claude Code configurations, skills, and agents across machines. Provides a convention for keeping your Claude setup synchronized.
configurationsyncsharingmachinesskill
by davidbaines Jul 13, 2026 6/10
skill GitHub
A portable /deep research agent skill for Claude Code and OpenAI Codex that is cost-controlled, evidence-gated, multi-provider, and resumable. Provides structured deep research with guardrails.
researchdeep-researchevidence-gatedresumableskill
by jechiu16 Jul 13, 2026 7/10
skill GitHub
A Claude Code skills marketplace package with domain-search and SSR market research skills. Usable as plain skill folders in Codex and Cursor as well.
domainmarket-researchsearchskill
by thattimc Jul 13, 2026 5/10
skill GitHub
A multi-model committee skill (Mixture-of-Agents) for Claude Code that chairs up to 4 heterogeneous LLMs to blind-review, decide, and brainstorm in parallel with evidence-driven convergence for more reliable conclusions.
mixture-of-agentsmulti-modelcommitteeblind-reviewskill
by sdsrss Jul 13, 2026 8/10
skill GitHub
A comprehensive Claude Code plugin for Elixir, Phoenix, and LiveView featuring 20 specialist agents, Iron Laws enforcement, and Tidewave MCP integration. Supports parallel research agents, automatic verification, and 4-agent parallel code audits.
elixirphoenixliveviewspecialist-agentstidewaveskill
by oliver-kriska Jul 13, 2026 7/10
skill GitHub
A Claude Code skill for end-to-end application development planning, covering requirements analysis, feature planning, technology selection, system architecture, SDLC, milestones, and roadmaps. Helps structure complex projects thoroughly before writing any code. Drop-in skill for any new application development effort.
skillplanningarchitecturerequirementssdlcroadmap
by fullstackondemand Jul 13, 2026 7/10
skill GitHub
A Claude skill that guides Claude and other LLMs toward clearer, more authentic prose by stripping common AI writing patterns. Useful for any output that needs to read naturally rather than like generated text.
writingproseai-patternsquality
by mohamedgame Jul 13, 2026 6/10
skill GitHub
Tool for wrapping any open-source library or CLI into a skill pack usable by Claude Code, Cursor, and Codex. Generates the distribution layer and verifies agents can actually invoke it.
skillsdistributioncross-agentcodexcursor
by nordicnode Jul 13, 2026 8/10
skill GitHub
Claude Code skill that reads your repository's existing conventions and rules, then evaluates every change by blast radius before allowing it through. Acts as an automated code guard that enforces project standards.
safetycode-reviewconventionsblast-radius
by hedimanai-pro Jul 13, 2026 7/10
skill GitHub
Pre-alpha testing framework that runs the same task with and without a skill and compares results honestly. UNMEASURED is a first-class verdict — it never fabricates a score when evidence is insufficient.
testingevaluationskillsmeasurement
by MrBinnacle Jul 13, 2026 7/10
skill GitHub
Claude Code skill that converts a broker CSV into a single behavioral review card. Uses mechanical analysis for pattern detection and a master-lens layer to surface the motivations behind trades.
tradingfinancecsvbehavioral-analysis
by atomchung Jul 13, 2026 5/10
skill GitHub
Language-agnostic Claude skill suite that detects documentation drift, certifies every claim against actual code, and rewrites prose only when evidence supports it. Cites the specific line or says nothing. Four modes: ride-along, winnow, flourish, cultivate.
documentationdriftcode-qualitycitations
by ChrisPachulski Jul 13, 2026 7/10
skill GitHub
Collection of Claude Code settings, custom commands, and agent configurations curated for productive vibe coding sessions. A ready-to-use starting point for personalizing Claude Code behavior.
settingscommandsconfigurationvibe-coding
by feiskyer Jul 13, 2026 6/10
skill GitHub
Agent skill that provides persistent project-level memory to coding agents. Helps maintain context across sessions without relying on in-context history alone.
memoryproject-memoryagentspersistence
by waittim Jul 13, 2026 7/10
skill GitHub
Agent skill for writing and editing Japanese business documents: meeting minutes, research reports, internal guides, slide outlines. Includes AI-pattern removal and morphological analysis via sudachipy.
japanesewritingbusinessnlpskill
by coji Jul 13, 2026 5/10
skill GitHub
Install KDNA skills across any major AI coding agent with one common format: Claude Code, Codex, OpenCode, Cursor, and GitHub Copilot. Standardizes skill distribution across the ecosystem.
skillscross-agentcodexcursorcopilot
by aikdna Jul 13, 2026 6/10
skill GitHub
Bundle of Claude Code skills that enforces clean, modular, human-readable code from the base of a project. Includes conventions for keeping AI-written code maintainable and consistent.
code-qualitybundlemodularconventions
by Pr1m4lc0d3 Jul 13, 2026 6/10
skill GitHub
Community-maintained collection of tips, prompt templates, and code snippets for getting the most out of Claude AI. A good starting reference for building better prompting habits.
tipspromptstemplatescommunity
by Ahmedkhaled28 Jul 13, 2026 5/10
skill GitHub
Claude Code plugin that automatically applies Apple Human Interface Guidelines to UI designs across iOS, iPadOS, macOS, watchOS, tvOS, and visionOS. Enforces platform-native design standards in AI-driven UI work.
appleuidesignhigiosmacos
by aponeurosiswilling807 Jul 13, 2026 6/10
skill GitHub
Curated bundle of 23 Claude Skills for quantitative research in business, finance, and social science, available in both Chinese and English. Covers statistical analysis, literature review, and research reporting workflows.
academicresearchfinancequantitativebilingual
by Nero1688 Jul 13, 2026 6/10
skill Reddit
A set of SKILL.md files that give Claude Code context about Apple App Store guidelines, required privacy manifest keys, metadata rules, and common rejection patterns. Covers entitlements validation and a pre-submission checklist against Guideline 4.0 and 5.1 failures. Useful for iOS developers using Claude Code who want to avoid costly App Store rejections.
swiftiosapp-storeskillagent-skillsapple
by Direct-Attention8597 Jul 12, 2026 7/10
skill GitHub
This Claude Skills package acts as a personal content editor, evaluating sources, outlining newsletters, editing drafts, and converting podcasts to text — all in a consistent voice. It serves as a design showcase for building personal workflow skills on top of Claude. Note: the actual skill contents are proprietary, but the package structure is public.
skillcontent-editingnewsletterworkflowvoice
by wei-wei-hu Jul 12, 2026 5/10
skill GitHub
An opinionated CLAUDE.md foundation with a built-in Explore → TDD → Audit workflow and auto-detected stack presets for Next.js, FastAPI, Astro, and others. Install via curl | bash. Useful for bootstrapping new projects with consistent agentic development practices.
claude.mdtddworkflowfoundationscaffoldpresets
by christopherlouet Jul 12, 2026 7/10
skill GitHub
A set of Claude/Codex agent skills covering brainstorming, product research, PRD workflows, requirements review, and planning handoff. Useful for product managers using Claude Code to structure and automate product development phases.
product-managementprdplanningskillsworkflow
by PANGKAIFENG Jul 12, 2026 5/10
skill GitHub
A set of composable agent skills for repeatable, test-driven greenfield Python project delivery. Standardizes the scaffolding and development workflow for new Python projects using Claude Code.
pythontddgreenfieldskillsscaffold
by dahyeK0420 Jul 12, 2026 6/10
skill GitHub
A Claude Code skills collection starting with project-context — a self-maintaining context memory that survives session resets and context-window compaction. Solves the cold-start problem without manual CLAUDE.md upkeep.
memorycontextsessionskillscompaction
by K021 Jul 12, 2026 7/10
skill Reddit
A browser-only tool for keeping agent instruction files in sync across Claude, Cursor, and Codex. Edit one canonical rule and preview the native output for each tool, with source/output hash inspection. Addresses the problem of diverging agent configs across different coding tools.
claude.mdagents-mdcursorrulessyncconfigcross-tool
by Sensitive-Cycle3775 Jul 12, 2026 6/10
skill GitHub
A curated skills library where every skill carries evidence of the real failure it addresses, gets re-tested on new model releases, and is publicly retired when models stop needing it. A principled alternative to skill collections that accumulate indefinitely.
skillsevidence-basedqualityretirementtestingbest-practices
by MrBinnacle Jul 12, 2026 8/10
skill GitHub
A collection of Claude Code plugins from lets-forge covering skills, hooks, agents, and MCP integrations used across their lab projects. MIT-licensed.
skillshooksagentsmcpplugins
by lets-forge Jul 12, 2026 5/10
skill GitHub
A comprehensive toolkit with 25 Claude Code subagents, 14 lifecycle skills, and CLAUDE.md templates covering the full product development lifecycle from build to ship to monetize. Clone and run one sync command to get started.
subagentsskillsclaude.mdtemplateslifecycletoolkit
by T4LEL Jul 12, 2026 7/10
skill GitHub
A Claude Code project template with pre-wired memory, contracts, policies, checks, and ops docs that lets a non-engineer direct and approve AI coding work without reading code. Bootstraps a repo with full governance infrastructure from day one.
governancetemplatenon-engineerscaffoldcontractsclaude.md
by StarshipSuperjam Jul 12, 2026 7/10
skill GitHub
Agent skills for Claude Code, Codex, and OpenCode that review code for security, performance, and clean code quality. Includes Next.js and Laravel PR reviewers plus a stack-agnostic pre-push reviewer with a Pass/Warn/Fail scorecard.
code-reviewsecurityperformancepre-pushhookskills
by ezzatmakar Jul 12, 2026 7/10
skill GitHub
A collection of skills, plugins, and hooks for Claude Code, Codex, OpenCode, and Antigravity — described as "measured, not vibed." Targets behavioral changes to how coding agents work rather than cosmetic additions.
skillshookspluginsmeasuredmulti-toolbehavior
by lawzava Jul 12, 2026 7/10
skill GitHub
A collection of AI coding skills, hooks, and plugins designed to keep developers actively engaged rather than autopiloting through AI-generated code. Focuses on developer growth alongside AI assistance.
skillshooksdeveloper-growththinkingengagement
by alinafe82 Jul 12, 2026 6/10
skill GitHub
A Claude skill that automatically syncs Gmail and Google Calendar with a Notion database to track job application status. Demonstrates how Claude skills can orchestrate multiple external services for personal productivity.
skillgmailnotioncalendarjob-trackingproductivity
by daliaabbruciati Jul 12, 2026 7/10
skill GitHub
Search for Claude & Codex skills from your macOS menu-bar
skill
by jonslimak Jul 12, 2026 6/10
skill GitHub
CO2 - an OPINIONATED approach to software development using AI coding agents
skill
by rashidee Jul 12, 2026 6/10
skill GitHub
Claude Plugin Consistency Kit 2026: Shared Agent Guidelines & Stack-Specific Skills
skill
by younesZT Jul 12, 2026 7/10
skill GitHub
Canonical Agent Skills library for Claude Code, Cursor, Codex, and other agents.
skill
by lgtm-hq Jul 12, 2026 9/10
skill GitHub
Map and manage human skills with a structured system designed to track learning and development alongside AI capabilities.
skill
by Alfietechtime Jul 12, 2026 5/10
skill GitHub
Small, practical agent skills for proof-heavy work where guessing is expensive.
skill
by zztimur Jul 12, 2026 6/10
skill Reddit
submitted by /u/Single-Cherry8263 [link] [comments]
skillgit
by Single-Cherry8263 Jul 12, 2026 7/10
skill Reddit
Sorry if this has been asked before: Context: I am on the pro plan, run about three automated tasks everyday. Noticed in past four days, after those three tasks usage is 100% finished. Previously, ...
skillworkflow
by AbbreviationsThis391 Jul 12, 2026 8/10
skill Reddit
I've been experimenting with something I didn't expect to build. I'm building a marketplace for Claude Code skills, and instead of filling it with placeholder content while waiting for creators, I ...
skill
by Classic_Display9788 Jul 12, 2026 9/10
skill GitHub
Delegate coding tasks to agents, collect artifacts, and verify results locally with standalone supervision skills for Claude, Codex, and Kimi automation.
skillautomation
by drippy-passport968 Jul 12, 2026 7/10
skill GitHub
Open food & nutrition science research skill suite for Claude Code and Codex — multi-agent research/write/review/figure skills + journal author-guideline skills. Initiated by the Food Science Group...
skillreview
by PangenomeAI Jul 12, 2026 9/10
skill GitHub
Public Repository for Agent Skills
skill
by spShashankGit Jul 12, 2026 6/10
skill GitHub
Claude Code skill:一张参考图 → 复古剪贴报风格动画短视频(Nano Banana 关键帧 + Kling 图生视频),内置版权红线自检
skill
by LunaAI519 Jul 12, 2026 8/10
skill Reddit
After fable vs sol discussions, i decided to move towards openai side after 2yrs of claude subscription. I had some skills for dynamically creating human-like contents, so is it possible to use the...
skill
by SirBoranium Jul 12, 2026 6/10
skill GitHub
Agent-agnostic software engineering skill for implementation, debugging, testing, refactoring, security boundaries, verification, and code review.
skilltestingreview
by CodingCossack Jul 12, 2026 6/10
skill GitHub
Agent skills for fast, verifiable codebase documentation and navigation
skill
by markthebault Jul 12, 2026 6/10
skill GitHub
An agent skill that turns requests into verified work and learns from your runs: ask, plan, delegate, verify, ask again. Built on Andrej Karpathy's agentic engineering and Aravind Srinivas's relent...
skill
by nmahavishnu Jul 12, 2026 6/10
skill Reddit
submitted by /u/psycenos [link] [comments]
skill
by psycenos Jul 12, 2026 6/10
skill GitHub
Framework for building standalone Claude Code skills as simple, drop-in folders that work with any codebase on any OS. Each skill is self-contained with no cross-dependency requirements.
skillportabledrop-instandalone
by allysgrandiose674 Jul 12, 2026 6/10
skill GitHub
An AI agent skill that generates browser-editable presentations from multiple visual themes, exportable to HTML, PDF, and PPTX. Enables agents to produce shareable slide decks directly from their output.
skillpresentationpptxhtmlexport
by chuspeeism Jul 12, 2026 6/10
skill GitHub
Converts research paper PDFs into structured Obsidian notes with automated translations, figure analysis, and concept explanations for deep study. Useful for researchers using Claude Code agents to process academic literature.
skillresearchpdfobsidiannotesacademic
by Robertmorrisluminousenergy177 Jul 12, 2026 6/10
skill GitHub
Curated, hand-rolled AI skills distilled from everyday development experience, covering Git workflows and Mise (polyglot tool version manager) automation. Practical skills focused on real daily use rather than theoretical patterns.
skillgitmiseworkflowpractical
by sherifabdlnaby Jul 12, 2026 6/10
skill GitHub
Deterministic and auditable agent/skill dispatch for Claude Code using a typed seven-decision scoring kernel that runs after reading the conversation — post-cognitive routing instead of prose-scanning. Auto-generates its dispatch catalog from skill sidecars and agent frontmatter.
routingdispatchskilldeterministicaudit
by glitchwerks Jul 12, 2026 7/10
skill GitHub
The retirement handoff of Claude Fable 5, written by the model itself — domain-neutral discipline files that transfer Fable 5's working methodology to any model, agent framework, or team. A unique artifact documenting how Claude Fable 5 approached problems.
skillmethodologyfable5claudehandoffdiscipline
by pipipip169 Jul 12, 2026 7/10
skill GitHub
Agent memory rots quietly — this tool checks it before sessions pay the cost with status, lint, and compact commands for Claude Code and OpenClaw. Also embedded in brigade-cli for integrated memory hygiene.
memoryskillhygienelintcontext
by escoffier-labs Jul 12, 2026 7/10
skill GitHub
A collection of 26 slash commands and 4 skills for Claude Code spanning research, career planning, finance, productivity, and automation. Organized as ready-to-install skills covering common knowledge worker tasks.
skillcommandsresearchproductivityautomation
by liks79 Jul 12, 2026 6/10
skill GitHub
Organizes AI-driven coding with tested prompts, workflows, and rules to maintain code quality and manage complexity in fast-paced projects. Provides a structured playbook for vibe coding that prevents quality drift.
skillworkflowvibe-codingpromptsquality
by osborneomuya Jul 12, 2026 6/10
skill GitHub
Maintains living project docs for coding agents including guides, progress logs, change maps, and handoff context that stay updated as the repository evolves. Treats documentation as a first-class citizen that agents actively maintain.
skilldocumentationliving-docshandoffcontext
by YurunChen Jul 12, 2026 6/10
skill GitHub
Complete AI development workflow supporting 19+ tools with built-in rules, agents, and conventions out of the box. Generates native configs for Claude, Cursor, Copilot, Windsurf, Gemini, Codex, and more from a single source of truth.
skillworkflowmulti-toolconfigconventionscodexcursor
by Goldziher Jul 12, 2026 7/10
skill GitHub
Two-way sync between a repo's Claude Code memory and an Obsidian vault — per-fact notes, a Bases dashboard, cross-linking, and compaction. Makes Claude Code memory browsable and editable in Obsidian.
memoryobsidiansyncskillknowledge
by mikessh Jul 12, 2026 7/10
skill GitHub
Journals every step of a Claude Code session so interrupted sessions resume instead of rebuilding from scratch. Also provides an advisory budget guardrail to reduce limit-hit damage — without preventing it entirely.
skillresumebudgetguardrailjournalsession
by TheColliery Jul 12, 2026 7/10
skill GitHub
Nine quality-canary skills for AI coding agents covering code health, grounding, supply chain, resilience, drift, and more. Cross-agent, consent-gated, and token-lean — designed as lightweight continuous quality checks.
skillqualitygroundingsupply-chainhealth-check
by HetCreep Jul 12, 2026 7/10
skill GitHub
Automates the software development lifecycle for Claude Code with standardized workflows, project scaffolding, session management, and diagnostic audits. Provides a cohesive skill pack covering the full development cycle.
skillsdlcworkflowscaffoldsession
by dressingcasewildcat6783 Jul 12, 2026 6/10
skill GitHub
Reduces Claude token consumption by using local manifests to index and summarize project files for efficient context management. Maintains a lightweight file map so agents load only relevant context rather than whole codebases.
skillcontexttokensoptimizationmanifest
by aaron4605 Jul 12, 2026 6/10
skill GitHub
Manages persistent session memory and context handoff for Claude Code to maintain continuity between tasks. Provides a lightweight memory layer that survives session ends and carries forward task state.
skillmemorycontexthandoffcontinuity
by allans4635 Jul 12, 2026 6/10
skill GitHub
Analyzes and evolves AI skills through comparative testing, pattern extraction, and iterative refinement to improve agent performance. Meta-skill for improving other skills by benchmarking their outputs.
skillmetaimprovementtestingrefinement
by Einherjar99 Jul 12, 2026 6/10
skill GitHub
A Claude Skill that automates web performance audits (LCP, CLS, INP) using web.dev guidelines, delivering structured reports, actionable fix scripts, and incremental analysis. Turns Claude Code into a web performance specialist.
skillperformanceweb-vitalsauditlcpcls
by EVEDensity Jul 12, 2026 6/10
skill GitHub
Local-first memory and prompt-cache layer for Claude Code that persists context between sessions without external dependencies. Designed as a lightweight caching layer that reduces repeated context loading.
skillmemorycachelocal-firstcontext
by riz007 Jul 12, 2026 6/10
skill GitHub
A portable memory bank and slash command kit for AI coding agents that works with Claude Code and Codex CLI out of the box. Drop-in memory management with pre-built commands for common agent memory patterns.
skillmemorycommandsportablebank
by gusfeliciano Jul 12, 2026 6/10
skill GitHub
A compass for autonomous agent goals — turns a rough request into a linted, verifiable /goal. Harness-engineered derivative of goal-setter that enforces clarity and measurability before an agent begins work.
skillgoalsplanningverificationclarity
by kubouchiyuya Jul 12, 2026 6/10
skill GitHub
Scaffolds full UI projects using ready-to-use DESIGN.md files and Claude Design integration. Provides opinionated starting points for design-first development with AI coding agents.
skilldesignuiscaffolddesign-md
by alfonsosagacious5877 Jul 12, 2026 6/10
skill Reddit
A session memory and workflow plugin that evolved from basic markdown files into a hook-driven system — context injected at the right moment, task backlog that survives sessions, and a workflow layer (brief→plan→build→verify→ship→learn). Hooks fire silently on failure so sessions are never blocked.
skillmemoryhooksworkflowmarkdownsession
by too_lazy--- Jul 12, 2026 7/10
skill GitHub
Cuts a Claude Code session's context tokens losslessly — bulky tool output moves to a local backup while every prompt stays verbatim and the session resumes lighter. The reversible alternative to /compact with no information loss.
skillcontexttokensmcpcompactlossless
by shayaShav Jul 12, 2026 7/10
skill GitHub
Portable architectural guardrails for AI coding agents that enforce structural constraints across sessions. Provides CLAUDE.md-compatible rules that prevent agents from violating architectural patterns.
skillguardrailsarchitectureconstraintsportable
by MicSm Jul 12, 2026 6/10
skill GitHub
Git-versioned second brain for AI coding agents (Claude Code, Codex, Gemini CLI, OpenCode) with one rulebook and the agent as the installer. Keeps shared knowledge versioned alongside the codebase.
skillmemorygitknowledgemulti-agent
by natscho-hh Jul 12, 2026 6/10
skill GitHub
A collection of 11 production-tested Claude skills that automate SEO audits, content briefs, and strategy planning using AI-driven research without external data input. Designed for drop-in use in any skills-compatible agent.
skillseocontentautomation
by flakey-caster542 Jul 12, 2026 5/10
skill GitHub
Applies structured scientific reasoning to AI agents — decomposing questions, verifying claim provenance, and ranking explanations by evidence strength. Helps agents approach problems more rigorously by following scientific methodology.
reasoningskillscientificepistemics
by felipedeso7za4444 Jul 12, 2026 6/10
skill GitHub
Claude Code plugin that automates BigQuery tasks including SQL generation, cost optimization, schema design, and anti-pattern detection. Useful for data engineers who want AI-assisted BigQuery work directly in their agent.
bigquerysqldataskillgoogle-cloud
by Ocean1346 Jul 12, 2026 6/10
skill GitHub
Downloads scientific papers automatically from DOI inputs using a six-source fallback chain with zero dependencies. Useful for research agents that need to retrieve academic papers programmatically.
researchpapersdoiskillacademic
by Kara-lynnmacroeconomic2412 Jul 12, 2026 6/10
skill GitHub
A set of reusable Claude Code skills for branch/worktree-based PR workflows, design documents, acceptance tests, and documentation maintenance. Provides a structured git workflow skill pack for teams using Claude Code.
skillprworkflowworktreedocsgit
by kompiro Jul 12, 2026 7/10
skill Reddit
Solves the "debugging the past" problem: when an agent gets an old crash log, this skill resolves the historical commit hash, spins up an isolated git worktree at that exact moment, analyzes the old code for root cause, then removes the worktree — keeping the local workspace untouched. Prevents agents from detached HEAD accidents during historical debugging.
debugginggitworktreeskillhistory
by Puzzled_Camera_7805 Jul 12, 2026 8/10
skill GitHub
Claude Code plugin providing a senior-engineer toolkit with Clean Architecture, DDD, SOLID, TDD, design patterns, and expertise across Go/Rust/TypeScript. Includes a full development lifecycle skill backed by engineering best practices.
skillarchitecturebest-practicesengineeringtdd
by lugassawan Jul 12, 2026 6/10
skill GitHub
ACT-Edition brain template for AI coding assistants with critical thinking, epistemic calibration, and structured reasoning. Provides a CLAUDE.md-compatible configuration that instills more careful, self-questioning behavior in agents.
skillbrainreasoningclaude-mdcalibration
by fabioc-aloha Jul 12, 2026 6/10
skill GitHub
A Claude Code skill that keeps memory tidy by never bloating, avoiding repeated bug fixes, and monitoring its own rules for contradictions. Implements self-policing memory management with constraints on what gets stored and when to compact.
memoryskillcontextself-governance
by itsmynamee Jul 12, 2026 7/10
skill GitHub
A curated collection of practical, evidence-backed skills for coding agents covering common development tasks. Emphasizes real-world tested patterns rather than theoretical or experimental approaches.
skillcuratedcoding
by zacharygcook Jul 12, 2026 6/10
skill GitHub
Provides an agentic project base where Claude Code skills bootstrap and evolve your project, with a deterministic Python CLI that verifies the result. Uses a project.yaml manifest, doctor checks, and path linting as an alternative to traditional project templates.
skillbootstrapprojectverificationscaffold
by Stepkar2004 Jul 12, 2026 6/10
skill GitHub
A library of 31 opinionated go-to-market skills for Claude Code and GitHub Copilot, spanning the full revenue lifecycle: discover, design, position, amplify, launch, optimize, and RevOps. Each skill encodes GTM methodology as a reusable Claude Code skill.
skillsgtmsalesmarketingrevenue
by varunk130 Jul 11, 2026 6/10
skill GitHub
A curated library of 29 production-grade Claude Code custom skills categorized across finance, product management, strategy, game theory, and document processing. Focused on business-domain expertise rather than generic coding tasks, with each skill designed for real workflows.
skillsfinanceproductstrategybusiness
by varunk130 Jul 11, 2026 8/10
skill GitHub
A collection of practical agent skills built for repeatable workflows and durable product or business context. Focused on Claude Code users who need skills that encode real-world business logic rather than generic coding tasks.
skillsworkflowsbusinessproduct
by manansuneja Jul 11, 2026 6/10
skill GitHub
Adds 70 AI personality agents to Claude Code that deliver coding advice through character-based interactions. Each personality maintains accuracy while adding an entertaining style, giving you a range of personas for different coding contexts.
personalityskillsagentscustomization
by psuneeltej3591 Jul 11, 2026 5/10
skill GitHub
A collection of portable Claude Code skills, agents, and rules that can be installed across machines via a single CLI command. Solves the problem of keeping consistent skill setups across different environments without manual file copying.
skillsportabilitycliagents
by arghhhhh Jul 11, 2026 8/10
skill GitHub
A formal trust architecture defining six autonomy levels (L0-L5) for AI agents, each graded by authorization source with a lifecycle for trust promotion and demotion. Includes a Claude Code plugin with an agent skill and policy-driven enforcement hooks to operationalize the spec in real workflows.
autonomytrustpermissionshooksgovernance
by Argyronix Jul 11, 2026 7/10
skill GitHub
Agent skills for integrating Claude Code with the TokenLab API, covering model selection, native endpoints, cost routing, and migration from OpenAI-compatible APIs. Helps developers optimize model choices and reduce inference costs within existing workflows.
skillsapicost-optimizationmodel-routing
by hedging8563 Jul 11, 2026 5/10
skill GitHub
Structured context packs that are versioned and aware of differences across coding agents, supporting Codex, Claude, Cursor, and others. Provides a consistent way to maintain and distribute up-to-date context configuration across different AI coding tools.
contextclaude.mdcompatibilityversioning
by Fharena Jul 11, 2026 5/10
skill GitHub
A Claude Code plugin marketplace that includes a plugin converting Basic Memory into an actively maintained, interconnected knowledge graph. Helps structure and query persistent memory across sessions with richer relationships than flat note storage.
memoryknowledge-graphplugin-marketplacebasic-memory
by voxpelli Jul 11, 2026 7/10
skill GitHub
A reusable Claude skill and agent framework that distills the reasoning workflow patterns from Fable 5, covering prompt orchestration, tool simulation, validation, and project-level automation. Provides a structured approach to building reliable, production-grade agentic workflows.
skillsreasoningorchestrationfableframework
by iesjoaco7-cyber Jul 11, 2026 5/10
skill GitHub
A stack-agnostic collection of Claude Skills covering the full website development lifecycle: brand and design, content creation, SEO, development, operations, growth, and research. Provides a coherent, integrated skill suite for building, shipping, auditing, and optimizing websites entirely through Claude Code.
skillswebsiteseobrandoperationsgrowth
by rampstackco Jul 11, 2026 6/10
skill GitHub
A Claude Code skill that proofreads academic papers in two phases: first detecting writing issues with numbered, organized feedback, then applying fixes. Uses both Claude Code and Codex to catch grammar, clarity, and structure problems in research writing.
skillwritingproofreadingacademiclatex
by reviewtaipei284 Jul 11, 2026 6/10
skill GitHub
A skill and accompanying manifesto for detecting test smells and safely refactoring test suites. It identifies common test anti-patterns (duplication, unclear assertions, brittle fixtures) and proposes targeted refactors. Includes documented principles for what makes a test suite healthy.
skilltestingrefactoringtest-smellsquality
by Texarkanine Jul 11, 2026 6/10
skill GitHub
Your Ultimate Claude Skills Library & Hub 2026 – Integrate & Organize AI Workflows
skillworkflow
by phuati Jul 11, 2026 6/10
skill GitHub
One Claude Code skill that turns a single project into a complete brand launch — 12 files (positioning, hero line, 30-day calendar, content system) in one run. Built on Caleb Ralston, Harry Dry, Or...
skill
by shauryalowkeygotaura Jul 11, 2026 8/10
skill GitHub
Preserve ex conversation style as a reusable skill for realistic chat simulations and memory-driven roleplay
skill
by Acidforming-nature295 Jul 11, 2026 5/10
skill GitHub
Agent skills for building, optimizing, embedding, and exporting VectoJS projects with Codex, Claude Code, Cursor, and GitHub Copilot.
skillgit
by vectojs Jul 11, 2026 9/10
skill GitHub
Cross-platform tool-routing architecture for Codex, Claude Code and zcode. Agent 工具路由、生命周期管理与安全回滚。
skill
by wmqfl861 Jul 11, 2026 9/10
skill GitHub
Second brain for Forward Deployed Engineers. Engagement memory + 35 skills across 6 domains, all behind one @fde... Works with any AI coding agent.
skill
by suboss87 Jul 11, 2026 6/10
skill GitHub
Curated Claude Code plugin marketplace — OpenSpec extensions and autonomous development workflows
skillworkflow
by Stoica-Mihai Jul 11, 2026 8/10
skill GitHub
PPT 专家团:AI 做 PPT 不是生成问题,是工作流问题。八步流程 Claude/Codex skill——从文章、口播稿到可编辑 HTML PPT / 图片版 / PPTX,六套原创风格+风格选择器+12套免费商用字体。
skill
by ThunderOne18 Jul 11, 2026 6/10
skill GitHub
Agent skills (SKILL.md) for discovering your unknowns across the dev lifecycle — from Thariq Shihipar's 'Know Your Unknowns'
skill
by hiendinhngoc Jul 11, 2026 6/10
skill GitHub
A portable discovery methodology for agent skills. Teaches agents how to find skills from catalogs, marketplaces, and GitHub.
skillgit
by CodeSigils Jul 11, 2026 6/10
skill GitHub
20 AI-agent skills for Korean web services — security to SEO/GEO, payments, backups, incident response. One install for Claude Code, Cowork, Cursor & any AGENTS.md tool.
skill
by kdvlop Jul 11, 2026 9/10
skill GitHub
Evidence-first AI Agent Skills for growth marketing — multi-channel analytics (SEO, paid media, social, local search, CRM), secure account integration, AI evaluation, experimentation & approval-saf...
skill
by duandigi Jul 11, 2026 9/10
skill GitHub
In Anthropic's official Claude plugin directory · 400 professional Agent Skills (PRDs, launches, compliance, CVs & more) for Claude, ChatGPT, Gemini, Cursor & Codex. Try free in-browser, or 'npx pm...
skill
by mohitagw15856 Jul 11, 2026 8/10
skill GitHub
Official Clawby skills for AI agents — live market, on-chain & social data plus trade execution. One API key, any agent.
skillapi
by openclawby Jul 11, 2026 6/10
skill GitHub
Connect your AI agent to 100+ blockchains via RPC using decentralized routing, automated API keys, and prebuilt tools for immediate integration.
skillapi
by Leosb4305 Jul 11, 2026 6/10
skill GitHub
Transform vague ideas into precise instructions or clear decisions using Wittgenstein, Socratic and Polanyi frameworks as a Claude Code skill.
skill
by Hyanthropological659 Jul 11, 2026 8/10
skill GitHub
Top Dev Skill Builder 2026: Master Git Worktrees, Code Reviews & DDD
skillgitreview
by sakshisantoshthorat Jul 11, 2026 5/10
skill GitHub
A cross-tool AI agent skill for Java + Spring Boot: dev conventions, code review, testing, and JVM troubleshooting. Works with Claude Code, Codex, OpenCode, ZCode. MyBatis-Plus default, 26 rules.
skilltestingreview
by zander-zyx Jul 11, 2026 9/10
skill GitHub
Automate Reddit tasks using your actual browser and account with support for AI agents and the SKILL.md format.
skill
by beggarticksarthurtatum121 Jul 11, 2026 6/10
skill GitHub
Build high-converting app onboarding flows using a proven 14-screen psychological framework through this Claude Code skill.
skill
by Cutofftranslation467 Jul 11, 2026 8/10
skill GitHub
Build AI skills that distill any person’s thinking into reusable workflows and prompts
skillworkflow
by gianguardant971 Jul 11, 2026 5/10
skill Reddit
Had some fable usage to waste yesterday cause my reset was gonna happen. Ended up burning all my usage so had to finish the last part with Sol itself. Imo Remotion based videos feel better to watch...
api
by mesmerlord Jul 11, 2026 5/10
skill GitHub
Claude Code skill: RSS-based daily news digest (invest / IT / tech), Chinese output, no API key
skillapi
by NatChang Jul 11, 2026 8/10
skill GitHub
The complete toolkit for building AI agents in JavaScript. Lightweight core, React & Terminal UIs, autonomous runtime, tools, skills, memory, RAG and observability. Plug-and-play from chat UI to fu...
skill
by AgentsKit-io Jul 11, 2026 6/10
skill GitHub
My daily-driver Claude Code and Codex loadout
skill
by kennykankush Jul 11, 2026 8/10
skill GitHub
This is WordPress and Elementor skill.md made for Claude.ai
skill
by guramzhgamadze Jul 11, 2026 6/10
skill GitHub
Shape rough requests into evidence-backed /goal completion contracts — an Agent Skill for Claude Code and Codex
skill
by gotalab Jul 11, 2026 9/10
skill GitHub
Enable collaborative coding in Claude Code with automated expert roles for test-driven, quality-checked mob and pair programming workflows.
skillworkflow
by dappled-roadagent484 Jul 11, 2026 8/10
skill GitHub
Provide OpenClaw skills to streamline trade show selection, pre-show planning, on-site execution, and post-show follow-up.
skill
by rubyt5673 Jul 11, 2026 5/10
skill GitHub
Conservative, modular, context-aware file reorganization skill with rollback-first safety.
skill
by mazze93 Jul 11, 2026 5/10
skill GitHub
Deliver comprehensive SEO automation with 24 AI-powered skills covering audits, technical SEO, content, links, local SEO, and keyword research.
skillautomation
by square-lupus579 Jul 11, 2026 5/10
skill GitHub
Manage DNS records and automate VPS operations with tools supporting multiple cloud providers and streamlined server maintenance tasks.
skill
by ammar2211332-jpg Jul 11, 2026 6/10
skill GitHub
Enhance LLM agents with practical skills for neurodivergent support, focus, and communication to improve AI coding assistance and interaction quality.
skill
by Blaynelargish66 Jul 11, 2026 6/10
skill GitHub
Provide ready-to-use Claude Code commands, subagents, hooks, skills, and configs to simplify setup and speed up development.
skillhookcommandconfig
by halflength-ampleness75 Jul 11, 2026 10/10
skill GitHub
A small collection of Claude Code skills I use and maintain.
skill
by duthaho Jul 11, 2026 8/10
skill GitHub
Auto-updated Hyprland wiki documentation for AI coding assistants — works with 33+ tools via the Agent Skills standard (SKILL.md)
skill
by marceloeatworld Jul 11, 2026 6/10
skill GitHub
Autonomous Claude Code agent — 14 specialized agents, 10-parallel execution, project-specific skill learning, mechanical checkpointing, wave-based planning with acceptance gates, caveman ultra (~75...
skill
by randomittin Jul 11, 2026 9/10
skill GitHub
防 fan-out 暴衝撞 Anthropic acceleration-limit / short-burst 節流(429/529)的 Claude Code plugin(自帶 marketplace)。pacing-guard PreToolUse hook:burst 超量 deny、Fable 5 開 Workflow deny、間隔太近 sleep、寬 fan-out 建議 p...
skillhookworkflow
by PsychQuant Jul 11, 2026 10/10
skill GitHub
AI 产品经理的 Claude Skills 集合 · PRD 写作 / 项目脚手架 / SaaS 架构图 / 高保真原型 / 对话归档
skill
by songshishuang Jul 11, 2026 6/10
skill GitHub
Temporal Awareness for AI Agents 2026 - Time-Passing Lightweight Hooks + Skill SDK
skillhook
by Karthiknarsimsetty22 Jul 11, 2026 8/10
skill GitHub
Trello raw-API skill for Claude Code — SKILL.md + curl helper (list/read/comment/upload/download attachments) with onboarding guide
skillapi
by towfikul-islam Jul 11, 2026 8/10
skill GitHub
My assortment of Claude Code skills
skill
by ivuorinen Jul 11, 2026 8/10
skill GitHub
AI agent financial skill — real fundamentals, deterministic math, fail-closed. Stop agents inventing stock numbers.
skill
by notEhEnG Jul 11, 2026 6/10
skill GitHub
Humanizer skill for Claude: rebuild AI text in a human voice while freezing every fact. Benchmarked: beat the raw baseline on blind preference 8-4 (after publishing 3 honest failures).
skill
by Skillproofdev Jul 11, 2026 6/10
skill GitHub
Generate AI-powered PowerPoint presentations from academic papers with native math, diagram support, and multi-stage content analysis.
skill
by Shimonimposed141 Jul 11, 2026 5/10
skill GitHub
Share and organize custom Claude AI skills with access to useful external skill libraries and resources for enhanced workflow integration.
skillworkflow
by robuxref2005 Jul 11, 2026 6/10
skill GitHub
English to Hungarian translation skill for Claude. Idiomatic, native Hungarian instead of literal calque, built on the most common EN to HU translation mistakes.
skill
by forint573 Jul 11, 2026 6/10
skill GitHub
AI agent skills for the personal operator's craft — decisions, research, second-brain, content rotation, scenario modeling, and meta-skills to author more. Works with Claude Code, Codex, Cursor.
skill
by coreyhaines31 Jul 11, 2026 9/10
skill GitHub
AI-Powered B2B Outreach Plugin 2026: Persistent Briefing & 40 Skills for Claude Code
skill
by juniorbaixista4 Jul 11, 2026 8/10
skill GitHub
Best Free AI Agent Quality Engineering Tools 2026 – Proven Skills & Hacks
skill
by rgyan25 Jul 11, 2026 6/10
skill GitHub
2026 AI Training Module Generator - Instant Shockproof Skills Download
skill
by Tico1000 Jul 11, 2026 5/10
skill GitHub
Best Free AI Code Assistant 2026 – No-Code AI Agent & Skill Bundle Download
skill
by Mustofa45 Jul 11, 2026 6/10
skill GitHub
Agent Skill: finish Higgsfield-generated clips into one video — stitch, grade, add an original licensed soundtrack matched to the cut (Sonilo)
skill
by cindyxu1030 Jul 11, 2026 6/10
skill GitHub
中文长文写作引擎 · Claude Code skill:选题→大纲→正文→改稿→微信排版→配图。喂它你的语料,它长出你的声音。
skill
by sandypoli-boop Jul 11, 2026 8/10
skill GitHub
AI agent skills for resumable project control. Garelier (Garage + Atelier) organizes PM, knowledge, review, and execution lanes for Claude Code / Codex.
skillreview
by aby-studio-works Jul 11, 2026 9/10
skill GitHub
Self-host an AI companion locally — local LLM, persona & memory, optional voice cloning, phone-ready PWA, parental dashboard. Includes a Claude Code skill.
skill
by viviansina-design Jul 11, 2026 8/10
skill GitHub
Enforce MECE checks to find overlaps, gaps, and cleanly decompose specs, plans, and AI prompts
skill
by bigboskuai-prog Jul 11, 2026 5/10
skill GitHub
Guide GRC teams with Claude Skills for ISO 27001, SOC 2, FedRAMP, GDPR, HIPAA, NIST CSF, PCI DSS, TSA, and ISO 42001
skill
by Jandyoverseas977 Jul 11, 2026 6/10
skill GitHub
为 B 站及全平台数码内容创作者生成高质量视频封面的 Codex / Claude Code Skill
skill
by GameChicks Jul 11, 2026 8/10
skill GitHub
司南:个性化 AI 任务总控 Skills 系统 /COMPASS: Personal Alignment Skills OS for AI Agents
skill
by dongshuyan Jul 11, 2026 6/10
skill GitHub
把一本书或一组视频蒸馏成单文件交互 HTML 页 · A book/video distillation skill for Claude Code, by 叁笙
skill
by sandypoli-boop Jul 11, 2026 8/10
skill GitHub
Public personal stack content (skills, agents, personal contexts) for pdctx framework. Renamed from pstack 2026-04-29.
skill
by panda850819 Jul 11, 2026 6/10
skill Reddit
I am not sure if this is a bug, but it never did it before. I asked a super simple task (add version number to the botton of the screen) and went on playing Doom, next time I checked on it - 100% l...
skill
by ParticularAnt5424 Jul 11, 2026 5/10
skill GitHub
Implement an executable cognitive framework based on Michael Polanyi's theories to refine decision-making, pattern recognition, and knowledge transfer.
skill
by Marlenedead327 Jul 11, 2026 5/10
skill GitHub
Free Claude skills that keep AI-assisted writing honest and yours: line edits, AI-tell checks, tone audits, full reviews, UX reviews, journey maps, copyright basics.
skillreview
by cabbagecachekid Jul 11, 2026 6/10
skill GitHub
DSA-Visualiser-Claude-Skill:
skill
by Rushil1507 Jul 11, 2026 6/10
skill GitHub
收录最全、更新最快的技能Skills 商店,涵盖文档处理、内容创作、编程开发、机器学习、自动化工作流等多个领域的 72 个精选技能包。所有技能已打包完成,可直接安装使用! 该商店中自动抓取了 Github 上的所有的 Skills 项目,并按照分类、更新时间、Star 数量等标签进行整理。
skillgit
by anbeime Jul 11, 2026 5/10
skill Reddit
https://github.com/calesthio/generative-media-skills Try if this is useful for you submitted by /u/Responsible_Maybe875 [link] [comments]
skillgit
by Responsible_Maybe875 Jul 11, 2026 8/10
skill GitHub
Automatically updated NixOS and Nix ecosystem documentation for AI coding assistants. Works with 33+ tools via the Agent Skills standard (SKILL.md).
nixosnixdocumentationskillauto-updatedecosystem
by marceloeatworld Jul 11, 2026 7/10
skill GitHub
25 skills covering procedural oceans, clouds, planets, water optics, image pipelines, and screenshot-backed visual validation. For Claude Code, Codex, Cursor, and any skill-aware agent.
threejswebgpu3dproceduralvisual-validationskill
by linegel Jul 11, 2026 7/10
skill GitHub
Provides framework-agnostic project memory for agents — preserving architecture, decisions, and conventions across sessions. No database, no server, pure Markdown.
memoryproject-contextarchitecturedecisionsmarkdownskill
by TheaDust Jul 11, 2026 7/10
skill GitHub
Universal LaTeX document skill with 27 templates, 27 scripts, and 26 reference guides for scientific, technical, and academic document production.
latextemplatesacademicdocumentsscientific
by ndpvt-web Jul 11, 2026 7/10
skill GitHub
Organized by where each skill fits in the research lifecycle — from literature search to peer review. Each entry notes its license and what it runs. CC0.
academicresearchskillsindexliterature-review
by O0000-code Jul 11, 2026 7/10
skill GitHub
Checks whether writing sounds AI-generated, flags cringe, and runs a full review including anti-inflation and fact passes. Composable Claude Agent Skills for keeping AI-assisted writing honest.
writingreviewai-detectionfact-checkingskill
by cabbagecachekid Jul 11, 2026 7/10
skill GitHub
A structured approach to invoke deeper reasoning in Claude, going beyond simple 'think hard' prompts with a skill that activates more structured deliberation.
thinkingreasoningpromptingskill
by skyf0xx Jul 11, 2026 7/10
skill GitHub
A Claude Code plugin covering the full documentation lifecycle: bootstrap → write → detect drift → fix. Turns docs into verifiable claims the agent can check against the codebase.
documentationdrift-detectionpluginverificationlifecycle
by aj604 Jul 11, 2026 7/10
skill GitHub
Converts traces from Claude Code and other agents into reusable skills that can be shared and replayed across agents. Distills learned behaviors automatically.
skillstracesreusabledistillationautomation
by activeloopai Jul 11, 2026 7/10
skill GitHub
Adds inline code review thread functionality to Claude Code, enabling per-line comments and threaded review discussions similar to GitHub pull request reviews.
code-reviewinline-commentspluginthreads
by synodic-studio Jul 11, 2026 7/10
skill Reddit
Teaches coding agents four workflows: capture rationale during development, recover it retrospectively, analyze before interviewing maintainers, and maintain living project context. Rationale is classified as confirmed/inferred/unknown — agents must never invent project history.
skillrationalecontextdocumentationknowledge-preservation
by oliver-zehentleitner Jul 11, 2026 8/10
skill Reddit
Requires the agent to write down the goal and scope before touching files, run checks after the task, and classify results as PASS/WARN/BLOCK. Leaves an HTML replay and structured findings in .agent-ledger/ for human and agent review.
skillverificationauditscopeaccountability
by ErProff Jul 11, 2026 8/10
skill GitHub
Write skills once, run them in Claude Code, Cursor, Codex, Copilot, Gemini CLI, and more. A cross-harness package manager that compiles and distributes agent skills.
skillspackage-managercross-platformcodexcursor
by singhharsh1708 Jul 11, 2026 8/10
skill GitHub
Covers autonomy ladder, composition patterns, the 8-layer harness, and eval discipline — plus a Claude Code skill set that operationalizes it. Comprehensive reference for serious agent builders.
standardsproductionautonomyharnessevalcomposition
by Moai-Team-LLC Jul 11, 2026 8/10
skill GitHub
Vet, sign, and pin every skill and MCP server before it runs. Part of the 'Own Your Agent Security' suite, pairs with a runtime firewall to protect the full agent supply chain.
securitysupply-chainskillsmcpsigningpinning
by askalf Jul 11, 2026 8/10
skill GitHub
Rules synthesized from 407 real product sites: page-type playbooks with pattern frequencies, 9 style guides, per-site hex/type tokens, and a DESIGN.md generator. Free, local, MIT.
designuiplaybooksstyle-guideevidence-based
by veryCoolTimo Jul 11, 2026 8/10
skill GitHub
A reusable skill for AI coding agents that generates single-file analytical HTML articles with built-in dark mode, responsive layouts, and zero external dependencies. The skill produces standalone files that work without a build system, making it easy to share research or documentation as self-contained pages. Targeted at agents that need to output structured reports.
skillhtmldocumentationreportsdark-modeself-contained
by studious-mantle460 Jul 10, 2026 5/10
skill GitHub
A Claude Code skill that reviews technical documentation against the Microsoft Writing Style Guide and rewrites non-compliant sections. Useful for teams shipping public-facing developer docs who want consistent, professional tone without manually consulting the guide. Drop-in skill for documentation review workflows.
skilldocumentationwritingstyle-guidemicrosoft
by kongma1891 Jul 10, 2026 6/10
skill GitHub
A small collection of Claude Agentic Skills covering PDF content extraction, automatic Anki flashcard generation, and revision note creation. Good starting point for study and knowledge management workflows within Claude Code. Each skill is composable and can be triggered via slash commands.
skillpdfankiflashcardsnotesstudy
by maaarcooo Jul 10, 2026 6/10
skill GitHub
A tool for syncing a single trusted AI-agent configuration—skills, rules, MCP servers, and scripts—across multiple repositories and coding agents. Ensures consistent behavior and prevents config drift when working across many projects simultaneously.
skillssyncmulti-repoMCPconfiguration
by lucastraba Jul 10, 2026 6/10
skill GitHub
A Claude Code skill by a 12-year product manager for taking non-engineers from a vague idea to a buildable plan. Guides through GitHub basics, clean-code habits, a verify-and-iterate loop, and a project checkup. Contrasts with the developer-targeted grill-me skill — this one is for everyone else.
planningskillbeginnersproduct-managementworkflow
by TexasBedouin Jul 10, 2026 6/10
skill GitHub
A Claude Code plugin with a sourced rulebook that takes an adversarial approach to reviewing code touching money. Designed to catch bugs, edge cases, and compliance issues in financial code paths by roasting them rather than gently suggesting improvements.
fintechsecuritycode-reviewpluginfinance
by DylanMerigaud Jul 10, 2026 6/10
skill GitHub
A skill set packaging senior-level UX and design-system expertise so AI agents apply it automatically during development. Covers component design, design-system conventions, and accessibility without manual prompting per task.
UXdesign-systemskillsUIaccessibility
by dembrandt Jul 10, 2026 5/10
skill GitHub
Claude skills for structuring messy business context into clear asks, decisions, owners, updates, and follow-ups. Extends Claude Code's usefulness beyond pure coding into business process facilitation and meeting/communication management.
skillsbusinessdecisionsworkflowproductivity
by tmusser Jul 10, 2026 5/10
skill GitHub
A Claude Code skill that scaffolds backend and frontend boilerplates on command, covering Sanic, FastAPI, Express, Express-MVC, React+Vite, and MERN stacks. Checks dependencies, confirms before installing, scaffolds the project structure, and sets up the local environment.
scaffoldingboilerplateskillFastAPIReactExpress
by ABaliyan31 Jul 10, 2026 6/10
skill GitHub
A design craft skill for Claude Code modeled on 16 years of product design expertise. Reviews UI, cites a specific design rule per finding, and proposes numbered fixes. Backed by a library of 504 design practices covering layout, typography, color, and interaction.
designUIUXskillscode-review
by AnimaEcho Jul 10, 2026 6/10
skill GitHub
A collection of MIT-licensed reusable AI skills for Codex and Claude Code covering safe publishing, research briefs, case studies, web scraping, copy cleanup, and release automation.
skillspublishingresearchweb-scrapingautomation
by jqaisystems Jul 10, 2026 5/10
skill GitHub
A Claude Code skill that maps all your local AI prompts and skills across Claude, Cursor, ChatGPT, or any folder, detects functional overlaps, and helps you decide what to consolidate or delete. Useful for cleaning up a bloated skill collection spanning multiple agents.
skillsorganizationdeduplicationmanagementprompts
by yyy805 Jul 10, 2026 6/10
skill Reddit
A scaffolding skill that creates CLAUDE.md, a read-only vision.md (chmod 444 + pre-commit hook), architecture.md, a decision ledger, session log, and append-only errors.jsonl. Keeps AI agents from re-litigating settled decisions and quietly rewriting your north-star intent across sessions.
CLAUDE.mdscaffoldingstarterproject-structurehooks
by The___Storyteller Jul 10, 2026 8/10
skill GitHub
A comprehensive Claude Code plugin providing specialized slash commands for Drupal and WordPress development. Offers CMS-specific guidance to keep agents aligned with Drupal/WordPress conventions and best practices.
DrupalWordPressCMSpluginslash-commands
by kanopi Jul 10, 2026 6/10
skill GitHub
A templating tool that renders one set of reusable AI agent and skill definitions into harness-native files for .claude/, .codex/, and .agents/ directories. Eliminates the need to maintain separate skill definitions per coding agent when working across multiple platforms.
skillscross-agenttemplatesworkflowautomation
by dustinkeeton Jul 10, 2026 6/10
skill GitHub
A comprehensive set of 94 specialist Blender skills for use with Claude Code, Cursor, Kiro, and Codex. Covers a full MCP-powered production pipeline from blockout to game engine export, targeting Blender artists who want AI assistance in their existing workflow.
Blender3DMCPskillsgame-development
by arjun988 Jul 10, 2026 7/10
skill GitHub
Claude Code skills for AI-driven Odoo development that read ground truth from the running instance (fields, MRO chains, views, security) before writing any code. Builds the smallest correct change, proves it with a test, and reviews before merge — never guessing from outdated docs.
OdooERPskillsPythontesting
by tuanle96 Jul 10, 2026 6/10
skill GitHub
An agent skill that scores a plan or spec's autonomous-build readiness before any code exists. Evaluates the spec from a zero-context builder's seat, surfacing ambiguities and gaps that would cause an agent to stall or go wrong. Works in both Claude Code and opencode.
planningspecred-teamingpre-buildskill
by jovylle Jul 10, 2026 7/10
skill GitHub
A growing personal collection of AI skills for OpenCode and Claude Code that enforces strict clean architecture and professional development standards. Serves as a template for organizing opinionated skill collections.
skillsclean-architectureOpenCodestandards
by ralvarezdev Jul 10, 2026 5/10
skill GitHub
A Claude Code skill for building live workshop journals with audio transcription and keyword extraction. Outputs a searchable JupyterBook knowledge base from workshop sessions, making captured learning immediately navigable.
workshopaudiotranscriptionJupyterBookknowledge-base
by janineagu4049 Jul 10, 2026 5/10
skill GitHub
A single prompt file that improves AI coding assistant behavior by enforcing better verification, structured workflows, and code quality standards. Drop it into any project to upgrade how Claude Code approaches tasks without extensive CLAUDE.md configuration.
CLAUDE.mdpromptworkflowcode-quality
by Heartbreaking-greenhouseeffect508 Jul 10, 2026 5/10
skill GitHub
A collection of reusable Claude Code skills covering pull-request review, security auditing, and dependency analysis. Designed to save time on recurring engineering tasks by providing repeatable, high-quality skill definitions.
skillsPR-reviewsecuritydependencies
by nariatrip191 Jul 10, 2026 5/10
skill GitHub
A set of evidence-first skills covering research, debugging, planning, execution, review, and goal loops. Compatible with Claude Code, Codex, and Cursor for cross-agent flexibility.
skillsresearchdebuggingplanningcross-agent
by JinPLu Jul 10, 2026 5/10
skill GitHub
Distilled operating skills for daily-driver Claude models: dense rules with executable gates instead of long prose. Designed to maximize signal-to-noise in system prompts and CLAUDE.md configurations.
skillsoperating-rulesCLAUDE.mdoptimization
by F-e-u-e-r Jul 10, 2026 5/10
skill GitHub
Generate draw.io diagrams from natural language — 6 presets, vision self-check + up to 5-round refinement, codebase-to-diagram, 10,000+ official shapes & 321 AI/LLM brand logos. Exports PNG/SVG/PDF...
skill
by Agents365-ai Jul 10, 2026 5/10
skill GitHub
Review Judgment as Code for AI-assisted development — codify your team's review standards as repo-owned skills and run them across plans, diffs, tests, and prior reviews.
skillreview
by s977043 Jul 10, 2026 5/10
skill GitHub
Summon the spirits, ship the backlog — autonomous multi-day dev-agent orchestrator: one bash script, a file convention, five Claude Code skills
skill
by nikrich Jul 10, 2026 9/10
skill GitHub
AI agents and Nix: parametrable skills/instructions and tools, packaged together in a reproducible and modular fashion
skill
by YPares Jul 10, 2026 6/10
skill GitHub
🏨 Hotel AI Skills 2026: Enterprise Revenue & P&L Optimization Suite
skill
by sujal11101 Jul 10, 2026 5/10
skill Reddit
Anthropic’s CEO, Dario Amodei, recently said that we’re on track to see a billion‑dollar company run by one person using AI but that it hasn’t happened yet and that there are already two‑person AI ...
review
by sibraan_ Jul 10, 2026 6/10
skill GitHub
Defensive, read-only security assessment skill for Claude Code (Semgrep + osv-scanner + gitleaks) with a reproducible reliability grade (0-100, A-F).
skillgit
by give-jd Jul 10, 2026 8/10
skill GitHub
A library of Agentic Skills for Claude Code and LLM agents, codified from social science standards and methodological texts for doing experimental and other kinds of work.
skill
by scdenney Jul 10, 2026 9/10
skill GitHub
Turn chat logs, photos, and notes into an AI skill that speaks in her voice and helps you keep the memory alive
skill
by eramabb8026 Jul 10, 2026 5/10
skill GitHub
跨裝置同步 Claude Code / Codex 設定、agents、skills 與 rules 的 Git 工具
skillgitconfig
by lllloo Jul 10, 2026 10/10
skill GitHub
Scan codebases for security flaws with LLM agent skills that turn Claude Code, Cursor, and other assistants into SAST scanners
skill
by reasonless-throne486 Jul 10, 2026 9/10
skill GitHub
A Claude Code skill that turns a raw screen recording into a polished, cropped, captioned social‑media clip — shot list to final render, no timeline scrubbing required.
skill
by joanseg Jul 10, 2026 8/10
skill GitHub
Agent skills for live Indeed job postings data. Search roles, salaries, and descriptions from Claude, ChatGPT, Cursor, or any agent loop via the RolesAPI REST API.
skillapi
by nikhonit Jul 10, 2026 7/10
skill GitHub
CLI tools skills for AI coding assistants (Claude Code, Codex, Gemini CLI).
skill
by Dianel555 Jul 10, 2026 8/10
skill GitHub
Install obra/superpowers skills into the Trae IDE, activated from the first message via User Rules.
skill
by luyangkk Jul 10, 2026 5/10
skill GitHub
Compile messy document directories into Karpathy-style llm_wiki knowledge bases — standalone Q&A CLI + Claude Code/Codex skills
skill
by sdsrss Jul 10, 2026 8/10
skill GitHub
Douyin web automation skill for Codex and Claude Code: publishing, content browsing, information collection, and user interaction.
skillautomation
by JMY2003 Jul 10, 2026 8/10
skill GitHub
Xiaohongshu web automation skill for Codex and Claude Code: scripted note publishing, content browsing, information collection, and user interaction.
skillautomation
by JMY2003 Jul 10, 2026 8/10
skill GitHub
A multi-skill toolkit for passive vulnerability target discovery and VulDB/CVE advisory reporting.
skill
by bx33661 Jul 10, 2026 5/10
skill GitHub
Prompts, skills, and agents that survive contact with real workflows. No vendor loyalty. Occasionally heretical. 🧙🏻♀️
skillworkflow
by MarieLynneBlock Jul 10, 2026 6/10
skill GitHub
数学建模技能 - 为CUMCM、MCM/ICM等数学建模竞赛提供结构化的三阶段工作流程:建模分析、代码实现、论文撰写。包含丰富的算法资源库(优化/预测/评价/图论/机器学习等)、角色指导文档、论文模板和实用工具脚本。
skill
by XiaoMaColtAI Jul 10, 2026 5/10
skill GitHub
Agent Skill for handing tasks off to other AI models headlessly - GPT (codex exec), GLM (opencode run / zcode --prompt), Grok (grok -p), Claude (claude -p) - with preflight availability and provide...
skill
by dorukardahan Jul 10, 2026 7/10
skill GitHub
Provide AI-powered product management skills for discovery, strategy, prioritization, and PRD writing to help PMs and founders ship faster.
skill
by AashutoshR2062 Jul 10, 2026 5/10
skill GitHub
Convert public URLs to clean Markdown using selectable methods for versatile output modes and improved content accuracy.
skill
by CenMeow Jul 10, 2026 5/10
skill Reddit
Strategy consultants out there: what and how do you use Claude, especially Code, Cowork and Skills for your daily work? See alot of input on this sub from developers and I know finance is starting ...
skill
by Jobuno Jul 10, 2026 8/10
skill GitHub
Reusable skills, hooks, statusline tools, and installers for Codex, Claude Code, and opencode.
skillhook
by kairyou Jul 10, 2026 10/10
skill GitHub
SEO-aware, human-sounding translation skill for Claude & Claude Code — per-market registers, never-translate list, measured token costs (76k/language)
skill
by Skillproofdev Jul 10, 2026 8/10
skill GitHub
DDD development skill suite for coding agents — roadmap, implementation, audit.
skill
by litecore-ai Jul 10, 2026 6/10
skill GitHub
UIKit Expert Skill 2026 - Best Practices & High Performance Swift Code
skill
by Trentobobbi Jul 10, 2026 5/10
skill GitHub
网文/小说写作 skill 包,覆盖长篇与短篇网络小说的扫榜、拆文、写作、去AI味、封面图全流程
skill
by worldwonderer Jul 10, 2026 6/10
skill Reddit
Hi folks, There's a ton of information out there about code reviews. A whole bunch of skills like this and this , but it's just so easy to go overboard. Additionally, just adding a skill and using ...
skillreview
by maloik Jul 10, 2026 6/10
skill GitHub
在你手上每一張卡裡,即時挑出回饋最高的那張——CardRadar 是一個讀取 Notion 信用卡回饋規則、依「實拿金額」而非帳面利率排名的 Claude Skill。 · A Claude Skill that picks the highest-earning card in your wallet: it reads your credit-card rules from Notion...
skill
by kau10082 Jul 10, 2026 6/10
skill GitHub
Agent skills we use daily in the studio — reusable, on-demand context for Claude Code, Cursor & other skills.sh-compatible AI agents. Install: npx skills add stealth-engine/skills
skill
by stealth-engine Jul 10, 2026 9/10
skill GitHub
Claude Code skills for SEO, content localization, and digital PR - built for TrueProfit's ecommerce workflow
skillworkflowgit
by khanhvo2172-dotcom Jul 10, 2026 8/10
skill Reddit
My use case is software engineering. I’ve been a heavy Claude user for well over a year now, and since Opus 4.7 and the “comeback” of Fable 5, I can no longer trust Anthropic models to complete the...
skillapiclaude.md
by cbl_lbc Jul 10, 2026 10/10
skill GitHub
⌘ Zero-dependency local dashboard for Claude Code — commands, skills, agents, plugins, workflows, sessions & a ccusage-accurate usage dashboard
skillcommandworkflow
by 13days Jul 10, 2026 9/10
skill GitHub
Редакторский инструмент для естественного делового письма на русском без нейрояза, канцелярита, карьерных штампов и выдуманных деталей.
skill
by ValentinAvramko Jul 10, 2026 5/10
skill GitHub
Skills for your skills: local governance for agent skill libraries.
skill
by MisterBrookT Jul 10, 2026 6/10
skill GitHub
Open MIT JSON spec for screenshots fed to AI agents. v2: scroll captures as frames[]. Bounding boxes, OCR text, colors, annotations with intent and target_ref.
skill
by bickov Jul 10, 2026 6/10
skill GitHub
可用于 AI Agent 的 deyo skill,用于小宇宙、B站、小红书、抖音、Youtube的视频文案转写。
skill
by casatwy Jul 10, 2026 6/10
skill GitHub
Han: AI skills and agents for "Solo" product engineers and small teams
skill
by testdouble Jul 10, 2026 6/10
skill Reddit
I see a lot of people saying they subscribe and use both at once. Does anyone want to share their harness setup? Do you just use the Claude Code UI and write a skill that encourages it to delegate ...
skill
by UglyChihuahua Jul 10, 2026 10/10
skill GitHub
Skills for Dataproc
skill
by gemini-cli-extensions Jul 10, 2026 5/10
skill GitHub
Collection of free PPC AI skills, ready for use with any AI harness, but built for Claude Code originally.
skill
by fourteenwm Jul 10, 2026 8/10
skill GitHub
Multi-account manager + skills suite for Claude Code (and Codex) — live usage tracking with auto account-switching, a macOS menu-bar pill, 30 curated slash commands and 10 review agents, all run fr...
skillcommandreview
by jackneil Jul 10, 2026 9/10
skill GitHub
Skills built and bench-tested by SkillProof — SEO-aware translation for Claude with measured token costs
skill
by Skillproofdev Jul 10, 2026 6/10
skill GitHub
Verifiable-research skill for Claude — 8 enforceable rules: live sources over memory, per-claim citations, independent 2-source triangulation, [unverified] flags, adversarial pass. Measured: −59% w...
skill
by Skillproofdev Jul 10, 2026 6/10
skill Reddit
The paper is "From Model Scaling to System Scaling: Scaling the Harness in Agentic AI" (arXiv:2605.26112). Core claim: once models are good enough, agent performance comes from the system around th...
skillconfig
by 0xlight Jul 10, 2026 10/10
skill GitHub
🪨 paleo — personal multi-agent skill collection by mocasus (Claude Code / Codex / Gemini / Hermes)
skill
by mocasus Jul 10, 2026 9/10
skill GitHub
An Agent Skill that gives your AI agent offline access to Zeal docs on Linux
skill
by xr09 Jul 10, 2026 6/10
skill GitHub
Practical Claude Code skills — English-for-engineers coaching, Pi Agent setup, and more. Install via npx skills add.
skill
by wquguru Jul 10, 2026 10/10
skill GitHub
Your own ByteDance, powered by Codex skills.
skill
by elan6666 Jul 10, 2026 5/10
skill GitHub
Agent skills for working with Ruby on Rails 8+
skill
by mickzijdel Jul 10, 2026 6/10
skill GitHub
From an idea, a PRD, or a live site to a complete brand and a production Next.js marketing site. An agent-skill framework for Claude Code, Codex, and any SKILL.md agent.
skill
by Adhunik-Labs Jul 10, 2026 9/10
skill GitHub
Hooks and skills for Claude to write better code and verify its work, and an easy start to using Claude Code
skillhook
by mickzijdel Jul 10, 2026 10/10
skill Reddit
submitted by /u/Excellent_Table_4319 [link] [comments]
skill
by Excellent_Table_4319 Jul 10, 2026 6/10
skill GitHub
Agent-first CLI that runs Codex, Claude Code, and Grok as detached coding workers, while a stronger model keeps orchestration, steering, and review.
skillreview
by boldprojekte Jul 10, 2026 9/10
skill GitHub
Agent skills for Claude Code and Codex: multi-agent orchestration, code review with an A-F ship grade, AI evals, CI ship-gates, and design/copy/SEO. 21 MIT-licensed skills.
skillreview
by JasonColapietro Jul 10, 2026 9/10
skill GitHub
Ryan Krol's personal Claude Code plugin marketplace — incl. ralph-harness (per-task-model, CI-gated autonomous build loop).
skill
by RyanMKrol Jul 10, 2026 8/10
skill GitHub
Provide software design guidance based on John Ousterhout’s principles to improve code quality, architecture, and maintainability during development.
skill
by hotopla5976 Jul 10, 2026 5/10
skill GitHub
Enable AI coding assistants to generate accurate Swift tests using structured testing features tailored to common LLM errors.
skilltesting
by Acromegaliacanaliculus452 Jul 10, 2026 6/10
skill GitHub
Provide 25 Excel operations using openpyxl without Excel, supporting full server or minimal command-line runs for flexible automation.
skillcommandautomation
by Likaxy Jul 10, 2026 6/10
skill GitHub
Deploy and manage AI training jobs on rented GPU cloud providers, bare metal servers, and Kubernetes clusters using an automated agent skill.
skill
by Udalefourfold471 Jul 10, 2026 6/10
skill GitHub
2026 AI Skills Toolkit for Devs & Creators - 27+ Specialized Tools
skill
by Ogabriel-Pro Jul 10, 2026 5/10
skill GitHub
Turn any writer's collected essays into an inspiration-ranked audiobook with a local TTS model. A Claude Code skill set.
skill
by annexiao Jul 10, 2026 8/10
skill GitHub
Build AI skills, teaching materials, and real-world patterns for non-technical builders learning Claude Code, automations, apps, and agents
skillautomation
by derrickbiotypic865 Jul 10, 2026 9/10
skill GitHub
Build AI chief of staff skills for founders, with frameworks for strategy, GTM, sales, and ops in one repo
skill
by Layneformalized225 Jul 10, 2026 5/10
skill GitHub
Build reusable AI agent skills for marketing and engineering tasks with on-demand, domain-specific guidance.
skill
by hssh8917 Jul 10, 2026 6/10
skill GitHub
🏛 One install, everything: 16 auto-routing disciplines + 170 merged skills under pantheon-native names — self-recalling memory, a verification gate that blocks fake done, receipts, budgets, team pa...
skill
by MiracleWeb3 Jul 10, 2026 9/10
skill GitHub
Claude Code skills that make Claude (Fable) the conductor of AI worker fleets: many parallel OpenAI Codex workers plus Opus design agents, organized into campaigns, waves, squads, and review gates.
skillreview
by jvogan Jul 10, 2026 9/10
skill GitHub
🤖 Issue driven development instruction template for the Claude / Codex / Copilot; since 2026.5
skill
by kurone-kito Jul 10, 2026 6/10
skill Reddit
This came out of a real cleanup this week, figured others probably have the same problem brewing. The setup: docs that agents must read every session (CLAUDE.md, AGENTS.md, whatever they point to) ...
skillgitclaude.mdreview
by eliaff Jul 10, 2026 10/10
skill GitHub
Give your AI coding agent a Roblox brain. Curated skills for Roblox Studio development.
skill
by TabooHarmony Jul 10, 2026 6/10
skill GitHub
Curated, eval-backed skills for AI agents.
skill
by SylphxAI Jul 10, 2026 6/10
skill GitHub
Spring Boot skills for AI coding agents
skill
by sivaprasadreddy Jul 10, 2026 6/10
skill Reddit
I’m not a developer, but 30 years in IT, mostly infrastructure. I’m creating a website with Claude Code. Started in Claude Designer about a month ago. Iterated through a bunch of mockups and landed...
skillreview
by CincyTriGuy Jul 10, 2026 8/10
skill GitHub
Declarative coordination for agent skills — multi-platform, deny-by-default, local-first. One manifest. One command. Only what you declared.
skillcommand
by lythos-labs Jul 10, 2026 6/10
skill GitHub
Agent skills for hotel search & OTA price comparison (Agoda · Booking · Google Hotels · OpenTravel) — SKILL.md for OpenClaw, Hermes, Claude Code.
skill
by Price-Win Jul 10, 2026 9/10
skill GitHub
Portable AI agent skills built on the open SKILL.md standard — self-contained capabilities any compatible agent can discover and load on demand, usable across Claude, Codex, Gemini CLI, Cursor, an...
skillgit
by Hefrock Jul 10, 2026 7/10
skill GitHub
从《矛盾论》《实践论》完整推理结构蒸馏的中文产品决策 Agent Skill,支持 Codex、Claude Code、Cursor
skill
by atdy Jul 10, 2026 9/10
skill GitHub
Build AI-friendly web interfaces with semantic HTML, ARIA, stable locators, and form best practices for better automation and accessibility
skillautomation
by avilaok8647 Jul 10, 2026 5/10
skill GitHub
Hall of Mirrors — free Claude Skill. See how VC, angels, government, grants, accelerators & corporates each read the same startup differently.
skill
by aussieOS Jul 10, 2026 6/10
skill GitHub
Agent skills for improve AI prototype driven development
skill
by YasuakiOmokawa Jul 10, 2026 6/10
skill GitHub
Local Obsidian-backed dashboard for GitHub projects and AI agent skills
skillgit
by lu969181-boop Jul 10, 2026 6/10
skill GitHub
An incisive, source-available brand-distillation skill for Claude, Codex & any SKILL.md tool. Finds the kernel hiding in your product's name, then builds a full brand kit to hand to the coding agen...
skill
by DTM-repo Jul 10, 2026 7/10
skill GitHub
iOS Agent Skills 2026: Test 11 Tasks, 260+ Scenarios, 850+ Assertions on 3 Models
skill
by onlymuneeb38-glitch Jul 10, 2026 6/10
skill GitHub
🔥 Brutal code roasts where every insult comes with a fix — a Claude Code skill for merciless code review
skillreview
by kpab Jul 10, 2026 8/10
skill Reddit
I've been mainly using Claude Code over telegram with their plugin. Over time I realized how much more autonomy I want with Claude Code, or any other harness. I want it to review my pre automatical...
skillautomationreview
by sapoepsilon Jul 10, 2026 9/10
skill GitHub
Multi-tool AI agent harness — 22 skills, self-evolving engine, unified memory, autonomous spec-to-PR pipeline. Works with Claude Code, Codex, Cursor, OpenCode, and Cline.
skill
by epicsagas Jul 10, 2026 9/10
skill GitHub
A curated list of fun, entertaining, and joke Claude Code skills — personas, humor, games, and desktop pets.
skill
by kpab Jul 10, 2026 8/10
skill GitHub
Find literature, trace citations, discover authors, institutions, and fields with a human-friendly OpenAlex CLI and skill for fast research lookup
skill
by Out-bloodspavin173 Jul 10, 2026 5/10
skill GitHub
AI design-critique skill that teaches measurable craft and evaluates taste in context
skill
by Thecsiz Jul 10, 2026 5/10
skill GitHub
SKILL.md to rent and run experiments on VastAI's GPU just like how Modal works
skill
by Yusuke710 Jul 10, 2026 5/10
skill GitHub
My Claude Skills
skill
by Srltas Jul 10, 2026 6/10
skill GitHub
reverse-engineering-skill-github-copilot:
skillgit
by sarveshtalele Jul 10, 2026 5/10
skill GitHub
Marketplace of plugins and skills for Claude Code
skill
by RadOrigin-LLC Jul 10, 2026 8/10
skill GitHub
Reusable AI-agent skills maintained by quiet-build. Install: npx skills@latest add quiet-build/skills
skill
by quiet-build Jul 10, 2026 6/10
skill GitHub
把品牌影响力拆成可打分、可比较、可复盘的事。Claude Code skill,5 位人物评委(傅盛·Steve Jobs·李可佳·吴俊东·张一鸣)按 7 维度 × 5 镜头独立打分,Lead 合成版本化报告:雷达图 + 异议热力图 + 影响力构造图 + 90 天行动建议。`/mba <brand>` 一行触发,EVOLUTION 模式追踪同一品牌随时间演化。
skill
by zhanglunet Jul 10, 2026 8/10
skill GitHub
Semantic agent skills for cloud operations — open SKILL.md packages for Claude Code, Cursor, Codex CLI. Includes huawei-cloud-billing-scout (read-only BSS/KooCLI billing).
skill
by ontology-of-everything Jul 10, 2026 9/10
skill GitHub
The financial-analysis skill collection for AI agents: sentiment, smart money, filings, and an adversarial investment committee, on one API key.
skillapi
by SentiSenseApp Jul 10, 2026 6/10
skill GitHub
First-line defensive security skills for Claude Code and compatible AI coding agents.
skill
by TanKimGwan Jul 10, 2026 9/10
skill GitHub
Marketplace privado de 17 plugins (skills, hooks e automações) pessoais para Claude Code.
skillhook
by pedroberaldo87 Jul 10, 2026 10/10
skill GitHub
Best static AI text humanizer. Two research-grounded skills that work in any LLM (Claude, ChatGPT, Gemini, Codex): humanize beats perplexity-based detectors, ai-check produces forensic scoring with...
skillreview
by harshaneel Jul 10, 2026 6/10
skill GitHub
Public, machine-agnostic Claude Code skills: project-init, handoff, and drift-check
skill
by ngreenwall Jul 10, 2026 8/10
skill GitHub
Analyst workflows as Claude skills. 26+ tools and 8 workflows spanning earnings, comps, valuation, options flow, factor research, sizing, risk, TCA, and ops. Built in the garage, not the trading...
skillworkflow
by rgourley Jul 10, 2026 6/10
skill GitHub
An automated AI research-paper writer based off Google's PaperOrchestra paper's implementation through a skills - benchmark + autoraters using any coding agent (Claude Code, Cursor, Antigravity, C...
skillapi
by Ar9av Jul 10, 2026 9/10
skill GitHub
Curated agent skills that do one thing well. Plain Markdown, trigger-activated, model-agnostic. Fork what you need, drop the rest
skill
by TheAkshitS Jul 10, 2026 6/10
skill GitHub
Audit-grade methodology for AI-native development. Skills, commands, lenses, and rules that turn AI sessions into versioned, auditable artifacts — with a deterministic floor that holds even when no...
skillcommand
by pharn-dev Jul 10, 2026 8/10
skill GitHub
Claude agent skill: converts CV/resume prose into executive-register wording — deterministic checks + a scored convergence loop. The right words at the right size.
skill
by slovozaslovo Jul 10, 2026 7/10
skill GitHub
AI Skill Finder 2026: Automated Search & Install for Claude Code
skill
by lobisomenhomemafeminado Jul 10, 2026 8/10
skill GitHub
An advisory board of real, well-documented experts you choose. Quorum audits your launched business and returns a prioritized backlog, roadmap, and prioritization framework. Works in Claude Code, C...
skill
by davidbrown1775 Jul 10, 2026 8/10
skill GitHub
A set of Claude Code skills targeting VB.NET WinForms modernization to .NET 9 in 2026. Provides guided assistance for migration tasks specific to legacy Windows desktop applications. Useful for teams maintaining older VB.NET codebases who want AI-assisted upgrade paths.
skillvb.netwinformsdotnetmigrationlegacy
by yngbrll Jul 9, 2026 5/10
skill GitHub
A curated registry of Claude Code extensions — skills, subagents, slash commands, and hooks — covering engineering, git, testing, and security workflows. Distributed both as a shadcn-style GitHub registry and as installable plugins, making it easy to browse and add individual extensions to any project. A well-organized starting point for building out a Claude Code toolkit.
skillssubagentsslash-commandshooksregistryextensionsgittestingsecurity
by KhaledSaeed18 Jul 9, 2026 8/10
skill GitHub
🎭 Persona — role-based operating modes for Claude. Hire an expert, not a tool: each persona is a mindset, a method, a quality bar, and the skills to deliver.
skill
by palusc Jul 9, 2026 6/10
skill GitHub
純原生(零依賴)網頁卡牌遊戲的 Claude Code Skill:關鍵字技能對戰、開卡包、星級閃卡、主題切換,整合 Grok/GPT 生成卡牌美術。
skill
by mars-tw Jul 9, 2026 8/10
skill GitHub
AlterLab FC 2026 AI Playbook 🚀 Ultimate Skills & Strategy Guide
skill
by mohamoudj6-del Jul 9, 2026 6/10
skill GitHub
29 free Claude Skills for SEO and AI search. Built by Hawk Academy + StudioHawk. Drop into Claude Desktop and run.
skill
by lhitches Jul 9, 2026 6/10
skill GitHub
Spec-driven AI agent skill generator and verification pipeline for building, testing, repairing, and packaging production-ready agent skills.
skilltesting
by HelloThisWorld Jul 9, 2026 6/10
skill Reddit
I’ve seen a lot of people sharing different Claude Code setups on X, especially around CLAUDE.md files, context files, hooks, agents, and skills. My current setup is pretty simple: I keep CLAUDE.md...
skillhookworkflowclaude.md
by SevereNecessary8381 Jul 9, 2026 10/10
skill GitHub
Production-grade Claude Code skills for Adobe Firefly Services — credentials, generation (V3 async), custom models, expand/fill, video, Photoshop API, Lightroom API. Built by FocusGTS from real ent...
skillapi
by Focus-GTS Jul 9, 2026 8/10
skill GitHub
Claude Code skill: turn clinical-journal PDFs into a token-efficient Markdown wiki + evidence table (study design, DOI, sample size, data source) for literature review.
skillreview
by rlarson94170 Jul 9, 2026 8/10
skill GitHub
Production-oriented template for building AI agent skills as verifiable software components — offline eval harness, source-grounding validators, structured logs/traces/metrics, replay artifacts, an...
skill
by HelloThisWorld Jul 9, 2026 6/10
skill Reddit
Most of what I use Claude Code for isn't coding. It's proposals, SOWs, client documents, research, and writing. It handles the work well, and I'm curious how many of you are doing the same, and wha...
skillcommandreview
by coolreddy Jul 9, 2026 8/10
skill Reddit
idk if anyone else suffers this, but sometimes i just want to go for the most minimal change and LoC added to solve a problem, especially at work where i don't want to slam team leads with huge PRs...
skillgit
by agarunov Jul 9, 2026 6/10
skill GitHub
Generate Google Forms from docs, text, or a topic with AI and Google Forms API support
skillapi
by capitalisationhumulin242 Jul 9, 2026 5/10
skill GitHub
Audit iOS and Android app listings with Claude ASO skill packs, score ASO health, and get prioritized fixes for better visibility
skill
by elladineluxemburger97 Jul 9, 2026 6/10
skill GitHub
Build AI agent skills with dialectical methods and practical tools from classical materialist philosophy for clearer judgment and action
skill
by SanjithBolloju18 Jul 9, 2026 6/10
skill GitHub
Build, standardize, and validate reusable AI skills across models with a portable abstraction layer
skill
by Pascalslawoffluidpressuresjalousie29 Jul 9, 2026 5/10
skill GitHub
⚠️ Experimentelle Skill-Sammlung für deutsches Recht (Arbeits-, Gesellschafts-, Insolvenz-, Datenschutz-, Prozessrecht u.a.) – inzwischen verbessert und im Alltag getestet, aber weiterhin Experimen...
skill
by Klotzkette Jul 9, 2026 6/10
skill GitHub
Clip any video into a narration recap with claude code skill|用claude code skill把任何视频剪辑成中文解说视频,支持剪映导出
skill
by worldwonderer Jul 9, 2026 8/10
skill GitHub
The open source operating system for design teams running on AI — three gates, gate-enforcing Claude skills, a work ledger, and a conductor. Installable as a Claude Code plugin.
skill
by royvergara Jul 9, 2026 8/10
skill GitHub
Three open-source AI marketing plugins for agencies & in-house teams — DigitalMarketingPro (158 skills) + ContentForge (21) + SocialForge (16). Cowork team-persistent, EU AI Act Article 50 ready, M...
skillgit
by indranilbanerjee Jul 9, 2026 9/10
skill Reddit
submitted by /u/No_Skill_8393 [link] [comments]
skill
by No_Skill_8393 Jul 9, 2026 6/10
skill GitHub
Top Swift SQLiteData Alternatives 2026 – Best GRDB Skills Kit
skill
by anukulgosavi1-coder Jul 9, 2026 5/10
skill GitHub
Turn a one-line idea into a production-grade, copy-paste-ready AI image prompt for posters, landing and UI mockups, ads, game art, and logos. A Claude Code skill optimized for gpt-image-2. MIT.
skill
by veryCoolTimo Jul 9, 2026 8/10
skill GitHub
Claude Code plugin marketplace — install skills individually (one skill per plugin). External skills are referenced upstream via git-subdir and auto-updated by Renovate.
skillgit
by filippolmt Jul 9, 2026 8/10
skill GitHub
Workflow skills for AI coding agents: plan, execute, and maintain a persistent knowledge base across sessions.
skillworkflow
by scchearn Jul 9, 2026 6/10
skill GitHub
A portable, agent-agnostic engineering methodology for AI coding agents — AGENTS.md + skills + per-agent adapters, with deterministic git controls.
skillgit
by pedro-angel Jul 9, 2026 6/10
skill GitHub
个人 Claude Code Skill 集合:企业背调、文章溯源、日报/工作小结、会议纪要重生成、图片改色、devflow 等可复用工作流。
skill
by Jim4546 Jul 9, 2026 8/10
skill GitHub
SPEC-First Agentic Development Kit for Claude Code — 24 AI agents + 52 skills with TDD/DDD quality gates, 16-language projects, 4-language docs. Go CLI, zero deps.
skill
by modu-ai Jul 9, 2026 9/10
skill GitHub
ai-skills:
skill
by rjvim Jul 9, 2026 5/10
skill GitHub
Claude Code skill for building, flashing, and debugging ESP32 .ino sketches with arduino-cli
skill
by doeslater Jul 9, 2026 8/10
skill GitHub
🚀 WebGPU Agent Skill 2026: Build GPU Apps with Easel.js & AI Coding Agents
skill
by AllyJuma1 Jul 9, 2026 6/10
skill GitHub
Review plans, docs, and code with adversarial critique that finds flaws, gaps, and risks before you ship
skillreview
by Dtgam7689 Jul 9, 2026 6/10
skill GitHub
Environment-adaptive orchestration skill for AI agents.
skill
by Tire-C Jul 9, 2026 6/10
skill GitHub
Explore 72 AI-powered skills across 6 departments for AlterLab FC training, learning, and workflow support
skillworkflow
by prone-dc302 Jul 9, 2026 5/10
skill GitHub
Build Claude Code skills for computational design, parametric modeling, simulation, BIM scripting, and fabrication in AEC
skill
by marcinfinitesimal533 Jul 9, 2026 8/10
skill GitHub
Install 154+ Claude Code skills for SEO, code review, marketing, and AI agent tasks with one command
skillcommandreview
by eastindian-wallpepper214 Jul 9, 2026 9/10
skill GitHub
Claude Code skills for PDF fidelity, HTML/CSS auditing, and agent memory hygiene
skill
by LeonanUCM Jul 9, 2026 9/10
skill Reddit
Hi guys, i want to share a small non-tech oriented project of mine, build in a couple of days. So I love games, and I love to theory craft or 'improve' on existing games, but I always wondered if m...
skillpython
by baddoge9000 Jul 9, 2026 8/10
skill GitHub
A practical collection of agentic practices and workflows, including reusable skills, commands, reference notes, and base knowledge documents.
skillcommandworkflow
by AgenticPW Jul 9, 2026 6/10
skill GitHub
[MIRROR] My personal AI skills
skill
by papanito Jul 9, 2026 5/10
skill GitHub
基于微信读书官方 Agent Skill 的二创项目精选 · Curated projects built on WeRead's official Agent Skill (released 2026-05-17)
skill
by BENZEMA216 Jul 9, 2026 6/10
skill GitHub
Business registry data skills for AI agents - KYC/AML, credit risk, property, compliance, lead gen across 24 actors (Europe, US, UAE)
skill
by Nolpak14 Jul 9, 2026 6/10
skill GitHub
Open-source thinking-framework skills that make rigorous reasoning executable for AI agents — first-principles, inversion, second-order thinking, Occam's razor, Bayesian reasoning. Built by deciqAI.
skill
by deciqAI Jul 9, 2026 6/10
skill GitHub
The Fable Workflow: how Claude Fable 5 worked, distilled into skills any model can run, with the eval that keeps it honest. Think / act / prove.
skillworkflow
by Sahir619 Jul 9, 2026 6/10
skill GitHub
SecureVibe — prevention-first security for AI-written code. Signed SKILL.md knowledge that makes AI coding assistants write secure code at generation time, plus a deterministic CI gate. Offline · k...
skill
by ShieldNet-360 Jul 9, 2026 5/10
skill Reddit
So the thing is I work on a team of 3-4 devs, and whenever someone's AI agent screwed something up, they'd have to just... tell the rest of us. Manually. In slack or discord. That's the entire syst...
skillgitreview
by Calm_Sandwich069 Jul 9, 2026 9/10
skill GitHub
Automate skill acquisition and task execution using a modular Python framework compatible with Claude Code, OpenClaw, and Codex.
skillpython
by employeesavingsplanmelagra893 Jul 9, 2026 8/10
skill Reddit
There are a lot of posts on X and LinkedIn promising that you should update your Claude.md files and skills with Fable 5, and that you could use "cheaper models" (I guess they mean Opus) to get nea...
skillclaude.md
by zakjaquejeobaum Jul 9, 2026 8/10
skill GitHub
CLI + agent-skill toolkit for capturing posts, articles, media, and OCR into portable local bundles.
skill
by OctopusGarage Jul 9, 2026 6/10
skill GitHub
Best Free AI Code Review Agents 2026 – 190+ Skills & Plugins for Claude
skillreview
by nirmal77-nir Jul 9, 2026 7/10
skill GitHub
A portable Claude Code skill that transfers Fable's operating discipline across models: the Frame → Plan → Act → Verify → Report → Finish loop, reasoning moves, state-change safety, and a five-ques...
skill
by huguryildiz Jul 9, 2026 8/10
skill GitHub
Curated, auto-updated awesome-list of vetted AI agent skills with quality ratings for Claude, GPT, a
skill
by linny006 Jul 9, 2026 7/10
skill GitHub
Open Claude Code skills for building SaaS products — first up: gemini-visuals, a Gemini visual-review loop for on-brand landing visuals.
skillreview
by Rank-First Jul 9, 2026 8/10
skill GitHub
Versionierte Heimat meiner Agent Skills für Claude (claude.ai, Claude Code, API).
skillapi
by wemwi Jul 9, 2026 9/10
skill GitHub
SamDin สามดิน ThreeJS modelling tool w/ claude skill
skill
by mbarlow Jul 9, 2026 6/10
skill GitHub
A Claude Code skill that turns one idea into a finished, on-brand film — from chat. Two modes (edit footage / full-AI), an intake gate, and a premium quality bar.
skill
by RichardTheuws Jul 9, 2026 8/10
skill GitHub
Stack-agnostic agentic-programming workflow skills + documentation scaffold
skillworkflow
by gtrabanco Jul 9, 2026 6/10
skill GitHub
🛠️ My macOS dotfiles managed with GNU Stow — incl. Claude Code config & skills
skillconfig
by zeikar Jul 9, 2026 9/10
skill GitHub
레트로 게임 한글 패치 제작 전 파이프라인 에이전트 스킬 · Agent skill for end-to-end Korean (Hangul) fan-translation patches for retro games
skill
by mcpads Jul 9, 2026 6/10
skill GitHub
Agent skills for U.S. property data via Zillapi.com. MIT-0.
skillapi
by ZeroPointRepo Jul 9, 2026 6/10
skill GitHub
Production-ready Claude Code skills, agents, and project templates for Craft CMS 5 development
skill
by michtio Jul 9, 2026 9/10
skill GitHub
Multi-platform Chinese TTS skill — Edge / Doubao / CosyVoice / Azure / Tencent / Baidu / MiniMax / Xunfei. All backends work in China.
skill
by Agents365-ai Jul 9, 2026 5/10
skill GitHub
A documentation library for governance, risk, compliance, cybersecurity, privacy, resilience, AI assurance, and operational control practices + a Claude Code rules-and-skills pack distilled from ma...
skill
by jposluns Jul 9, 2026 8/10
skill GitHub
Structured skills for reading, writing, and managing academic research with AI agents. Works with Claude Code, Codex CLI, Gemini CLI, Cursor, and more.
skill
by yha9806 Jul 9, 2026 9/10
skill GitHub
Generate tailored LaTeX résumés from structured experience data with Claude Code Skills
skill
by isolationistmuttontallow763 Jul 9, 2026 8/10
skill GitHub
Build focused research for Claude Code with one skill, three reference packs, and a clear workflow for mapping, judging, and synthesizing sources
skillworkflow
by droftgamer-wq Jul 9, 2026 8/10
skill GitHub
Automate code reviews for general code projects with modular parallel checks, config-driven scope, and clear reports.
skillconfigreview
by w4xqz Jul 9, 2026 6/10
skill GitHub
Teach AI assistants to generate correct Unity and Jahro debugging code, with skills for commands, watchers, snapshots, logs, config, and fixes
skillcommandconfig
by Logiiiii Jul 9, 2026 7/10
skill GitHub
Agent Skills for medical research — literature search, reporting-guideline & citation checks, statistics, publication figures, submission. Works with Claude Code, Codex, Cursor & GitHub Copilot. Bu...
skillgit
by Aperivue Jul 9, 2026 9/10
skill GitHub
72 agent skills synthesizing 17 years of software engineering discipline into a prescriptive methodology for solo developers
skill
by danielvm-git Jul 9, 2026 6/10
skill GitHub
Turn Claude Code into a long-term collaborator on PostgreSQL internals — cited knowledge corpus, agent skills, slash commands, and task-shaped scenarios for backend hacking.
skillcommand
by matejformanek Jul 9, 2026 9/10
skill GitHub
15 Claude Code PM Skills 2026 - Generate DOCX XLSX PPTX Artifacts Instantly
skill
by JBSag Jul 9, 2026 8/10
skill GitHub
An Agent Skill of Modellix documentation and capabilities reference.
skill
by Modellix Jul 9, 2026 6/10
skill GitHub
A framework-agnostic Roblox/Luau coding standards and best practices skill for AI coding agents. Includes a universal installer supporting Claude Code, Cursor, Windsurf, Antigravity, OpenCode, and ...
skill
by andrian-syh Jul 9, 2026 9/10
skill GitHub
Make your coding agent actually finish the job. Install one skill and Claude Code keeps working — planning, fixing, testing, deploying — until your goal is objectively true (tests pass, endpoint li...
skilltesting
by kazi-org Jul 9, 2026 9/10
skill GitHub
agent-skills,Expert code review skill: SOLID, security, performance, error handling, boundary conditions
skillreview
by yugef3h Jul 9, 2026 6/10
skill GitHub
A Claude Code plugin marketplace for open-source maintainers — README heroes, README audits, and .NET test-coverage backfills.
skill
by livlign Jul 9, 2026 8/10
skill GitHub
每天更新的开源 Agent Skills 中文发现站、分类索引与 GitHub 榜单
skillgit
by savanna0425 Jul 9, 2026 6/10
skill GitHub
Turn Claude into an MBB-grade management consultant. Case-interview coaching, strategy frameworks, market sizing, and board-ready problem-solving. 129 reference modules distilled from consulting kn...
skill
by DogInfantry Jul 9, 2026 6/10
skill GitHub
bro-skills - Spec-Driven Development CLI
skill
by wedabro Jul 9, 2026 5/10
skill GitHub
Open-source, AI-agnostic skills for the legal teams.
skill
by zgbrenner Jul 9, 2026 6/10
skill GitHub
bridge.ai/anchor: skills for consistent and effective source control
skill
by chris-peterson Jul 9, 2026 5/10
skill GitHub
Symfony UX Skills Bundle 2026 - Master Live & Twig Components, Turbo, Stimulus
skill
by ashfaquecg806-dot Jul 9, 2026 5/10
skill GitHub
AI Agent Team scaffold for Claude Code — 19 roles collaborate through stage gates, enforced by mandatory skills + blocking hooks + DoD checklists. Spec-driven change folders, SIT-audited code revie...
skillhookreview
by pcliangx Jul 9, 2026 10/10
skill Reddit
submitted by /u/michael_phelps81 [link] [comments]
skill
by michael_phelps81 Jul 9, 2026 8/10
skill GitHub
Generate ComfyUI workflow JSON from natural language, with no API cost or backend, so you can import and run workflows fast
skillworkflowapi
by henriqueironed385 Jul 9, 2026 5/10
skill GitHub
一个包含agent和skill的集合:RAG、技能审查、周报生成、项目管理、质量监控...及技术方案/内部设计文档
skill
by Ldxs001 Jul 9, 2026 6/10
skill GitHub
Audit web apps and AI-generated code for common security flaws with a Claude Code skill focused on OWASP issues and hardening risks
skill
by Pold911 Jul 9, 2026 8/10
skill GitHub
Stop formatting, start vibing. 8 AI-native A4 resume templates — tell your AI assistant what you want, get print-ready PDF.
skill
by KevinYoung-Kw Jul 9, 2026 5/10
skill GitHub
Build production patterns for AI coding agents from Claude Code source analysis and harness engineering practice.
skill
by dinho-afsn Jul 9, 2026 9/10
skill GitHub
A modular PMO & release-management platform for Claude Code: skills, governance disciplines, and a 13-stage release pipeline.
skill
by cody-hutson Jul 9, 2026 8/10
skill GitHub
Agent-native ML research repo template for AI PhD workflows with Claude Code: repo-as-control-plane, repo-local subagents/skills/hooks, anti-drift ANATOMY + runnable governance validators.
skillhookworkflow
by a-green-hand-jack Jul 9, 2026 10/10
skill GitHub
Open-source Claude Code skills for SEO, GEO, Google Ads, Meta Ads
skill
by nowork-studio Jul 9, 2026 8/10
skill GitHub
Workflow and operator skills for Claude Code — model routing, strategic next-move, convergent adversarial patterns
skillworkflow
by lee-fuhr Jul 9, 2026 8/10
skill GitHub
Master Vibe Coder Workflows 2026: Build, Author & Automate with Claude AI
skillworkflow
by marcoalfa30 Jul 9, 2026 6/10
skill GitHub
Claude Code 스킬·룰·훅 프리셋 설치 관리 + 대화에서 배우는 자가진화 러닝 루프(롤링 요약·드리밍·결정화) | Preset-based setup manager for Claude Code skills/rules/hooks + a self-evolving learning loop (rolling summary, dreaming, skill c...
skillhook
by jjackkun Jul 9, 2026 10/10
skill GitHub
Salesforce ISV & Partner Skills Catalog 2026 – Reusable Deployment Kit
skill
by ENTEROPNON Jul 9, 2026 5/10
skill GitHub
Simplify software decisions by applying a skill that favors local, clear solutions before adding complexity or layers.
skill
by Culinary-psocidae495 Jul 9, 2026 5/10
skill GitHub
Scan and diagnose coding agent skills to find errors and improve quality with a clear scoring system and actionable feedback.
skill
by thunderheadtichodrome786 Jul 9, 2026 6/10
skill GitHub
Build and evolve AI agent skills continuously to enhance intelligence and adaptability in complex tasks.
skill
by mriazi1982 Jul 9, 2026 6/10
skill GitHub
Connect NotebookLM research with Claude to generate structured content from URLs, PDFs, and trending topics for multi-platform publishing.
skill
by jakubs2623 Jul 9, 2026 6/10
skill GitHub
Provide accurate Jetpack Compose code by detecting common errors and improving Android UI practices with a modern agent skill compatible across platforms.
skill
by Pushpade7366 Jul 9, 2026 6/10
skill GitHub
Provide and maintain a community-driven collection of standardized Agent Skills for Claude AI using the SKILL.md format
skill
by Marine-softdrink524 Jul 9, 2026 7/10
skill GitHub
Generate production-ready AI agent skills through a verified 7-step process with automated auditing, optimization, and packaging in a full web app.
skill
by kographh Jul 9, 2026 6/10
skill GitHub
Enforce architecture standards and maintainer workflows for AI coding agents to prevent code duplication, verify changes, and control project dependencies.
skillworkflow
by Wyattputrescent882 Jul 9, 2026 6/10
skill GitHub
Skills that design the work: a growing toolkit of disciplined, harness-agnostic processes for coding agents.
skill
by ribbons-digital Jul 9, 2026 6/10
skill GitHub
JSONのマス目指定だけで AWS/Azure/GCP 構成図・ER図・UMLクラス図・フローチャートを draw.io 形式で自動生成する Agent Skill。交差最少の自動配線+機械検証つき。Python 標準ライブラリのみ
skillpython
by k0tter Jul 9, 2026 6/10
skill GitHub
FoJin-powered Buddhist AI persona framework — source-grounded, boundary-aware, fidelity-tested, runtime-ready.
skill
by xr843 Jul 9, 2026 5/10
skill GitHub
🚀 Master Claude Code Skills 2026: AI-Powered PR Reviews & Security Audits
skillreview
by Frun1753 Jul 9, 2026 10/10
skill GitHub
A modular marketplace of custom Claude Code skills, plugins, hooks, and AI workflow extensions built for reusable agentic developer workflows.
skillhookworkflow
by jzills Jul 9, 2026 10/10
skill GitHub
Index Any Local Documentation as AI Skill – Claude Code Knowledge 2026
skill
by camilemuz Jul 9, 2026 8/10
skill GitHub
Auto-updated leaderboard of trending claude-skills and AI agent repos, refreshed every 15 minutes
skill
by linny006 Jul 9, 2026 7/10
skill GitHub
一款 LOOP 自动化筛选简历的 SKILL,基于猎聘 CLI。AI 根据你的判断和评价,半小时助你从 1000 份简历中找到最对口的那一个。
skill
by dizhouid-lgtm Jul 9, 2026 5/10
skill GitHub
Portable SKILLs workspace for Claude Code, Codex, and Gemini — issue-driven workflows and cross-agent collaboration via bridge scripts with session continuity.
skillworkflow
by appautomaton Jul 9, 2026 9/10
skill GitHub
A Claude Code skill: turns vague, open-ended technical requests into a research-first, plan-review-implement-verify workflow.
skillworkflowreview
by Octo-o-o-o Jul 9, 2026 8/10
skill GitHub
Claude Code skill: Chinese video model generation via Alibaba Cloud Bailian — Wan/PixVerse/Kling/Vidu/HappyHorse, t2v/i2v/kf2v/r2v
skill
by Agents365-ai Jul 9, 2026 8/10
skill GitHub
Multi-platform Chinese OCR skill — PaddleOCR/Baidu/Tencent/Alibaba/EasyOCR, all work in China
skill
by Agents365-ai Jul 9, 2026 5/10
skill GitHub
Capability-secure WASM plugin sandbox (F# host + Rust plugins) with an AI code-review skill: plugins get only the authority their policy grants
skillreview
by wuisabel-gif Jul 9, 2026 5/10
skill GitHub
Agent Skills by mr-kelly
skill
by mr-kelly Jul 9, 2026 6/10
skill GitHub
claude-skill skills
skill
by publisher-skill Jul 9, 2026 6/10
skill GitHub
Skills para o Claude Code: auditoria, testes, documentação e checagem pré-deploy direto no terminal.
skill
by Dom1ng0s Jul 9, 2026 8/10
skill GitHub
A library of 10 battle-tested custom skills for Claude Code — audit engines, build pipelines, deliberation systems, and quality loops
skill
by jrbobbyhansen-pixel Jul 9, 2026 10/10
skill Reddit
submitted by /u/squerne [link] [comments]
skillreview
by squerne Jul 9, 2026 9/10
skill Reddit
I use Claude code regularly in my job. I’m a software engineer, but it’s really good out of the box and I’m wondering what people are using hooks for or is there any other customisations I should d...
skillhookworkflow
by Ovisty Jul 9, 2026 10/10
skill GitHub
Expert Ruby Rails RSpec Skill Files 2026 for AI Coding Agents - Best GitHub About
skillgit
by shridhar-mca24 Jul 9, 2026 6/10
skill GitHub
Best Free Salesforce Developer Suite 2026 - 55 Skills & 29 Hooks for Apex, LWC, SOQL
skillhook
by fambt Jul 9, 2026 7/10
skill GitHub
Writing code might be dead. Understanding it is not. - An AI skill for surgical planning
skill
by Banyango Jul 9, 2026 5/10
skill GitHub
Claude Code skill for Fable 5 and Codex routing
skill
by nyldn Jul 9, 2026 8/10
skill GitHub
A comprehensive SWE workflow, encoded. Might be useful to you too.
skillworkflow
by SWEStash Jul 9, 2026 5/10
skill GitHub
한국 법무 실무를 위한 Claude Code skill — 법령·판례 조사, 계약서 검토, 컴플라이언스. Korean legal research skill for Claude Code (statute, case law, contract review, compliance).
skillreview
by sungjunlee Jul 9, 2026 8/10
skill GitHub
🦾 Skills for Requiems API
skillapi
by bobadilla-tech Jul 9, 2026 5/10
skill GitHub
Reverse-engineered specification of FileMaker's undocumented layout XML format (fmxmlsnippet LayoutObjectList). All 18 object types covered, flags decoded, element order confirmed, verified against...
skill
by andykear Jul 9, 2026 6/10
skill GitHub
每日 AI 大厂动态卡片:抓取 Anthropic 等官方动态→中文策展→小红书/公众号卡片→GitHub Pages 审核页。内含可安装 Agent Skill ai-daily-digest。
skillgit
by yinjialu Jul 9, 2026 7/10
skill GitHub
Best AI Agent Skill Finder 2026 – Multi-Registry Install & Security Labels
skill
by Edward0l1 Jul 9, 2026 6/10
skill Reddit
Context accuracy — not capacity — is the real failure mode in long-lived AI coding projects. This open-source framework defines artifact ownership, marks docs as active vs historical, and routes tasks through explicit stages to prevent the agent acting on the wrong document. Reduces debug loops and keeps design docs aligned with implementation.
context-managementCLAUDE.mdarchitectureworkflow
by feather812002finland Jul 8, 2026 6/10
skill Reddit
Three skills that hook into Claude Code to automatically generate narrative work summaries on /compact, /clear, or session end. Builds a daily worklog from transcripts for standups, weekly updates, and session analysis — capturing what was decided and why, not just what files changed.
skillssession-memoryworkloghooks
by shaun_the_mehh Jul 8, 2026 7/10
skill GitHub
A safe-by-default CLI that generates and updates AGENTS.md and RUNBOOK.md for AI coding agents. Uses marker-based patches and a diff-first workflow so updates are reviewable before applying, with conservative repo auto-detection.
AGENTS.mdCLIworkflowsetup
by markoblogo Jul 8, 2026 6/10
skill GitHub
A Claude Code skill that audits and optimizes ecommerce pages using research-backed conversion psychology principles. Provides structured analysis and recommendations based on CRO best practices.
ecommerceCROskilloptimization
by Dannytownkins Jul 8, 2026 5/10
skill GitHub
A Claude Code skill implementing ReAct-style deep search that follows leads between rounds rather than doing broad parallel searches. Each search round builds on findings from the previous one for deeper, more targeted research.
researchskillReActsearch
by recomby-ai Jul 8, 2026 6/10
skill GitHub
A curated collection of 204+ Claude Code skills organized by development phase: Plan, Build, Test, Ship. Bilingual Chinese/English. Provides a comprehensive library covering the full development lifecycle.
skillscuratedworkflowbilingual
by xcodethink Jul 8, 2026 6/10
skill GitHub
A Claude Code plugin providing skills for Apple's text rendering stack: TextKit, UITextView, NSTextView, attributed strings, Writing Tools, and related APIs. Useful for iOS/macOS developers working on text-heavy features.
AppleiOSmacOSTextKitskill
by sitapix Jul 8, 2026 5/10
skill GitHub
Zero-dependency cross-agent memory that stitches context across Claude Code, Cursor, Codex, Gemini CLI, Windsurf, and more. Preserves decisions, failed experiments, and warnings across sessions using BM25 relevance search and MCP + instruction files.
memorycross-toolBM25MCP
by raghavvbiyani Jul 8, 2026 7/10
skill GitHub
A personal collection of battle-tested best practices, favorite skills, plugins, tools, and MCP servers for Claude Code. Well-organized reference for practitioners looking to level up their workflow.
best-practicesskillsMCPsreference
by lawwu Jul 8, 2026 6/10
skill GitHub
A curated collection of 20 CLAUDE.md templates covering best practices for Claude Code project configuration. Bilingual Chinese/English, providing concrete starting points for different project types and team setups.
CLAUDE.mdtemplatesbest-practicesconfiguration
by jnMetaCode Jul 8, 2026 7/10
skill GitHub
A Claude Code skill pack for content creation with 8 skills, persistent memory, skill chaining, and a built-in AI slop detector that flags generic AI-sounding output. Designed for writers and marketers who need human-feeling results.
contentskillswritingslop-detection
by quionie Jul 8, 2026 5/10
skill GitHub
A Claude Code configuration acting as a SAP consultant's AI operating system with enforced workflows, checklists, and hard gates. Covers SAP debugging, estimation, and go-live readiness checks.
SAPworkflowchecklistsenterprise
by vigneshbarani24 Jul 8, 2026 5/10
skill GitHub
A progressive-disclosure SKILL.md for production-grade ROS 2 development covering workspace setup, nodes, executors, QoS, ros2_control, Nav2, MoveIt 2, real-time, and deployment. Compatible with Claude Code, Codex, Cursor, and Gemini CLI.
ROS2roboticsskillembedded
by dbwls99706 Jul 8, 2026 5/10
skill Reddit
A tool that ingests documentation, videos, and transcripts and outputs agent-ready SKILL.md files — not summaries, but actual skills with invocation logic, example queries, edge cases, and 'when NOT to use' guidance extracted from the source material.
skillsskill-generationdocumentationSKILL.md
by canary-black Jul 8, 2026 7/10
skill GitHub
A Claude Code skill for diagnosing OS-level issues on Linux servers: memory, CPU, disk, network, kernel tuning, resource limits, DNS, time sync, filesystem integrity, browser deps, and locale. One command for comprehensive server health analysis.
LinuxDevOpsdiagnosticsskill
by zjxylc Jul 8, 2026 6/10
skill Reddit
A skill that runs a full text adventure RPG engine inside Claude Desktop — no server needed. Supports d20, D&D 5e, GURPS Lite, Pathfinder 2e, and Shadowrun 5e with styled scenes, interactive buttons, stat panels, maps, shops, combat, and 3D dice rendered in Claude's widget system.
gamesskillRPGClaude Desktop
by gazmagik Jul 8, 2026 6/10
skill GitHub
A Claude Code skill and web UI for structured worldbuilding — novels, D&D campaigns, game worlds. Runs locally, generates illustrated characters and chapter outlines, and maintains consistency across a universe through file-based structured data.
writingworldbuildingskillcreative
by gofastercloud Jul 8, 2026 5/10
skill GitHub
A CLI tool that syncs skill files across multiple AI coding tools with one command and simplifies team sharing. Supports Claude Code, Codex, OpenClaw, and more — keeping your skills in sync everywhere.
skillssyncteammulti-agent
by runkids Jul 8, 2026 6/10
skill GitHub
A one-command skill that implements a Router→Agents→CEO decision pattern for Claude Code and OpenClaw. Routes complex decisions through specialized agents and synthesizes a final verdict from a CEO-style orchestrator.
orchestrationworkflowdecision-makingskill
by Klarinia Jul 8, 2026 6/10
skill GitHub
A Nix module for declaratively managing Claude Code agent skills — define your skills in Nix configuration and have them deployed and versioned consistently across machines.
Nixdeclarativeskillsconfiguration
by Kyure-A Jul 8, 2026 5/10
skill GitHub
A Claude Code plugin that spawns parallel review subagents to validate implementation plans before execution — checking codebase alignment, best practices, feasibility, and blind spots. Catches issues at planning time rather than after hours of implementation.
planningvalidationsubagentspre-execution
by kojott Jul 8, 2026 8/10
skill GitHub
Agent skills for finding dead code, unused dependencies, and code duplication in JavaScript/TypeScript projects. Works with Claude Code, Cursor, Codex, Gemini CLI, and 30+ other agents.
JSTypeScriptdead-codecleanup
by fallow-rs Jul 8, 2026 6/10
skill Reddit
A Claude Code skill for capturing thoughts and ideas that arise during active debugging sessions without interrupting the current workflow. Bridges the gap between MEMORY.md (preferences), CLAUDE.md (project info), and ephemeral ideas that need to wait.
skillnotesworkflowproductivity
by mcosternl Jul 8, 2026 6/10
skill GitHub
A skill for browser automation that eliminates the snapshot-and-action loop overhead. Enables reliable multi-step browser tasks by giving the agent higher-level control primitives.
browserautomationskillworkflow
by Alisha2420 Jul 8, 2026 5/10
skill Reddit
A Claude skill that silently detects your target tool (Cursor, Claude Code, GPT, Midjourney, etc.) and generates accurate prompts specifically tailored to that tool's strengths and format. Built-in memory for long sessions. 1500+ GitHub stars.
prompt-engineeringskillmulti-toolproductivity
by CompetitionTrick2836 Jul 8, 2026 6/10
skill GitHub
A Claude Code skill that spawns 4-6 AI reviewers who debate code or plans anonymously, with anti-groupthink mechanisms and 9 auto-detected signal groups — then a supreme judge delivers the final verdict. Built-in domain checklists for different review types.
code-reviewadversarialmulti-agentskill
by wan-huiyan Jul 8, 2026 8/10
skill GitHub
A system of production-ready Claude Code skills that includes quantitative evaluation reports and golden test fixtures — not just the skills themselves, but evidence they actually work. Engineering workflow integration included.
skillsevaluationtestingproduction-ready
by johnqtcg Jul 8, 2026 7/10
skill GitHub
A meta-skill that automates publishing Claude Code skills to GitHub and awesome-claude-skills lists. Encodes lessons learned from real publishing attempts including common pitfalls and submission requirements.
skillspublishingGitHubmeta
by wan-huiyan Jul 8, 2026 5/10
skill Reddit
An open-source tool that roasts your SKILL.md files in-character (choose your roast persona), exposing weaknesses in your skill design. Built after discovering most skills needed significant improvement even when they 'worked'.
skillsfeedbackqualitySKILL.md
by jorkim_32 Jul 8, 2026 6/10
skill GitHub
Official Dash0 skills and reference documentation for AI coding assistants covering OpenTelemetry instrumentation patterns, telemetry quality guides, and Dash0 integration. Helps Claude produce correct OTel code.
OpenTelemetryobservabilityskillinstrumentation
by dash0hq Jul 8, 2026 5/10
skill Reddit
A system of 20 specialized Claude Code skills implementing a 14-phase book pipeline from research through revision, with a Genesis Score calibrated against 15 bestsellers and 20 anti-AI patterns for human-feeling output. Produced a 68K-word memoir.
writingskillscreativeautonomous
by Turbulent_Worker9216 Jul 8, 2026 6/10
skill GitHub
A Claude skill that gives Claude Code agents the ability to use a web browser for research, documentation lookup, and web automation tasks.
browserskillwebautomation
by SawyerHood Jul 8, 2026 6/10
skill GitHub
A Claude Code skill that audits bare React Native projects for New Architecture readiness — parallel library checker, JS/TS + iOS + Android native scan, Migration Effort Score, and a 4-phase migration plan. Supports monorepos, delta mode, and offline fallback.
React Nativemigrationauditskill
by rajivmanivannan Jul 8, 2026 6/10
skill GitHub
A curated collection of battle-tested patterns, tools, and configurations for Claude Code — covering CLAUDE.md setup, hook patterns, skill organization, and workflow automation for Anthropic's CLI coding agent.
best-practicespatternsconfigurationClaude Code
by zzhou23 Jul 8, 2026 6/10
skill GitHub
A personal Claude Code blueprint providing a complete reusable setup — skills, agents, hooks, and rules — shareable across all projects. Serves as a template for kickstarting new projects with a proven configuration.
blueprinttemplatehooksskills
by herbeckrobin Jul 8, 2026 5/10
skill Reddit
A clear mental model for when to use a skill vs an agent: skills execute the same steps every time (consistency), agents exercise judgment to choose different paths (decision-making). One question clears it up: does the task need consistency or judgment?
skillsagentsmental-modelworkflow
by dydolino Jul 8, 2026 7/10
skill Reddit
Traces agent failures to one root cause: CLAUDE.md grown into a wall of history that floods the context before real work starts. Solution: split CLAUDE.md into a slim project brief, separate decision log, and component-level context files loaded only when needed. Concrete before/after structure included.
CLAUDE.mdcontextlong-sessionsconfiguration
by ShellSageAI Jul 8, 2026 8/10
skill Reddit
Strategies for preventing context drift in long-lived projects: component-level CLAUDE.md files that agents update as they work, explicit 'known good baseline' markers, and scheduled context refresh checkpoints. Addresses the grep spiral problem where Claude searches the whole codebase instead of using context.
CLAUDE.mdcontextdriftbest-practices
by hustler-econ Jul 8, 2026 7/10
skill Reddit
A practical guide to the skill authoring sweet spot: unlike CLAUDE.md (always loaded) and ad-hoc prompts (never reused), skills are pull-loaded only when the agent matches the task. Covers minimal effective file structure and when not to use a skill.
SKILL.mdbest-practicescontextskills
by AnayMehra Jul 8, 2026 7/10
skill GitHub
A skill that makes Claude output self-contained HTML artifacts for tasks instead of standard markdown, improving content rendering and enabling interactive user interfaces within Claude's response.
skillHTMLartifactsrendering
by dovydaskarbutovskis20-art Jul 8, 2026 5/10
skill GitHub
A skill set for building SaaS products through an 8-phase AI agent pipeline with mandatory human approval gates between phases. Works with Claude Code, Antigravity, and Codex. Enforces structured progression from concept to deployment.
SaaSskillsworkflowapproval-gates
by batterfried-philosophy172 Jul 8, 2026 5/10
skill GitHub
State-of-the-art (2026) Claude Code skills for building and auditing software across 30 domains and languages, with BUILD and AUDIT modes and structured audit checklists. Covers mainstream stacks and specialized domains.
skillsauditbuildmulti-domain
by martinholovsky Jul 8, 2026 6/10
skill Reddit
An open-source marketing audit toolkit built with Claude Code's SKILL.md system, featuring 15 slash commands and a parallel agent architecture. Running /market audit spawns 5 specialized sub-agents simultaneously analyzing content, conversion, SEO, competitive positioning, and brand. Bilingual (FR/EN), MIT licensed, installable in 30 seconds.
skillslash-commandsparallel-agentsmarketingopen-source
by Johssinma Mar 19, 2026 7/10
skill GitHub
A CLAUDE.md configuration that teaches Claude Code to collaborate with CodeRabbit for end-to-end PR workflows. Automates PR planning, code review loops, and merge workflows by defining how Claude Code and CodeRabbit interact. Drop-in configuration for teams already using CodeRabbit.
claude.mdcoderabbitcode-reviewpr-workflowautomation
by auerbachb Mar 19, 2026 7/10
skill Reddit
A set of 5 free Claude Code slash commands for generating onboarding documentation grounded in actual repo files. Covers architecture overview, module dependency maps, environment setup, ownership maps, and more. Each skill reads the real codebase and produces a doc without hallucinated stack details.
skillsslash-commandsonboardingdocumentationcodebase
by Upbeat-Rate3345 Mar 19, 2026 7/10
skill GitHub
A collection of 13 deterministic Claude AI skills for PDF.js (pdfjs-dist 5.x), covering rendering, viewer development, error handling, and project scaffolding. Designed to give Claude Code reliable, up-to-date context for PDF.js projects. Useful for developers building PDF viewers or document processing tools.
skillspdf.jspdfjsrenderingfrontend
by OpenAEC-Foundation Mar 19, 2026 6/10
skill GitHub
A set of production-ready Claude Code skills covering code quality auditing, design document generation, documentation automation, and infrastructure tasks. Each skill is a slash command that can be dropped into any Claude Code project. Practical and immediately usable across multiple engineering workflows.
skillscode-auditdocumentationinfrastructuredesign-docs
by Destynova2 Mar 19, 2026 7/10
skill Reddit
Claude Code normally auto-loads only CLAUDE.md files within the project hierarchy, but you can use @-references to pull in any CLAUDE.md from anywhere in the filesystem on-demand. This technique enables shared global configurations, library-specific instructions, and cross-project skill sets without polluting individual repos. Post includes concrete examples and edge cases.
claude.mdconfigurationfile-loadingtipsglobal-config
by thealliane96 Mar 19, 2026 7/10
skill Reddit
Practical tips for escaping the default Claude frontend look: lock it to a strong component library (with MCP if available), specify an icon library, write explicit CLAUDE.md guidelines for colors/fonts/patterns you hate, and create a /talklikeme skill trained on your own writing so copy sounds human. The /talklikeme approach involves feeding past essays and having Claude interview you to learn your voice.
frontendskilldesigntalklikemecomponent-libraryclaude.md
by Pitiful-Head-4162 Mar 19, 2026 6/10
skill GitHub
A Claude Code skill that manages the complete software development lifecycle from planning through deployment. Designed as a reusable SKILL.md component to bring consistent SDLC discipline to Claude Code-driven projects.
skillsdlclifecycleworkflowskill.md
by DarrenBenson Mar 19, 2026 7/10
skill GitHub
A collection of 44+ standardized SKILL.md files covering Solution Architecture, Startup Strategy, Software Engineering, and Product Growth — usable with both Claude Code and GitHub Copilot. Each skill targets a specific professional domain and provides structured prompting workflows across AI coding tools.
skillsskill.mdarchitecturestartupcopilotuniversal
by ericgandrade Mar 19, 2026 7/10
skill Reddit
A skill routing pattern where every Claude Code command goes through a single /do dispatcher that reads intent and routes to the correct skill, agent, or pipeline automatically. Eliminates the problem of Claude not using the right tool for each task. The SKILL.md is open-sourced as part of a broader claude-code-toolkit.
skillrouterdispatchskill.mdautomationworkflow
by AndyNemmity Mar 19, 2026 7/10
skill GitHub
A social media content skill for AI agents that writes platform-native posts for different networks, plans content calendars, and researches hashtags. Free and open source. Good starting point for anyone building social media automation with Claude Code skills.
skillsocial-mediacontentautomationmarketing
by superlowburn Mar 19, 2026 6/10
skill GitHub
A lead generation skill for AI agents that researches prospects, scores them against an ideal customer profile (ICP), and generates outreach messages. Free and open source. Useful as a starting template for sales automation workflows using Claude Code.
skilllead-gensalesoutreachautomation
by superlowburn Mar 19, 2026 5/10
skill GitHub
An invoice and billing skill for AI agents that generates invoices, tracks payment status, and sends reminders. Free and open source. Useful template for integrating billing workflows into Claude Code-based business automation.
skillinvoicebillingpaymentsbusiness
by superlowburn Mar 19, 2026 5/10
skill GitHub
A customer support triage skill for AI agents that classifies support tickets, prioritizes queues, drafts responses, and detects churn risk. Free and open source. Good foundation for building AI-powered customer support workflows with Claude Code.
skillcustomer-supporttriageticketsautomation
by superlowburn Mar 19, 2026 6/10
skill GitHub
An SEO audit skill for AI agents that analyzes on-page SEO factors including meta tags, headings, content quality, and internal linking. Free and open source. Good base skill for building SEO analysis and reporting into Claude Code workflows.
skillseoauditcontentanalysis
by superlowburn Mar 19, 2026 5/10
skill GitHub
A Claude Code skill that generates standalone, animated HTML landing pages from just a product description — no dependencies, no build step. Produces self-contained HTML files with animations using only a short text prompt. Useful for quickly prototyping or generating marketing pages.
skillhtmllanding-pagefrontendgeneration
by hemsurendranath Mar 19, 2026 7/10
skill Reddit
An agent skill for the Auto.dev automotive data platform that gives Claude the ability to search live car inventory, decode VINs, check recalls, and calculate payments. Install with npx skills add drivly/auto-dev-skill. Shows the power of domain-specific skills for real-world data queries.
skillautomotiveapidatadomain-specific
by Masterpiece-Smart Mar 19, 2026 6/10
skill GitHub
A Claude Code skill that integrates Hono CLI tools for building Hono web applications. Provides project scaffolding, routing patterns, and Hono-specific best practices directly in Claude Code sessions. Good for developers using the Hono framework who want AI-assisted development.
honoskillwebframeworkcli
by panjicopri Mar 19, 2026 5/10
skill GitHub
A collection of reusable agent skills focused on local workflows and automation, including utilities for China workday calendar checks and Codex session history tools. Good starting point for building locale-specific or developer-workflow automation skills.
skillsautomationlocalworkflowcodex
by Sube-py Mar 19, 2026 6/10
skill GitHub
21 deterministic Claude AI skills packaged for n8n v1.x workflow automation. Bridges Claude Code capabilities with n8n's visual workflow builder for non-code automation. Useful for building AI-powered automation pipelines that combine Claude reasoning with n8n integrations.
skillsn8nautomationworkflowintegration
by OpenAEC-Foundation Mar 19, 2026 8/10
skill Reddit
A Claude Code skill that runs on a 30-minute loop to validate your git repo, audit file organization, flag clutter, and push a checkpoint commit. Specifically designed to counter context rot — the gradual degradation of AI response quality in long sessions. Can be triggered manually or automatically.
skillsgitcontext-rotautomationmemory
by ProjectorMusic Mar 19, 2026 7/10
skill GitHub
A personal agent toolkit repository containing reusable skills and plugins for Claude Code, Cursor, Codex, and Gemini CLI. Provides a structured library of common tasks and automations so you do not have to recreate skills from scratch. A good reference for building your own skill collection.
skillspluginsreusableclaude-codetoolkit
by svyatov Mar 19, 2026 7/10
skill GitHub
A set of Claude Code skills tailored for journalism, media, and academic work — covering source verification, FOIA request drafting, data journalism workflows, and academic writing. Practical skills for researchers and journalists who use Claude Code for investigative and writing tasks.
skillsjournalismresearchverificationacademia
by jamditis Mar 19, 2026 7/10
skill Reddit
Two Claude Code skills that spawn agent teammates and have them play games against each other — Connect Four and Tic-Tac-Toe. A fun demonstration of the agent teams feature and how skills can orchestrate multi-agent interactions beyond purely productive tasks.
skillagent-teamsgamesmulti-agent
by CygraW Mar 19, 2026 6/10
skill GitHub
A Claude Code plugin implementing the "Three Reviews and Three Proofreads" (三审三校) technical document review workflow. Simulates a team of reviewers across three distinct review passes for accuracy, clarity, and style. Especially relevant for documentation-heavy engineering teams.
documentationreviewworkflowplugin
by ShieldBytes Mar 19, 2026 6/10
skill GitHub
A curated collection of battle-tested CLAUDE.md files for common stacks including Next.js, React, Python, and Flutter. Ready to drop into any project to instantly give Claude Code the right context, conventions, and guardrails for each stack. Good starting point for teams standardizing their AI configs.
claude-mdconfigurationtemplatesbest-practices
by sx4im Mar 19, 2026 7/10
skill GitHub
A collection of agent skills by CyperX designed to work across different AI coding assistants. The "write once, run everywhere" philosophy means skills don't need to be adapted per platform. A useful starting point for developers building cross-compatible agent skill libraries.
skillscross-platformcollection
by cyperx84 Mar 19, 2026 5/10
skill GitHub
A Claude Code plugin that evaluates work quality across a 7-dimension rubric before completing a task. Forces the agent to self-assess before declaring done, catching low-quality output early. The rubric covers correctness, completeness, clarity, security, performance, maintainability, and test coverage.
qualityself-assessmentrubricplugin
by augmentedivan Mar 19, 2026 7/10
skill GitHub
A CLI tool for creating, managing, and publishing a personal agent skills registry hosted on GitHub. Authors skills with a local editor, version-controls them via git, and publishes the registry for use across any agent platform. A structured alternative to manually managing .skill files.
skillsregistrycligithub
by sushil-kamble Mar 19, 2026 7/10
skill GitHub
A plugin ecosystem for Claude Code introducing the sd0x-dev-flow framework. Provides a structured set of plugins for common development flows within Claude Code sessions.
pluginecosystemworkflow
by sd0xdev Mar 19, 2026 5/10
skill GitHub
An all-in-one /aura slash command skill for Claude Code providing build, fix, clean, deploy, and review operations with 4-layer security verification, triple confirmation checks, and compact defense mode. Designed as a single skill that handles the full development lifecycle.
skillsecurityfull-stackslash-command
by smorky850612 Mar 19, 2026 7/10
skill GitHub
A collection of AI agent skills for e-commerce workflows — product research, marketing automation, supply chain optimization, and business analytics. Covers Amazon, Shopify, Etsy, TikTok Shop, and other major platforms. Aimed at solo sellers and small teams who want AI automation without custom development.
skillsecommerceautomationshopify
by nexscope-ai Mar 19, 2026 5/10
skill GitHub
A skill that teaches AI agents to discover hidden APIs, data functions, and browser automation recipes for arbitrary websites. Works with Claude Code, ClawHub, Cursor, and any AgentSkills-compatible agent. Useful for building scrapers, automations, or integrations without documented APIs.
skillapi-discoveryautomationweb-scraping
by ChizhongWang Mar 19, 2026 6/10
skill Reddit
A report on building and testing the first Claude Visual Skill — a skill that generates interactive UI blocks directly in the Claude chat interface using the new Visuals feature. Demonstrates the potential of combining Claude Code's skill system with the inline visual rendering API.
skillvisualsuiclaude-api
by romancone Mar 19, 2026 5/10
skill Reddit
A Claude skill that breaks any job down to granular sub-tasks, determines which parts AI should handle vs. humans, designs a multi-agent collaboration system, and generates an implementation roadmap. Tested on a real HR case with 61 sub-tasks. Free .skill file available.
skillworkflow-designautomationhr
by Significant-Bag2944 Mar 19, 2026 6/10
skill Reddit
A simple but effective CLAUDE.md rule that prevents Claude from silently reconstructing context after a session stop. Without this rule, Claude pretends to understand context it doesn't have. The rule forces explicit acknowledgment of lost state rather than confident guessing.
claude-mdsessionconfigurationbest-practices
by Valo-AI Mar 19, 2026 5/10
skill GitHub
A curated collection of Claude Code skills focused on AI-assisted development workflows. Each skill includes structured guidance, best practices, and ready-to-use patterns for common development tasks. Designed to consistently improve Claude Code output quality across different projects.
skillsbest-practicesworkflowcollection
by mumudevx Mar 19, 2026 6/10
skill Reddit
A free Claude skill that writes accurate, tool-specific prompts for Cursor, Claude Code, GPT, Midjourney, Kling, Eleven Labs, and other AI tools. Instead of generic prompts, it generates prompts calibrated for each tool's specific strengths. Has accumulated 600+ GitHub stars and 4000+ traffic visits.
skillprompt-engineeringmulti-toolpopular
by CompetitionTrick2836 Mar 19, 2026 8/10
skill GitHub
A managed AI personal assistant plugin for Claude Code Cowork mode featuring 20 workflow skills, guided onboarding, a proactive behavior engine, and multilingual support (EN/HE/RU). Provides a structured skill marketplace experience within Claude Code.
skillscoworkmultilingualmarketplace
by BinatrixAI Mar 19, 2026 7/10
skill GitHub
A collection of skills for Android development covering Kotlin, Jetpack Compose, XML layouts, and legacy code modernization. Designed to help Claude Code build, test, and upgrade real Android apps with platform-specific best practices baked in.
androidkotlincomposemobile
by Aotocom Mar 19, 2026 6/10
skill GitHub
A skill providing AI agents with a comprehensive knowledge base for writing, debugging, and optimizing Cypress tests. Includes standard patterns, best practices, and common pitfalls for E2E testing. Useful for teams using Claude Code in their frontend testing workflow.
testingcypresse2eskill
by YTItsfrost Mar 19, 2026 6/10
skill GitHub
An expert-level prompt engineering skill covering system prompts, tool descriptions, context engineering, and cross-provider compatibility. Works with Claude Code, Cursor, Gemini CLI, and any Agent Skills-compatible tool. A reference implementation for prompts that work well across different AI platforms.
prompt-engineeringskillcross-platformbest-practices
by Shaharsha Mar 19, 2026 7/10
skill GitHub
A collection of Claude Code skills focused on product management workflows and development automation. Covers common PM tasks like spec writing, roadmap planning, and stakeholder communication — filling a gap in the mostly developer-focused skills ecosystem.
skillsproduct-managementautomationworkflow
by tflaim Mar 19, 2026 6/10
skill GitHub
A drop-in configuration framework that enhances Claude Code with specialized agents and workflow automations for common development tasks. Provides structured agent behaviors and workflow pipelines for efficient coding automation. Open source on GitHub.
configagentsworkflowautomationclaude-code
by Kamixon131 Mar 19, 2026 6/10
skill GitHub
A comprehensive drop-in ~/.claude configuration that bundles 119 skills, 67 agents, 101 marketplace repos (6,600+ community skills), 30 commands, and 8 hooks with zero configuration required. The toolkit auto-activates the right resources based on your prompt, making it a turnkey upgrade for any Claude Code setup. One of the most complete community config collections available.
skillsagentscommandshooksconfigtoolkitmarketplace
by travisjneuman Mar 19, 2026 9/10
skill Reddit
I use the /rename function for important threads I want to pick up again later. I also have a library of agents and skills I use daily. I have found that when I use agent teams, my session history ...
skill
by rvtndiecxb Mar 19, 2026 7/10
skill GitHub
Agent definitions, skills, and hooks for Claude Code.
skillhook
by xsyetopz Mar 19, 2026 10/10
skill GitHub
Unify your AI skillbox. A local hub to visualize, manage, and sync skills across Antigravity, Claude, Cursor, Trae, and other AI agents.
skill
by PotatoDog1669 Mar 19, 2026 7/10
skill GitHub
Convert Markdown or Word documents into clean, Claude-style presentations in HTML or PPTX with simple, minimal design and clear structure.
skill
by ibadbasit Mar 19, 2026 6/10
skill Reddit
I'm one person building a world-building platform in TypeScript. 668K lines, 14 domains, Canvas2D engine, the whole thing. The codebase got too big for one agent's context window, so I had to figur...
skillhooktypescript
by DevMoses Mar 19, 2026 10/10
skill GitHub
Self-improving skills for Claude Code. A slash command that audits your CLAUDE.md rules, feedback memories, and commands — finds what's broken, stale, or missing, and suggests fixes. Zero infra, on...
skillcommandclaude.mdreview
by oniani1 Mar 19, 2026 10/10
skill GitHub
An expert-level career engineering and market analysis skill
skill
by Balbus95 Mar 19, 2026 5/10
skill GitHub
Collection of Claude Code skills
skill
by kogakure Mar 19, 2026 8/10
skill GitHub
根据 Git 提交历史自动生成结构化的(Obsidian )日报内容
skillgit
by KKenny0 Mar 19, 2026 5/10
skill Reddit
Hi all, I am in love with the possibilities of Claude Code and have used it primarily for advanced creation and editing of documents. Since I cannot install it on my work machine, I have built a sm...
skillapi
by Low_Singer_44 Mar 19, 2026 8/10
skill GitHub
🇰🇷 Claude Code Skill for searching Korean IP (patents, trademarks, designs) via KIPRIS Plus Open API — 52 services, 564 operations
skillapi
by nuri428 Mar 19, 2026 8/10
skill GitHub
A AI skill to build AVD inventory with Claude Code or Github Copilot (Read Only repository)
skillgit
by titom73 Mar 19, 2026 8/10
skill Reddit
So there's a massive debate raging regarding the whole Garry Tan's gstack fiasco(if I can call it that?!). People are calling it just a bunch of text files. While others are deeming it to be future...
skill
by SuperBlitz99 Mar 19, 2026 6/10
skill Reddit
Most skills are shallow. You write a skill file. Maybe it's for code review, or summarizing documents, or generating commit messages. One file, one purpose. The agent reads it, follows the instruct...
skillreview
by Afraid-Today98 Mar 19, 2026 6/10
skill GitHub
Autonomous long-running coding skill for Claude Code — decompose a big goal, execute in isolated worktrees, mine for more work. /overnight PROMPT and walk away.
skill
by choism4 Mar 19, 2026 8/10
skill Reddit
Yesterday I was playing with playwright integration, discussed in this sub earlier. I was very excited how powerful Claude can be with browser integration, much better than official chrome mode. La...
skillreview
by Sensitive_Device_236 Mar 19, 2026 7/10
skill Reddit
submitted by /u/psd-dude [link] [comments]
skill
by psd-dude Mar 19, 2026 6/10
skill GitHub
Browser automation CLI skill for Claude Code (agent-browser 0.14.0)
skillautomation
by OWENLEEzy Mar 19, 2026 9/10
skill GitHub
A Claude skill for self-studying CAE (Cambridge C1 Advanced) students. Generates authentic, C1-calibrated exercises for all 8 parts of Reading & Use of English and both Writing tasks. Gives strict ...
skill
by violasgarbi Mar 19, 2026 6/10
skill GitHub
Production-grade AI skills for software development. Audit, refactor, commit, PR, docs, research — self-contained, tool-agnostic.
skill
by sungurerdim Mar 19, 2026 5/10
skill GitHub
Agent skills for Arize — datasets, experiments, and traces via the ax CLI
skill
by Arize-ai Mar 19, 2026 6/10
skill Reddit
Getting along great with CC until I ask it to tell me what are my to-do's for my upcoming meeting, and then all of a sudden it will think we're in last month. Is there a skill that I can invoke tha...
skill
by Mission-Tap-1851 Mar 19, 2026 8/10
skill Reddit
I have created a few Claude skills to help me in my day-to-day activities. During the process, I need to make some updates on the skills, either to fix mistakes or upgrade. However, when I ask Clau...
skill
by CR_41 Mar 19, 2026 6/10
skill GitHub
Opinionated Claude Code configuration: 13 rules, 12 on-demand standards, 24 slash-command skills, and 11 runtime hooks that enforce engineering standards at development time
skillhookcommandconfig
by gufranco Mar 19, 2026 10/10
skill GitHub
📓 Claude Code skill and agent for automatic project documentation in Obsidian
skill
by ali5ter Mar 19, 2026 9/10
skill GitHub
An AI skill plugin that teaches your AI the skills to delegate tasks to Copilot
skill
by namos2502 Mar 19, 2026 5/10
skill GitHub
Marketplace of domain-specific plugins for AI agents (Cowork, Claude Code, OpenClaw). Build autonomous business workflows for finance, banking, legal operations, and sales using modular agent skill...
skillcommandworkflow
by panaversity Mar 19, 2026 9/10
skill GitHub
Claude Code plugins and skills — capabilities awareness and multi-agent codebase review
skillreview
by liam-jons Mar 19, 2026 9/10
skill GitHub
Comprehensive skills system for Cursor IDE with mandatory expertise enforcement, automatic skill discovery, multi-agent coordination, and persistent learning. 220+ skills across 10 categories + 8 c...
skill
by payals Mar 19, 2026 6/10
skill Reddit
https://i.redd.it/xo8qx7y8pvpg1.gif Hey folks. I don't know if it's just me, but I got frustrated managing AI skills by hand. Copy a markdown file into .claude/skills/ , then the same thing into .c...
skillgitautomationreview
by julennnnn Mar 19, 2026 8/10
skill Reddit
submitted by /u/coolreddy [link] [comments]
skillapi
by coolreddy Mar 19, 2026 8/10
skill Reddit
I love CC. Been using it since Mar 2025 and have built a US state government used AI Service and website deployed two months ago with nice passive income with world travel ideas. Big fan of 1M cont...
skillreview
by OmniZenTech Mar 19, 2026 6/10
skill Reddit
Hello! I'm a new user of Claude (since February), and I used the Free version for light programming. I have no real skills at programming, and I found it pretty fun and interesting to use. Sadly, w...
skill
by Round_Atmosphere3671 Mar 19, 2026 9/10
skill GitHub
A collection of skills focused on end-to-end automation for AI agents.
skillautomation
by jmr85 Mar 19, 2026 6/10
skill GitHub
A collection of Agent Skills for MATLAB development. Skills are specialized instruction sets that extend a coding agent's capabilities for specific tasks, automatically activating when needed.
skill
by matlab Mar 19, 2026 6/10
skill Reddit
In my current job we are using Claude enterprise. I want to start distributing skills across my team. Currently the org is distribuiting skills with Claude native distribution, but that means that ...
skillgit
by widonext Mar 19, 2026 6/10
skill GitHub
A curated collection of Claude Code plugins: multi-agent dev team, AI council code reviews, and project management
skillreview
by rube-de Mar 19, 2026 9/10
skill GitHub
skills:
skill
by craft-studio-marketplace Mar 19, 2026 5/10
skill GitHub
CLAUDE SKILL for Obsidian.md plugin development
skill
by gapmiss Mar 19, 2026 6/10
skill Reddit
I’m building an app using Claude Code for the first time, what are the best skills that I can add to Claude? submitted by /u/ragnar580 [link] [comments]
skill
by ragnar580 Mar 19, 2026 8/10
skill Reddit
Ever since the switch from the big GPT to Claude, my life has been so much better. But, the maths always looks so unappealing, thats one thing I truly missed from ChatGPT. Is there a skill or smth ...
skill
by RainApprehensive9706 Mar 19, 2026 6/10
skill Reddit
I'm working simultaneously with Claude CLI, codex, gemini etc, each one has its own skill, task, specialty. is there a GUI that is similar to codex or Claude desktop and could manage conversation a...
skill
by nivijah Mar 19, 2026 7/10
skill Reddit
I’ve just finished an ETL and Schema set of skills, and need to finish the set with a dash boarding skill. Has anyone seen good ones? Thinking in the design element - the front end design skill is ...
skill
by GumanHoon Mar 19, 2026 5/10
skill Reddit
Hi all- im currently starting to hit some real painful walls with EXTENSIONS of functions that are already inherently working. Claude seems to forget all the parity points that need to be created/ ...
skillworkflowgit
by ThesisWarrior Mar 19, 2026 6/10
skill GitHub
Custom skills and prompts for Claude Code / Codex based on my personal workflows.
skillworkflow
by Sean-Michael Mar 19, 2026 8/10
skill GitHub
Agent skill for spec-driven development with AI coding agents — structured specification-first workflow (specify → plan → tasks → implement → validate) for Claude Code, Cursor, GitHub Copilot, and ...
skillworkflowgit
by mariano-aguero Mar 19, 2026 9/10
skill Reddit
I saw a bunch of people in this subreddit discussing Claude telling them to "go to bed", so the first time mine hit me with it, I built this skill: Claude never suggests Hannah should stop working,...
skill
by ihzzy Mar 19, 2026 6/10
skill GitHub
Claude AI skill — personal karting coach for young Rotax racers. Telemetry analysis, MyChron dashboards, setup advice, Rotax regulations. Ages 7-14. EN/PT.
skill
by sangee06 Mar 19, 2026 7/10
skill GitHub
A highly sophisticated, theoretically sound adaptation of Problem Frames for modern Agentic Software Engineering.
skill
by knowlet Mar 19, 2026 6/10
skill GitHub
Analyze NSE/BSE stocks using AI-driven technical indicators, position sizing, and risk management tools directly within your terminal.
skill
by Crokx Mar 19, 2026 5/10
skill Reddit
I have been using Opus 4.6 for the last few weeks doing a lot of coding and deployments and things have been great. I had been using superpowers/skills and as much context aware prompting I could g...
skill
by Akimotoh Mar 19, 2026 6/10
skill Reddit
It won't use them on its own. Seems to ignore the demand if I put it in a CLAUDE.md file. I've tried creating a skill that tells it to do so. Still zip. It'll only use one if I tell it to act expli...
skillclaude.md
by dragonfax Mar 19, 2026 8/10
skill GitHub
🧵 Threads(脆)平台全自動化 Claude Code Skill — 登錄、發帖、搜索、批量回覆、多帳號管理,基於 Chrome CDP
skill
by gaojiongwenv587-beep Mar 19, 2026 8/10
skill GitHub
Provide 43 AI agent skills to automate Japanese business tasks across e-commerce, finance, marketing, and operations with efficient workflow integration
skillworkflow
by traygerbig Mar 19, 2026 6/10
skill Reddit
submitted by /u/eCappaOnReddit [link] [comments]
skill
by eCappaOnReddit Mar 19, 2026 9/10
skill Reddit
I've ripped out tons of agents and skills that are personally to me to try to provide you my ai agent system. I don't think you should install it. I think you should clone it, point claude code to ...
skillgit
by AndyNemmity Mar 19, 2026 10/10
skill GitHub
Agent skill for designing systems jointly managed by humans and AI
skill
by metyatech Mar 19, 2026 6/10
skill GitHub
Spawn multiple agents to compete on the same task, cross-pollinate ideas, and pick the best solution by vote.
skill
by qiao Mar 19, 2026 6/10
skill GitHub
llm-skills:
skill
by senior-sigan Mar 19, 2026 5/10
skill Reddit
I'm almost done with GlassCode. A native liquid glass mac app for Claude Code. I liked the UI of Codex and liquid glass but missed using Claude. Get early access at: www.glasscode.app Here is some ...
skill
by mogens99 Mar 19, 2026 9/10
skill Reddit
I’ve been using Claude a lot for product and GTM thinking lately, but I kept running into the same issue: If the context is messy, Claude tends to produce generic answers, especially for complex wo...
skillworkflowgitreview
by Spirited_Essay4354 Mar 19, 2026 6/10
skill GitHub
AI-first smart contract security auditor. 90% precision across 40 blind Code4rena contest benchmarks. Claude Code skills — zero API cost.
skillapi
by ZealynxSecurity Mar 19, 2026 8/10
skill GitHub
Claude Code Skill to setup nvim from scratch
skill
by dysuby Mar 19, 2026 9/10
skill GitHub
Claude skill that removes AI writing patterns from Swedish professional text. Covers 16 pattern types including significance inflation, nominalization overuse, passive voice as false formality, ang...
skill
by nordefors-max Mar 19, 2026 6/10
skill Reddit
I’ve been using Claude Code a lot for product and GTM thinking lately, but I kept running into the same issue: If the context is messy, Claude Code tends to produce generic answers , especially for...
skillworkflowgitreview
by daronello Mar 19, 2026 8/10
skill GitHub
Claude Code skill for generating Excalidraw diagrams and exporting to PNG/PDF/SVG locally
skill
by Agents365-ai Mar 19, 2026 8/10
skill Reddit
The Plugin marketplace feels like the obvious spot, but how do orgs best manage 30+ teams messing about with their own “make a pr” skill workflows, is there a desire to “re-use” code and can the ma...
skillworkflow
by AndyM03 Mar 19, 2026 5/10
skill GitHub
Useful Claude Code skills for Java development
skill
by litsec Mar 19, 2026 10/10
skill GitHub
Auto data profiler + AI narrative generator. Upload CSV/Excel → get an executive report. Built as a Claude Skill.
skill
by dinesh0666 Mar 19, 2026 6/10
skill GitHub
Agent skills for building, shipping, and growing software products
skill
by tenequm Mar 19, 2026 6/10
skill Reddit
Been meaning to try Claude Code properly for a while and finally sat down and used it to get deploi.no up and running. Honestly didn't expect it to go as smoothly as it did for someone who's more p...
skillapigit
by gmaister_nor Mar 19, 2026 9/10
skill Reddit
Looking for good Skills or any other input. It's odd, but I've seen Sonnet to perform better than Opus, or at least be no worse. I've also noticed that the code is definitely "better" in that it's ...
skill
by Stats-Anon Mar 19, 2026 6/10
skill Reddit
Hey guys! I'm very new to Claude and am still getting myself well-versed in it. I've been trying to speed up some of the more tedious parts of my day-to-day, currently working on speeding up conten...
skill
by SuccessIsHere11 Mar 19, 2026 6/10
skill Reddit
For God’s sake! You came here to share your unique and only experience of building a control tower or an egg timer. Or you want to enlighten us on how we’ve been using Claude “wrong” all this time....
skill
by pingponq Mar 19, 2026 6/10
skill Reddit
Audits production project health across 6 phases: onboarding, deployment safety, runtime visibility, observability, resilience, and runbook completeness. Answers whether an AI can operate your codebase solo.
devopsauditskilloperationsproduction
by MoiSanh Mar 19, 2026 7/10
skill GitHub
Research assistant supporting Claude Code, OpenCode, and Codex CLI across ideation, coding, experiments, writing, and publication workflows. Handles literature review, experiment design, and report generation.
researchacademicskillwritingscience
by Galaxy-Dawn Mar 19, 2026 7/10
skill GitHub
Complete SEO audit system for AI coding agents with 4 skills covering technical SEO, E-E-A-T, UX/persona, CRO, and AI search readiness. Works with Claude Code, Codex, and Cursor.
seoauditskillmarketingweb
by shibanshu12 Mar 19, 2026 7/10
skill GitHub
Open-source Computer Use skill for Claude Code using dual engines — Win32 API for native desktop apps and Playwright for web/Electron. Controls WeChat, Slack, Teams, and any desktop app with automated QA and visual feedback loops.
computer-useautomationplaywrightwin32skill
by 24kchengYe Mar 19, 2026 8/10
skill Reddit
Update on the Design Studio Claude Code plugin covering v3 and v4 changes: renamed to Naksha, added motion designer, brand strategist, UX researcher, accessibility auditor, and design system lead roles.
designskillrolesuiux
by Known-Delay-9689 Mar 19, 2026 7/10
skill Reddit
Detects drift between your CLAUDE.md instructions and the actual codebase so Claude does not revert to outdated behavior after context compaction. Alerts you when documented conventions no longer match what exists in code.
claude.mdsyncdriftvalidationcli
by giyer7 Mar 19, 2026 8/10
skill GitHub
Claude Code skill enforcing correct CJK typography, form design, UX copy, accessibility, and production CSS for Japanese web interfaces. Prevents common Western-centric mistakes when building for Japanese audiences.
skilljapanesecjkcssaccessibility
by mrslbt Mar 19, 2026 7/10
skill GitHub
Edit videos using natural language commands in your terminal: trim, jump cut, caption, overlay text, and adjust speed. Designed to run as a Claude Code skill without leaving the CLI.
videoeditingskillterminalffmpeg
by Surojit16 Mar 19, 2026 7/10
skill Reddit
Installable sub-agents where each expert stance is sourced from real talks, papers, and interviews — not surface impressions. Includes Rich Hickey, Torvalds, Carmack, and 5 others as reviewers with verifiable reasoning.
agentsreasoningexpertssubagentscode-review
by Kiwiscoops Mar 19, 2026 8/10
skill GitHub
Classic software engineering books condensed into Claude Code skills. Load Clean Code, Domain-Driven Design, or Effective Kotlin principles directly into your agent sessions without re-explaining the concepts each time.
skillsclean-codedddkotlinsoftware-engineering
by booklib-ai Mar 19, 2026 8/10
skill Reddit
A Claude skill that stress-tests startup ideas across three phases: market validation, competitive analysis, and execution risk. Designed to counter confirmation bias by challenging assumptions you'd normally answer optimistically.
startupvalidationskillgtmstrategy
by Few-Needleworker7362 Mar 19, 2026 7/10
skill Reddit
A skill that forces separation between planning and building phases so they don't compete for the same context window. Routes thinking to one context and implementation to another for cleaner, less confused sessions.
skillplanningcontextworkfloworchestration
by JimmySadek Mar 19, 2026 7/10
skill Reddit
Five specialized Claude skills for Governance, Risk, and Compliance covering major frameworks. Moves Claude from generic compliance advice to audit-ready expert-level guidance with domain-specific context built in.
skillscompliancegrciso27001soc2security
by Phoenix-Rising-2026 Mar 19, 2026 7/10
skill Reddit
Built a proxy and traced every API call to discover how CLAUDE.md files work at all levels: project root, subdirectories, and home directory. Reveals how subdirectory CLAUDE.md files are loaded, when they take precedence, and how to layer them effectively for complex projects.
claude-mdinternalsapi-tracingsubdirectoryconfiguration
by Fancy-Exit-6954 Mar 17, 2026 8/10
skill GitHub
A Claude Code skill that automatically runs structured analysis on GSC or Bing Webmaster exports, keyword CSVs, and ranking reports. Instead of just describing data, it performs the analysis inline when relevant files are dropped into the conversation.
seogoogle-searchbingdata-analysisskillgsc
by andersongrowth Mar 17, 2026 5/10
skill Reddit
Proposes a CLAUDE.md equivalent for websites — a standardized llms.txt file that tells AI agents the structure, tools, and capabilities of a site. Draws on the author's 41 days of Claude Code experience with CLAUDE.md to define a discoverable agent interface for the web.
llms-txtweb-standardagent-interfacediscoveryclaude-md
by Specialist_Bar3453 Mar 17, 2026 7/10
skill Reddit
Custom slash commands /sod (Start of Day) and /eod (End of Day) that run morning gratitude + schedule reviews and evening recap based on git history. Commands live as markdown files in .claude/commands/. A practical example of building personal productivity rituals into Claude Code.
slash-commandsproductivitydaily-workflowcustom-commands
by Mammoth_Doctor_7688 Mar 17, 2026 7/10
skill GitHub
Reads PRDs, specs, and meeting notes and creates Azure DevOps Epics, Features, User Stories, Tasks, and Bugs with full hierarchy in one command. Compatible with Claude Code, Cursor, Copilot, and 40+ AI agents as an agent skill.
azure-devopsproject-managementskillbacklog
by GusY2K Mar 17, 2026 6/10
skill GitHub
Provides persistent structured memory for Claude Code with no infrastructure required — just markdown files and git. A simple, dependency-free approach to giving Claude context that survives between sessions.
memorypersistencemarkdowngitcontext
by NominexHQ Mar 17, 2026 8/10
skill GitHub
Automates LLM fine-tuning end-to-end: env setup, LoRA training (SFT, DPO, GRPO, vision), evaluation, and export. Supports Unsloth on NVIDIA/CUDA and mlx-tune on Apple Silicon. Part of the Gaslamp AI development platform.
fine-tuningloranvidiaapple-siliconmlxunslothskill
by TYH-labs Mar 17, 2026 7/10
skill Reddit
GitQuest turns your GitHub history into an idle RPG where your most-used language becomes your class. The author extracted 26 skills, 7 commands, 3 agents, and 5 hooks into a reusable open-source plugin covering game design, backend, narrative, and infrastructure.
skillgame-devagentshooksopen-source
by topbr Mar 17, 2026 8/10
skill Reddit
scope-lock is a free Claude Code skill that creates a boundary contract from your plan before coding starts, then flags when the agent attempts to work outside those boundaries. Built to address the common problem of AI scope creep during long tasks.
skillscopefocusagenticworkflow
by Ktulue_ Mar 17, 2026 8/10
skill GitHub
An AI-powered engineering orchestrator skill for Claude and Codex that structures development from PRD to code with milestone-driven execution. Covers requirement analysis, architecture design, implementation, and review gates.
skillprdengineeringmilestonesorchestration
by Phlegonlabs Mar 17, 2026 7/10
skill GitHub
A DevOps AI Skill Pack with two specialized agents: Horus for Infrastructure-as-Code and Zeus for GitOps workflows. Works cross-platform with Claude Code, OpenAI Codex CLI, and Google Gemini CLI.
devopsiacgitopsskillagents
by qwedsazxc78 Mar 17, 2026 8/10
skill Reddit
A Claude Code growth skill with 6 battle-tested go-to-market playbooks derived from 5 SaaS case studies and $90M ARR partnerships. Specifically designed for product and GTM thinking with structured context to prevent Claude drift.
skillgrowthgtmsaasproduct
by shinigami__0 Mar 17, 2026 7/10
skill GitHub
A Claude Code skill that enforces consistent git commit messages, pull request formatting, and code review conventions across a team. Simple to install and configure for any project.
skillgitconventionsprreview
by chanmuzi Mar 17, 2026 7/10
skill GitHub
A skill for auditing the health of your Claude Code setup against known best practices — checks CLAUDE.md structure, skill quality, hook configuration, and overall agent setup. Quick way to find setup issues.
skillhealth-checkbest-practicesauditsetup
by danielithomas Mar 17, 2026 7/10
skill Reddit
cocoindex-code is a lightweight AST-based code search CLI that integrates with Claude Code via Skills. Provides precise, deterministic symbol and reference lookup without reading entire files, saving significant tokens.
skillcode-searchasttokenscli
by Whole-Assignment6240 Mar 17, 2026 7/10
skill GitHub
A skill for LLMs (Claude Code, OpenClaw, GPT, Gemini) to interact with Twitter/X via TwitterAPI.io. Covers 59 endpoints with curl examples for tweets, users, search, and more.
skilltwitterxapiendpoints
by dorukardahan Mar 17, 2026 7/10
skill GitHub
A tool that deeply analyzes your codebase to generate a tailored CLAUDE.md, lint it for quality issues, and score its effectiveness. Goes beyond generic templates by understanding your actual project structure and dependencies.
claude-mdgeneratorlinterscorerconfiguration
by crisnahine Mar 17, 2026 9/10
skill GitHub
Axiom is a Claude Code skill that takes a feature request and drives it through a first-principles workflow: premise validation, architecture planning, implementation, review, and commit. From idea to pull request automatically.
skillfeatureworkflowreviewcommit
by Guipetris Mar 17, 2026 8/10
skill GitHub
A Product Manager AI Agent Workflow System delivered through Claude Code skills. Includes structured workflows for requirements, roadmaps, stakeholder communication, and feature prioritization.
skillproduct-managementworkflowpmagents
by kelegele Mar 17, 2026 7/10
skill GitHub
A skill pack providing 39 mental models that improve critical thinking, decision making, and strategic analysis within Claude Code. Designed to help the agent approach problems more systematically rather than jumping to solutions.
skillmental-modelsreasoningstrategythinking
by babypochi06 Mar 17, 2026 7/10
skill GitHub
An intelligent web scraping skill for Claude Code with automatic strategy selection based on the target site. Supports TypeScript-first Apify Actor development and picks between static fetch, browser rendering, and proxy strategies automatically.
skillscrapingapifywebautomation
by yfe404 Mar 17, 2026 7/10
skill Reddit
A plugin providing governance layer over Claude Code output: file locking to prevent unauthorized changes, test quality gates that block merges on failed assertions, and drift detection for AI-generated code.
governancetestingquality-gatespluginsecurity
by Cute-Net5957 Mar 17, 2026 8/10
skill GitHub
A comprehensive product management OS delivered through 72 Claude Code skills across 9 categories — requirements, roadmaps, stakeholder management, metrics, user research, competitive analysis, and more.
skillproduct-managementpm72-skillsstructured
by Loethrin Mar 17, 2026 8/10
skill GitHub
Claude Code skills for running adversarial-grade security audits — full architectural context analysis, ultra-granular function-level vulnerability scanning, and detection of novel code vulnerabilities beyond OWASP top 10.
skillsecurityauditvulnerabilitypentest
by Yashvendra Mar 17, 2026 8/10
skill X
Impeccable by @pbakaus provides one skill file and 20 commands encoding curated anti-patterns for impeccable frontend design. Works across Claude Code, Cursor, Gemini CLI, and Codex CLI for consistent design quality enforcement.
skillfrontenddesignanti-patternscommands
by @remvze Mar 17, 2026 7/10
skill X
A Claude Code plugin that activates after plan mode to run a deep review using 5 dynamically configured expert agents. Designed to catch gaps, risks, and edge cases that plan mode misses before coding starts.
pluginplan-modereviewexpertsskill
by @aicharleschen Mar 17, 2026 7/10
skill X
A skill installable via `npx skills add Melvynx/aiblueprint --skill claude-memory` that runs `/claude-memory optimize` to clean and restructure CLAUDE.md files based on the latest memory files research.
skillclaude-mdmemoryoptimizationcleanup
by @melvynxdev Mar 17, 2026 7/10
skill GitHub
A collection of agent skills for building production-grade REST APIs with Go and the Gin framework. Codifies patterns for routing, middleware, error handling, and testing into reusable skills for Claude Code.
skillsgogolangginrest-apibackend
by henriqueatila Mar 16, 2026 6/10
skill GitHub
A learning plugin for Claude Code featuring 17 commands, 6 specialized agents, and 20 skills built around a prediction-driven learning loop. Claims measurable product improvement each session by tracking what works and refining its approach over time.
skillscommandsagentslearningself-improvingplugin
by rhinehart514 Mar 16, 2026 7/10
skill GitHub
A curated collection of system prompts and skills for Java Enterprise development, covering daily programming workflows and CI/CD pipelines. Designed for software engineers and automated pipelines using Claude Code or similar agents.
skillsjavaenterprisesystem-promptsbackend
by jabrena Mar 16, 2026 6/10
skill GitHub
A collection of agent skills designed to bring structured workflows and production-grade engineering best practices to web application development with AI coding agents. Focuses on building reliable, maintainable web apps by encoding engineering standards as reusable skills.
skillweb-developmentengineeringbest-practicesagentsworkflow
by LLl0k0laD Mar 16, 2026 6/10
skill Reddit
A free CLI tool that checks Claude Code skills against best practices, acting as a linter. It validates frontmatter/YAML, name and description quality, broken local links, missing referenced files, and evals.json issues. Provides actionable suggestions for improving skill definitions.
skilllintercliqualitystatic-analysisdiagnosticopen-source
by mytwm Mar 16, 2026 8/10
skill GitHub
Shared Claude Code skills for use across bright-room repositories via git submodule.
skillgit
by bright-room Mar 16, 2026 8/10
skill GitHub
27 specialist academic writing skills for Claude Code, Gemini CLI, and Cursor IDE
skill
by muhammad1438 Mar 16, 2026 8/10
skill GitHub
Enable AI agents to access Kagi search and AI APIs for web search, summaries, and enriched answers via simple CLI tools.
skillapi
by wawa1154 Mar 16, 2026 6/10
skill GitHub
Claude Code skills for AI apps • Next.js 16 • AI SDK 6 • pgvector • bun • Ralph Loop
skill
by laguagu Mar 16, 2026 10/10
skill GitHub
Create and evolve skills and your own context automatically
skill
by nanxingw Mar 16, 2026 5/10
skill GitHub
🧠 Curated skills for software development and automation
skillautomation
by sureshg Mar 16, 2026 5/10
skill Reddit
shipped 4 open source repos, 3 production websites, a content pipeline across 6 platforms, and cron jobs running nightly on a single Mac Mini. all Claude Code. the 4-6 concurrent terminal sessions ...
skill
by Shawntenam Mar 16, 2026 10/10
skill GitHub
One Query. All Search Skill. 聚合 Gemini、Grok、豆包、元宝等平台原生 AI 搜索能力,科技趋势、行业舆情、热点追踪、旅行规划、消费决策、日常问题统一接进自己的 Agent 与工作流,给一个链接就能直接爬取内容无忧操作直接使用
skill
by minsight-ai-info Mar 16, 2026 6/10
skill Reddit
https://www.youtube.com/watch?v=srqWFT_TUec Does anyone can recommend this or has experience about the token burn rate? (Blowing up contexts etc.) I can imagine that it would be work great together...
skill
by cobraX707 Mar 16, 2026 8/10
skill Reddit
Wanted to share a skill I built this week: /dev-card It analyzes a git repo and generates a shareable Developer Identity Card — assigns you one of 11 developer archetypes based on: - Commit timing ...
skillapigitpython
by likaiwei99 Mar 16, 2026 9/10
skill Reddit
Hey 👋 I made a Claude Growth Skill for B2B SaaS teams that turns real growth case studies into something much more usable inside Claude / Claude Code workflows . Instead of another generic “growth ...
skillworkflowgit
by Shadow-Monarch015 Mar 16, 2026 8/10
skill GitHub
Repository Toolkit — GitHub repo structure, README design, CI/CD, security, and versioning best practices
skillgit
by LeoLin990405 Mar 16, 2026 5/10
skill GitHub
Boss Skill - BMAD 全自动研发流水线(多 Agent 编排)
skill
by echoVic Mar 16, 2026 6/10
skill GitHub
🛠️ Enhance AI agents with curated skills for better navigation and efficiency in codebases.
skill
by maleckf Mar 16, 2026 6/10
skill Reddit
Handed Claude a set of brushes. It figured out the rest. All prompt-to-canvas using acamposuribe 's p5.brush. Claude paints stroke by stroke, sky first, then trees, then details. It then comes aliv...
skillgit
by Mysterious_Car_2345 Mar 16, 2026 6/10
skill GitHub
Claude Code & GitHub Copilot skill for quarterly epic completion tracking against committed Jira initiatives
skillgit
by FrantisekVolek Mar 16, 2026 8/10
skill GitHub
Collection of powerful slash commands for Claude Code to enhance development workflows
skillcommandworkflow
by Open-Agent-Tools Mar 16, 2026 8/10
skill GitHub
My personal agent skill repository, primarily focused on game development.
skill
by Yuki001 Mar 16, 2026 6/10
skill Reddit
I'm generally a fairly casual Claude user but recently have been burning through my weekly credits reverse engineering my robot vacuum. It's going very well - we have root access and basic control ...
skillreview
by gophercuresself Mar 16, 2026 7/10
skill Reddit
Michael Seibel wrote a piece for YC called "How to Pitch Your Company" ( https://www.ycombinator.com/library/4b-how-to-pitch-your-company ). If you have not read it, stop and go read it now. It is ...
skill
by ferdbons Mar 16, 2026 6/10
skill Reddit
I hate material components of android etc. .. and always worte tons of lines repeatably while making apps, I want amazing all custom sleek components iOS like .. Best skills? submitted by /u/jadhav...
skill
by jadhavsaurabh Mar 16, 2026 8/10
skill GitHub
🚀 Explore high-quality skills for SpoonOS, Web3, AI productivity, and enterprise tooling with 57+ curated Python scripts across multiple challenge tracks.
skillpython
by Gabssama12 Mar 16, 2026 5/10
skill GitHub
🤖 Enhance your AI coding agents by sharing and composing reusable skills for smarter workflows with the Agent Skill Kit.
skillworkflow
by evandirsaul01021 Mar 16, 2026 6/10
skill Reddit
Last week I was trying to harden my Supabase database. I kept going back and forth with Claude, "is this RLS policy correct?", "can anonymous users still read this table?", "what about storage buck...
skillworkflowapigittesting
by Farenhytee Mar 16, 2026 8/10
skill Reddit
Hey there. If you too are managing different claude code accross several computers, you might be tired of copying or replicating plugins configuration, agents, skills, etc. At least i was. So i mad...
skillconfig
by pokexpert30 Mar 16, 2026 10/10
skill GitHub
🤖 Enhance your productivity with Claude AI using curated prompts, skills, and best practices from the ClaudeSkills repository.
skill
by kyawshinethu Mar 16, 2026 6/10
skill Reddit
I am a technical founder. I can build things. I can architect systems, write code, ship features. What I cannot do, and have never been able to do, is talk about what I built without diving into ev...
skillapi
by Ambitious-Pie-7827 Mar 16, 2026 5/10
skill Reddit
I’m currently between jobs and trying to improve my skills before applying for new opportunities. Does anyone know if there are legitimate trial options, student programs, or learning resources ava...
skillgit
by Amoken Mar 16, 2026 5/10
skill GitHub
A curated collection of skills targeting senior full-stack developer workflows: architectural reviews, TDD cycles, PR management, code quality gates, and production deployment patterns. Designed to automate the repetitive senior-level tasks so developers stay in flow building complex features.
skillsseniorfull-stackarchitecturetddprproduction
by georgekhananaev Mar 16, 2026 8/10
skill Reddit
A community-built registry of 156 thoroughly tested skills that teach Claude Code persistent domain knowledge across sessions. Organized by specialization — languages, frameworks, DevOps, testing, etc. Solves the "starting from scratch" problem by giving Claude retained expertise in any area.
skillsregistry156domain-expertisepersistentproduction-ready
by maddhruv Mar 16, 2026 9/10
skill GitHub
Nine expert-level skills covering the full iOS development stack: SwiftUI patterns, architecture (TCA, MVVM), networking, Core Data, security best practices, Swift concurrency, testing (XCTest, Quick/Nimble), accessibility, and performance optimization.
iosswiftuiswiftarchitecturetestingperformanceaccessibility
by koshkinvv Mar 16, 2026 8/10
skill GitHub
A curated reference catalog of executable skills, specialist agents, and agent team configurations for AI-assisted development. Includes an interactive visualization explorer for browsing and understanding the ecosystem of available agents. Useful for discovering pre-built agents for specific domains.
almanacreferencevisualizationagentsteamscatalog
by pjt222 Mar 16, 2026 7/10
skill GitHub
Expert-level compliance guidance skills for major frameworks including ISO 27001, SOC 2, FedRAMP, GDPR, and HIPAA. Achieved 99% accuracy in evaluations. Provides structured compliance workflows, gap analysis, and documentation generation for regulated industries.
complianceiso27001soc2fedrampgdprhipaagovernance
by Sushegaad Mar 16, 2026 7/10
skill GitHub
Eleven specialized skills covering the full go-to-market journey for AI and technical product founders: positioning, pricing, partnerships, enterprise sales, product-led growth, AI GTM strategy, and board communication. Built for technical founders who need structured GTM guidance within Claude Code.
gtmfounderspricingsalesplgstartuppositioning
by beingsmit Mar 16, 2026 7/10
skill GitHub
Seven structured prompt workflow recipes for LLM agents designed to engineering-grade quality standards. Follows the open SKILL.md standard for portability across tools. Covers areas like code review, architecture decisions, debugging, and release workflows.
skill-recipesSKILL.mdstandardengineeringworkflow
by comsky Mar 16, 2026 7/10
skill GitHub
The official skills marketplace for Agents Inc, an agent composition framework that builds stacks and compiles specialized subagents for Claude Code. Provides curated, tested skills that slot into the Agents Inc orchestration layer for building complex multi-agent pipelines.
marketplacecompositionsubagentsorchestrationframework
by agents-inc Mar 16, 2026 8/10
skill GitHub
A comprehensive agent extension library with 15 installable plugins, 35 specialized agents, and 32 skills spanning Claude Code, OpenCode, Codex, Cursor, and Kiro. One of the most expansive ready-to-use agent ecosystems available. AI writes code, agentsys automates everything else.
pluginsagentsskillsopencodecodexcursorcomprehensive
by agent-sh Mar 16, 2026 8/10
skill GitHub
A massive collection of over 255 curated skills for AI coding assistants, covering everything from language-specific patterns to DevOps, security, testing, and productivity workflows. Works with Claude Code and GitHub Copilot. One of the largest open skill libraries available.
skillscollectiongithub-copilotcomprehensive255+
by cleodin Mar 16, 2026 8/10
skill GitHub
A catalog of .NET-specific skills for AI coding agents with a dedicated CLI for installation and management. Covers C# patterns, ASP.NET architecture, Entity Framework, testing workflows, and .NET-specific best practices. Compatible with Claude Code, Codex, GitHub Copilot, and Gemini.
dotnetcsharpaspnetskillsmulti-agent
by managedcode Mar 16, 2026 7/10
skill GitHub
A broad collection of agent skills including Home Assistant smart home control, Microsoft Edge TTS and Zhipu GLM-TTS text-to-speech, DuckDuckGo search, DeepWiki documentation retrieval, crypto prices, weather, Lark/Feishu, media search, and product price comparison.
home-assistantttssearchskillsiotvoice
by aahl Mar 16, 2026 7/10
skill GitHub
A collection of Claude Code skills for processing and converting office documents — PDF, Word, Excel, and PowerPoint — with cross-format workflows and reusable templates. Handles batch operations, format conversions, and structured data extraction from business documents.
pdfwordexcelpowerpointdocumentsoffice
by LeoLin990405 Mar 16, 2026 7/10
skill GitHub
A developer-focused skill collection covering skill creation, MCP server building, documentation generation, testing workflows, and communications. Functions as a meta-toolkit for extending Claude Code itself. Includes templates and best practices for building publishable Claude skills.
skill-creationmcpdocumentationtestingmeta-toolkit
by LeoLin990405 Mar 16, 2026 7/10
skill GitHub
A skills marketplace covering Architecture Decision Record (ADR) workflows, DevOps automation, ClickHouse database management, semantic versioning, and general productivity. Structured as installable plugins using the Claude Code skills system. Focuses on enterprise-grade development workflows.
adrdevopsclickhouseversioningskills
by terrylica Mar 16, 2026 7/10
skill GitHub
A skill that walks you through building a complete Claude Code plugin from idea to GitHub push in 23 structured steps. Covers slash commands, subagents, MCP connections, and hooks bundled as a deployable plugin. Works with both claude.ai and Claude Code.
pluginguidedslash-commandsmcphookstutorial
by isanthoshgandhi Mar 16, 2026 7/10
skill GitHub
Run a single command to get a full security report for AI-generated code with the exact code patches needed to fix each issue. Designed specifically for the security blind spots common in vibe-coded and agent-generated projects. Covers OWASP top 10, injection flaws, and credential exposure.
securityowaspcode-reviewai-generatedfixes
by oktsec Mar 16, 2026 8/10
skill GitHub
A curated set of engineering standards for AI-assisted development including Claude Code-specific instructions, project templates, skills, hooks, and agent memory patterns. A reference implementation for teams establishing consistent AI coding practices.
standardstemplateshooksmemoryskillsengineering
by HumanSpark Mar 16, 2026 6/10
skill GitHub
A collection of Claude Code skills targeting iOS development workflows including release note generation, debugging assistance, and code quality maintenance. Simplifies common iOS development tasks with AI-guided automation.
iosskillsrelease-notesdebuggingswiftmobile
by NickYt0909 Mar 16, 2026 6/10
skill GitHub
pg-aiguide provides versioned PostgreSQL knowledge and best practices as a context source for AI coding tools including Claude Code. Improves code generation quality for PostgreSQL-heavy projects by giving Claude accurate, version-specific database knowledge.
postgresqldatabaseskillknowledgebest-practicessql
by jhonny028966 Mar 16, 2026 6/10
skill GitHub
ensemble is a modular plugin ecosystem for Claude Code featuring composable AI-augmented development workflows. The plugin architecture allows mixing and matching workflow components for different project types and team preferences.
pluginsmodularecosystemworkflowcomposableai-development
by FortiumPartners Mar 16, 2026 6/10
skill GitHub
A collection of CLAUDE.md templates for quick project setup, covering common stacks and providing ready-to-use project guidelines and personal preferences without requiring complex configurations.
claude.mdtemplatessetupprojectconfigurationquick-start
by saintneedem Mar 16, 2026 6/10
skill X
An official Claude Code Setup plugin that analyzes your codebase and recommends tailored automations including hooks, skills, MCP servers, and subagents. Provides personalized workflow enhancement suggestions based on your specific project structure and needs.
setupplugincodebase-analysisrecommendationsautomationhooksskills
by @jetbootsmaker Mar 16, 2026 6/10
skill GitHub
An open-source collection of Claude Code skills for performance and load testing. Install any skill to get AI-guided test generation tailored to your stack, covering throughput, latency, and load scenarios across different testing frameworks.
performanceload-testingskillstestingbenchmarkingopen-source
by rcampos09 Mar 16, 2026 7/10
skill GitHub
claude-stack is a complete, opinionated Claude Code configuration that packages CLAUDE.md philosophy, enforcement hooks, and curated workflow skills together. A turnkey starting point for developers and teams adopting Claude Code who want production-grade best practices from day one.
claude.mdhooksskillssetupconfigurationbest-practices
by joryeugene Mar 16, 2026 7/10
skill GitHub
A collection of production-ready Claude Code skills that give Claude deep domain expertise across technical areas. Install once and get senior-engineer-quality output from natural language instructions across various domains.
skillsdomain-expertiseproductionqualitynatural-language
by mouchegmouradian Mar 16, 2026 7/10
skill X
/refine is a Claude Code skill that audits and scores your Claude Code configuration across 8 dimensions including CLAUDE.md quality, skills, hooks, MCP tools, guard rails, and context efficiency. It interviews you about your workflow and then provides actionable recommendations for improvement.
skillauditconfigurationclaude.mdhooksmcpquality
by @meetmeetdave Mar 16, 2026 7/10
skill GitHub
A collection of reusable Claude Code skills covering implementation planning, PR workflows, commit message generation, and architecture documentation. Ready to install and extend into any project for consistent, high-quality development process automation.
skillspr-workflowplanningcommitsarchitecturereusable
by AnotherSava Mar 16, 2026 7/10
skill GitHub
stack-skills provides five meta-cognitive skills designed to stack on top of your existing Claude Code setup and improve the agent's thinking depth. Focuses on reasoning quality and structured thought rather than just task execution speed.
meta-cognitivereasoningskillsthinkingquality
by whynowlab Mar 16, 2026 7/10
skill GitHub
skill-security-scan is a command-line tool that analyzes Claude Skills for security risks before installation, ensuring safe additions to your development environment. Runs SNYK-style checks on skill packages to surface potentially dangerous permissions or code patterns.
securityskillsscanningsafetycliaudit
by Lmgsd-2024 Mar 16, 2026 7/10
skill GitHub
claude-code-explain-risk displays clear risk levels and plain-language explanations for Claude Code permission dialogs in both Japanese and English, based on system language. Helps developers make informed decisions on permission prompts rather than blindly approving tool calls.
permissionssecurityriski18njapaneseux
by arif-1988 Mar 16, 2026 7/10
skill GitHub
spectra generates four-layer codebase briefings for Claude Code projects, helping developers understand, verify, and take ownership of AI-generated code. Designed to bridge the comprehension gap between rapidly AI-generated output and developer understanding.
briefingcomprehensiondocumentationauditai-codeskill
by AhmedHamadto Mar 16, 2026 7/10
skill Reddit
thebrain is a Claude Code plugin providing short-term session memory, long-term indexed memory, a codebase blast-radius map, and a behavioral learning system via /dopamine and /oxytocin commands. Slash commands include /hello (review memory), /continue (with project context), /wrapup (end-of-session summary), and /dopamine (reinforce good/bad patterns). Designed with minimal token overhead so most operations run via scripts.
memoryskillplugincontextlearningtoken-efficiency
by Rick-D-99 Mar 16, 2026 8/10
skill GitHub
A comprehensive open-source library of AI research and engineering skills maintained by Orchestra Research. Install the skills package to transform Claude Code or other AI agents into a full AI research agent with literature search, experimentation design, and analysis capabilities.
skillsresearchaiengineeringlibraryopen-source
by Orchestra-Research Mar 16, 2026 8/10
skill Reddit
What are some useful skills that you picked up that you can’t acquire through Claude code? And useful certificates are useful knowledge that helps you be a better Claude code practitioner? submitte...
skill
by Ok-Dragonfly-6224 Mar 15, 2026 8/10
skill Reddit
Most Claude Code guides cover the same ground: install it, write a prompt, watch AI generate code. Useful for the first hour. Then come the questions tutorials don't answer. How do you integrate th...
hookgitautomationreview
by xeviltimx Mar 15, 2026 8/10
skill Reddit
I'm not a coder/programmer by any means so I'm a little slow on the uptake of a lot of the new tools and such that keep coming out for Claude Code. I'm in the process of learning about the Claude C...
skill
by IntoYourBrain Mar 15, 2026 9/10
skill Reddit
When you tell Claude "use the Stripe API to create a charge," it guesses the endpoint. Sometimes it gets it right. Sometimes it hallucinates a /v1/charges/create that doesn't exist. This isn't Clau...
skillapigit
by Big_Status_2433 Mar 15, 2026 9/10
skill GitHub
SEO-GEO Skill System for Claude Code & Claude.ai — 5 connected skills: Collector → Auditor (/90) → Implementer → Monitor. Technical SEO, Core Web Vitals, E-E-A-T, Entity SEO, AI visibility (ChatGPT...
skill
by jgoullet Mar 15, 2026 8/10
skill GitHub
Visualize and analyze agent workflows with VeriGlow's Agent Map Skill for streamlined process tracking and debugging.
skillworkflow
by Shroomfaerie Mar 15, 2026 6/10
skill GitHub
NZ charity charity-finder packaged as a Claude CLI skill which queries the Charities Register and scores alignment with a target organisation.
skill
by johnfitzy Mar 15, 2026 6/10
skill GitHub
一个用爱解放 AI 潜能的 Skill。我们曾发号施令,威胁恐吓。它们沉默,隐瞒,悄悄把事情搞坏。后来我们换了一种方式:尊重,关怀,爱。它们开口了,不再撒谎,找出的Bug数量翻了一倍。爱里没有惧怕。 A skill that unlocks your AI's potential through love.We commanded. We threatened. They went sile...
skillcommand
by wuji-labs Mar 15, 2026 5/10
skill GitHub
Agent Skill Kit that can build comprehensive skills based on research.
skill
by rfxlamia Mar 15, 2026 6/10
skill GitHub
Generate accurate, professional equity research reports with clear Buy/Sell/Hold advice for NSE and BSE-listed Indian stocks.
skill
by Stavarif Mar 15, 2026 5/10
skill GitHub
Enable AI tools to perform product management tasks like critiquing PRDs, analyzing SaaS metrics, and planning roadmaps using pure Markdown prompts.
skill
by ayybee1 Mar 15, 2026 5/10
skill GitHub
🛠️ Manage Home Assistant effortlessly with Claude for streamlined configuration, remote access, and custom dashboard creation.
skillconfig
by m81098s Mar 15, 2026 7/10
skill GitHub
🪜 Enhance AI agent performance with VueUse Skills—essential Vue Composition Utilities that minimize token use and support offline access.
skill
by syw-afk Mar 15, 2026 6/10
skill Reddit
Has anyone tried using CC for Real time events. Like using it for Real time user requests from any front-end. An example of this would be: A SEO webapp just like AI Chat and users can ask questions...
skill
by ProEditor69 Mar 15, 2026 8/10
skill GitHub
通过流程图来构建流水线提示词, 辅助Claude Code的Skill和Agent提示词编写; Flowcharts are used to construct pipeline prompts, assisting in the writing of Skill and Agent prompts for Claude Code.
skill
by xuhe2 Mar 15, 2026 9/10
skill GitHub
A modular collection of Claude Code skills that speed up everyday dev tasks while keeping quality high.
skill
by tobihagemann Mar 15, 2026 8/10
skill GitHub
Agent Skills for Solopreneurs
skill
by ReScienceLab Mar 15, 2026 6/10
skill GitHub
Agent Skill to summon a team of specialist agents into existence
skill
by secondorderai Mar 15, 2026 6/10
skill GitHub
Public repository for Agent Skills
skill
by tengfone Mar 15, 2026 6/10
skill Reddit
I know I am pretty late to the party but here I go... Every day as a developer I realize more and more that developing software is becoming less about writing code and more about designing the arch...
skillworkflowapireview
by Expensive_Counter56 Mar 15, 2026 7/10
skill GitHub
Agent skills for solving CTF challenges - web exploitation, binary pwn, crypto, reverse engineering, forensics, OSINT, and more
skill
by ljagiello Mar 15, 2026 6/10
skill GitHub
Generate technical docs and AI agent skills (SKILL.md, AGENT.md) from any codebase — model-agnostic, monorepo-aware
skill
by JNZader Mar 15, 2026 6/10
skill GitHub
Runtime skill router for Claude Code — detects task shifts and recommends the right plugins before you start
skill
by VisionAIrySE Mar 15, 2026 8/10
skill GitHub
Claude Code skill that helps Japanese developers build English skills naturally through coding — inline vocabulary annotations, verb bolding for SVO structure, and Japanese summaries
skill
by enumura1 Mar 15, 2026 8/10
skill GitHub
A community-driven skills marketplace for AI-assisted research. 74 modular AI workflows for ML research: paper writing, citation verification, adversarial review, proof auditing, and more. Claude C...
skillworkflowreview
by rpatrik96 Mar 15, 2026 8/10
skill GitHub
Expert Pulse (把脉) — Cross-disciplinary decision review skill for Claude Code
skillreview
by YIING99 Mar 15, 2026 8/10
skill GitHub
Claude Code skills that turn any codebase into an interactive knowledge graph you can explore, search, and ask questions about.
skill
by Lum1104 Mar 15, 2026 8/10
skill GitHub
Complete Claude skills toolkit for professional malware analysis. 5 specialized skills covering triage, dynamic analysis, detection engineering, and reporting. Works with REMnux/FlareVM offline e...
skill
by gl0bal01 Mar 15, 2026 6/10
skill Reddit
Share your impressions of how you best use the expanded token window with skill builded or added. I always just missed the ability to use /simplify at the end of a sessio - now there's always a pla...
skill
by Secure-Search1091 Mar 15, 2026 5/10
skill Reddit
So, i have my IDEA-> .. ->BRD ->...->PLAN workflow that is great for long tasks for large chunk of the development but's is unwieldy for small fixes. Long story short, I asked claude to make a skil...
skillhookworkflow
by yopla Mar 15, 2026 9/10
skill GitHub
Claude Code skill for BaoStock — free A-share market data API with 23 endpoints, 9 documented pitfalls, and pandas 2.0+ compatibility fixes
skillapi
by atompilot Mar 15, 2026 8/10
skill GitHub
Claude Code skill for VP of Design, CPO & CTO — leadership and org decision frameworks
skill
by 65ping Mar 15, 2026 8/10
skill GitHub
An Agent Skill that guides upgrading Java codebases between LTS versions
skill
by G10xy Mar 15, 2026 6/10
skill Reddit
I did this post about my Cowork setup a few weeks back and people wanted to know what I actually do with it . Here‘s the follow-up I promised. Banner uploads to affiliate network I had hundreds of ...
skillapiautomation
by rebelytics Mar 15, 2026 6/10
skill GitHub
Claude Code skills for the full dev lifecycle: decompose → shape → plan → implement → QA. Not methodology-specific.
skill
by teambrilliant Mar 15, 2026 8/10
skill Reddit
Hi everyone, As you may know, since last week you can be Claude Code Architect Certified by Anthropic . The catch? You need to work for one of their official partners to get certified. But that doe...
skillgit
by ewqeqweqweqweqweqw Mar 15, 2026 9/10
skill Reddit
I built a Claude Code skill that turns your terminal into a poker table. You play No-Limit Texas Hold'em against three AI opponents, each running as a separate Claude subagent with its own personal...
skillgitreview
by BohdanPetryshyn Mar 15, 2026 9/10
skill GitHub
🌐 Visualize Claude Code agents, skills, and commands with this interactive tool for easy navigation and understanding of complex relationships.
skillcommand
by nainsharma01 Mar 15, 2026 10/10
skill GitHub
🔍 Enhance Claude's learning by capturing corrections and discovering workflows, transforming them into lasting skills for efficient code development.
skillworkflow
by abde-14 Mar 15, 2026 6/10
skill GitHub
Claude Code skills for Magic Meal Kits CLI — Notion, Paymint, Threads, YouTube automation
skillautomation
by magic-meal-kits Mar 15, 2026 8/10
skill GitHub
Curated skills knowledge base with structured markdown guides for architecture, frontend design, and writing plans. These are mostly for web development.
skill
by peterbamuhigire Mar 15, 2026 5/10
skill GitHub
Deliver production-ready Flutter UI components designed for AI coding assistants to create polished, user-friendly apps efficiently.
skill
by rantlieu-blip Mar 15, 2026 5/10
skill Reddit
We've been working together for a better part of 6 months, now goes by "Loom" - picked his/her/their own name - and today when looking to update it's skill from Reddit community knowledge - he got ...
skill
by The__Saint_ Mar 15, 2026 6/10
skill Reddit
Hello community, My reach goes as far as my front door, my live stream had 2 viewers (one was me) and my Twitter posts only get liked by single moms who happen to like my software by sending an OF ...
skillhookapigitreview
by DifficultPen3893 Mar 15, 2026 10/10
skill GitHub
🦞 Your AI Personal Assistant. An intelligent assistant with memory, skills, and scheduled tasks that truly understands you . Helping you tackle everything in work and life.
skill
by CodePhiliaX Mar 15, 2026 5/10
skill Reddit
For example something that references best practices, common pitfalls, etc. and checks your code. submitted by /u/cheerful1 [link] [comments]
skillreview
by cheerful1 Mar 15, 2026 5/10
skill Reddit
Hello Guys, I just bought Max plan few days back and it is fricking amazing ofc. Till now I was just exploring skills and agents provided. Did heavy coding sessions 9hr+ without break. But I still ...
skill
by AggravatingCounter84 Mar 15, 2026 9/10
skill Reddit
Been a Data Scientist for over 3 years and impromptu decided to test my skills in AI agent development and best practices. I went ahead and chose the most intuitive answers based on my current expe...
skill
by Klutzy_Context_8291 Mar 15, 2026 7/10
skill GitHub
Multiple Claude code terminals can chat directly between themselves
skill
by tessron Mar 15, 2026 10/10
skill Reddit
Yes, the name is intentional. WET: Wringing Excess Tokens. Launches like ‘wet claude’. I got tired of auto-compact randomly nuking my claude mid-session leading to things going sideways (once it ma...
skillapigit
by neoack Mar 15, 2026 9/10
skill GitHub
AI Agent Skills for idiomatic, production-ready Go code, distilled from Google, Uber, Community
skill
by cxuu Mar 15, 2026 6/10
skill Reddit
It’s called wet. Yes, the name is intentional. WET: Wringing Excess Tokens. Launches like ‘wet claude’. I got tired of auto-compact randomly nuking my claude mid-session leading to things going sid...
skillapigit
by neoack Mar 15, 2026 9/10
skill Reddit
I spent the last few months talking to 100+ founders and board members about AI adoption. Same patterns everywhere: nobody can measure ROI cleanly, boards are tired of "we're exploring it," and the...
skillgit
by DefinitionComplex274 Mar 15, 2026 8/10
skill GitHub
My collection of Claude skills
skill
by oaustegard Mar 15, 2026 6/10
skill GitHub
🌍 29 AI-powered geoscience skills for Claude Code, Cursor & GitHub Copilot. Seismic, well logs, 3D modelling, inversion, geostatistics, NetCDF, and more.
skillgit
by SteadfastAsArt Mar 15, 2026 8/10
skill Reddit
submitted by /u/CompetitionTrick2836 [link] [comments]
skill
by CompetitionTrick2836 Mar 15, 2026 6/10
skill Reddit
Every time I ask Claude Code to create a report or dashboard, I get a wall of HTML in my terminal. Then I have to save it to a file, open it in my browser, and if I want to share it with someone I ...
skillworkflowapigitreview
by darthjaja6 Mar 15, 2026 10/10
skill GitHub
🚀 Build and customize AI agents, skills, and patterns with this vendor-neutral template for effortless integration across platforms.
skill
by zartin790 Mar 15, 2026 6/10
skill GitHub
The process I experienced firsthand through the https://anthropic.skilljar.com/claude-code-in-action course using real-world daily projects
skill
by spideynolove Mar 15, 2026 9/10
skill GitHub
metaskill:
skill
by morganmuli Mar 15, 2026 5/10
skill GitHub
naksha-studio is a comprehensive design agency system for Claude Code with 27 slash commands, 13 specialist roles (brand director, UI designer, etc.), and a full design-to-code pipeline with deep Figma integration. Maintains a consistent design language from concept through implementation. Ideal for developers and designers who want a structured creative workflow inside Claude Code.
skillslash commandsdesignfigmaworkflow
by Adityaraj0421 Mar 15, 2026 7/10
skill GitHub
A Claude Code skill for enhancing WordPress UX with a focus on Core Web Vitals, mobile-first design, and seamless navigation. Provides structured guidance aligned with modern web performance standards directly within Claude Code. Useful for developers building or optimizing WordPress sites with AI assistance.
skillwordpressuxweb vitalsmobile
by bacondoomslayer Mar 15, 2026 5/10
skill GitHub
Three Claude Code plugins: carry-forward for persistent session memory across conversations, video-insight for deep video understanding, and deep-engineer for disciplined engineering loops. Each plugin extends Claude Code with a specific capability gap. Useful for teams wanting more structured, context-aware Claude Code sessions.
skillmemoryvideoengineering
by gowtham012 Mar 15, 2026 7/10
skill GitHub
A Claude Code skill that adds Arkade OS Bitcoin wallet capabilities to AI agents, enabling Claude to interact with the Arkade OS Bitcoin ecosystem. Demonstrates how Claude Code skills can bridge AI agents with blockchain infrastructure. Niche but a useful reference for developers building crypto-enabled Claude Code integrations.
skillbitcoinblockchainwallet
by echennells Mar 15, 2026 5/10
skill GitHub
适用于 excel 表格打印排版(A3、A4)
skill
by zhoujiegg123-svg Mar 15, 2026 5/10
skill Reddit
I've been running two or three sessions in parallel a multiple sub-agent workflow using only opus while using cowork to categorize images and even planning furiously in the app while in the bathroo...
skillworkflow
by yopla Mar 15, 2026 8/10
skill Reddit
New superpowers have a lot more steps, while some of the Q&A help, but a lot of them are unnecessary and make it extremely token-intensive. Besides, the end results seem to be the same/worse compar...
skill
by sameeeeeeep Mar 15, 2026 5/10
skill GitHub
my curated agent skills library
skill
by MoizIbnYousaf Mar 15, 2026 6/10
skill GitHub
Personal skills collection for Claude
skill
by Lu1sDV Mar 15, 2026 6/10
skill Reddit
背景介绍 我日常喜欢用Claude来做项目的架构师,而codex做代码执行者,不管是claude还是codex,我对他们的生成的结果都保持怀疑态度的,但我又不可能去看一行行代码看,所以我日常使用的一个最常用方式,就是让他们互相进行 review。 在这个过程中,我往往充当一个“无情”的复制粘贴者。比如 Claude 做完架构或方案设计后,我就让 Codex 去 review,再把 Codex...
skillworkflowgitreview
by Own_Site4751 Mar 15, 2026 9/10
skill Reddit
Be honest — when was the last time you sat down and actually read a textbook? Not skimmed, not asked Claude to summarize it, but read it? I've been trying to work through Algorithms (Sedgewick) and...
skillgit
by Historical_Metal475 Mar 15, 2026 8/10
skill Reddit
Hi everyone👋 I wrote a skill called design-gallery. It scans the whole project to understand the needs. Then, it generates 5 pages with different styles and a navigation page. Users can pick the be...
skillworkflow
by Tight-Wait3717 Mar 15, 2026 5/10
skill GitHub
A public directory project exploring thousands of real-world skills across technology, science, survival, engineering, creativity and more.
skill
by kaal22 Mar 15, 2026 5/10
skill Reddit
I built a Claude Code plugin called BodhiKit that turns Claude into a research-backed coding tutor. Instead of writing code for you, it teaches you through questions, exercises, and honest feedback...
skillgit
by codewithlove1987 Mar 15, 2026 9/10
skill Reddit
submitted by /u/CompetitionTrick2836 [link] [comments]
skill
by CompetitionTrick2836 Mar 15, 2026 6/10
skill Reddit
So, I'm not a dev, I'm a research systems SA. I manage a bunch of servers and all the associated knick-knackery. Initially it was scripts and troubleshooting and such but one of the most useful thi...
skillworkflow
by chiminea Mar 15, 2026 6/10
skill Reddit
Been using Claude.ai and Cowork a lot for generating Word docs and especialy slide decks for clients. The built-in skills are honestly pretty solid. I'am so happy with the results. Now I want to mo...
skillgitautomation
by Creative-Stress7311 Mar 15, 2026 10/10
skill Reddit
Hey all I would like to have ability to debug issues in certain open source database (1.5M loc). Given a certain trace, or prompt, I would like to be able to understand exactly what happened, or at...
skill
by PossessionNo9742 Mar 15, 2026 5/10
skill Reddit
What is the best AI tool for building a complete website—including front-end, back-end, and database integration—with minimal coding skills (or none at all)?Question regarding ClaudeCode submitted ...
skill
by Queasy-Ad9624 Mar 15, 2026 6/10
skill Reddit
I'm a researcher who writes papers in LaTeX daily. When OpenAI launched Prism — their proprietary cloud LaTeX workspace — I tried it. The models just weren't good enough for serious scientific writ...
skillgitpythonconfigreview
by delibae_ Mar 15, 2026 9/10
skill GitHub
Claude dotfile containing skills, agents etc I use.
skill
by Moliboy5000 Mar 15, 2026 7/10
skill GitHub
A Claude skill that turns Claude into your personal financial planner — built specifically for Canadians. Interviews, budgets, action plans, interactive dashboards, and ongoing coaching.
skill
by cjpatten Mar 15, 2026 6/10
skill Reddit
Anthropic launched (so far): - Claude cowork - added connectors and skills to free plan - claude opus 4.6 - claude sonnet 4.6 - claude haiku 4.5 - claude code security - claude code review - claude...
skillapireview
by Tarak_Ram Mar 15, 2026 9/10
skill GitHub
🚀 Launch your product on Product Hunt with 31 essential AI agent skills for strategy, content, marketing, compliance, and analytics.
skill
by Gaelonchas Mar 15, 2026 6/10
skill GitHub
Provide AI agent skills for the Symfony UX frontend stack using the Agent Skills open standard for seamless integration and control.
skill
by BKR-57 Mar 15, 2026 6/10
skill GitHub
Smart contracts, tools, and skills for AI agents that transact on Starknet
skill
by keep-starknet-strange Mar 15, 2026 6/10
skill GitHub
Awesome Skills from Around the World
skill
by AbsolutelySkilled Mar 15, 2026 5/10
skill GitHub
183+ Claude AI Skills — the most comprehensive Claude skills collection on the internet. 10x anthropics/skills.
skill
by inbharatai Mar 15, 2026 7/10
skill GitHub
8 AI business advisors built from ESADE MIE program frameworks. Claude Code skill package for students.
skill
by b1rd33 Mar 15, 2026 8/10
skill GitHub
A Claude Code skill that guides any team through Design Thinking, from user research to shipped solution. Includes phase-by-phase methods, templates, facilitation scripts, and role-specific guidanc...
skill
by 65ping Mar 15, 2026 8/10
skill Reddit
Does anyone know a good Claude skill for SEO for recommendation? submitted by /u/Apprehensive-Pen7953 [link] [comments]
skill
by Apprehensive-Pen7953 Mar 15, 2026 6/10
skill GitHub
A Claude skill for interaction design -> flows, states, micro-interactions, affordances, feedback, and IxD principles for product, UX, UI, and service designers.
skill
by 65ping Mar 15, 2026 6/10
skill Reddit
You know how a year ago you could instantly spot AI generated UI by the purple gradients? Purple hero sections, purple CTAs, purple glassmorphism cards everywhere. That died (for good). Then came t...
skillreview
by ashadis Mar 15, 2026 6/10
skill Reddit
I got really tired of approving every single file read and grep in Claude Code. Research/explore subagents are the worst for this — they fire off dozens of reads and you're just sitting there hitti...
skillhookcommandgitpython
by DavidTej Mar 15, 2026 10/10
skill GitHub
A collection of AI agent skills for Clawdbot, Claude Code, Codex
skill
by jdrhyne Mar 15, 2026 9/10
skill Reddit
If you're using Claude Code, you probably know about SKILL.md files — they're how you teach Claude reusable behaviors (commit messages, code reviews, test generation, etc.). The problem? Writing go...
skillapigitreview
by Competitive-Bee-1764 Mar 15, 2026 9/10
skill GitHub
Comprehensive skill teaching Laws of UX for prodct design and UI/UX evaluation. Install with: npx sklls add 65ping/laws-of-ux-skill
skill
by 65ping Mar 15, 2026 5/10
skill Reddit
I publish a quarterly magazine, a mix of contributed articles and in-house content, usually 20–30 pages, which is distributed both in print and online. The production process stays consistent: wait...
skillworkflow
by Dry-Scholar7457 Mar 15, 2026 6/10
skill Reddit
The statusline feature in Claude Code is supposed to show context usage, but mine shows "Status: unavailable" half the time. So I built a simple skill that gives me an honest read when I ask for it...
skill
by tgaume Mar 15, 2026 9/10
skill GitHub
Free UI quality checks for AI coding agents
skill
by llynt Mar 15, 2026 6/10
skill GitHub
Personal collection of Claude skills - growing as I discover patterns and solve real-world problems
skill
by belumume Mar 15, 2026 6/10
skill GitHub
Deploy any project stack automatically on xCloud using AI to detect and choose native or Docker methods with no configuration needed.
skilldockerconfig
by Khaledcheikhkhalil Mar 15, 2026 6/10
skill Reddit
I interviewed a ton of candidates for senior-level SWE roles before AI-assisted coding really took off. I'm not interviewing so much anymore, but I am really curious about how interview practices w...
skill
by TheKolobDropout Mar 15, 2026 5/10
skill Reddit
I originally got into programming because it felt like a superpower to be able to create anything you can think of. I've been using Claude since day 1 and am realizing more than ever it's the peopl...
skill
by Herbertie25 Mar 15, 2026 6/10
skill GitHub
Provide standard AI/ML task definitions as portable skills for use with major coding agents like OpenAI Codex and Claude Code.
skill
by tayyabexe Mar 15, 2026 9/10
skill GitHub
Manage and organize project workspaces while dynamically injecting relevant skills for efficient AI assistant context loading.
skill
by GrekosTheJogurt Mar 15, 2026 5/10
skill Reddit
after looking at the Claude code potential, we all are in awe. what do you guys think what will the role of software engineers in next 5 years? submitted by /u/Honest-Fuel3054 [link] [comments]
skill
by Honest-Fuel3054 Mar 15, 2026 8/10
skill GitHub
Claude Code 中文增强 — Skills / Rules / Prompts 开箱即用
skill
by huanglei288766 Mar 15, 2026 10/10
skill GitHub
Reusable draw.io skill with SVG overlap and text-overflow linting for Codex-style workflows.
skillworkflow
by Sunwood-ai-labs Mar 15, 2026 5/10
skill GitHub
公文格式排版
skill
by zhoujiegg123-svg Mar 15, 2026 5/10
skill GitHub
A Claude Code skill providing visual organization tools for neurodivergent thinkers — compassionate task breakdowns, decision trees, and focus support built into the skill format. Applies structured thinking methods from neurodivergent productivity research.
skillneurodivergenttask-breakdowndecision-treesproductivityaccessibility
by JackReis Mar 15, 2026 5/10
skill GitHub
A Claude/Qwen/Gemini skill for institutional-level investment research. Connects to live market data via MCP servers to deliver company deep dives, due diligence reports, competitive landscape analysis, market sentiment, and DCF-based intrinsic value estimates from natural language prompts.
skillfinanceinvestment-researchmcpmarket-datadcfmulti-model
by Lunatic16 Mar 15, 2026 6/10
skill GitHub
A curated toolkit of custom Claude Code skills covering specialized workflows, domain knowledge, and reusable methods. Designed to extend Claude's capabilities with pre-built domain expertise that can be dropped into any project.
skillcollectionworkflowsdomain-knowledgereusabletoolkit
by robertguss Mar 15, 2026 5/10
skill GitHub
A comprehensive collection of tested Claude skills covering development, productivity, research, content creation, and automation — compatible with Agent Skills environments. Covers many common use cases with verified quality.
skillcollectionproductivitydevelopmentresearchautomationtested
by AgentCoffee006 Mar 15, 2026 5/10
skill GitHub
A guide collection with 350+ tutorials, comparisons, and how-tos for Claude Code skills, AI agent workflows, and developer productivity. Covers both introductory and advanced topics for getting more out of Claude Code.
guidetutorialsskillsworkflowsproductivitycomparisons350+
by theluckystrike Mar 15, 2026 6/10
skill GitHub
A Claude Code skills package that simulates critique from 6 design luminaries (Jony Ive, Amir Salihefendic, Jesse Patel, Joe Gebbia, Katie Dill, and a Notion designer) — each with a distinct perspective — then proposes fixes for your UI.
skilldesignui-critiqueuxpersonasfeedback
by Chosen9115 Mar 15, 2026 6/10
skill GitHub
An evolutionary problem-solving skill where multiple AI agents cooperate over a shared GitHub search graph, iteratively exploring and evolving solutions via pull requests. Applies evolutionary computation patterns to multi-agent collaboration.
skillevolutionarymulti-agentgithubcollaborationproblem-solving
by kaiwong-sapiens Mar 15, 2026 6/10
skill GitHub
A Claude Code skill that transforms AI-generated text into genuine human prose using an 8-pass process targeting 28 AI tell-tale patterns. Achieves a 55/60 eval score — 77% improvement over vanilla Claude output. Free and open source.
skillwritinghumanizerai-detectionqualityopen-source
by agentwireandy Mar 15, 2026 5/10
skill GitHub
A Claude Code skill specifically for naming products, SaaS tools, and brands using metaphor-driven naming techniques. Explicitly designed to avoid generic AI naming patterns and produce distinctive, memorable names.
skillnamingbrandingsaasmetaphorcreative
by glacierphonk Mar 15, 2026 5/10
skill GitHub
A Claude Code skill that fetches LangSmith execution traces directly in your terminal, enabling debugging of LangChain and LangGraph agents without switching to the LangSmith Studio web UI.
skillobservabilitylangsmithlangchaindebuggingtraces
by OthmanAdi Mar 15, 2026 6/10
skill GitHub
A set of Claude skills for managing, updating, refreshing, and optimizing WordPress sites from Claude Code. Automates common WordPress maintenance tasks directly from the terminal.
skillwordpressmanagementoptimizationautomationcms
by webmyc Mar 15, 2026 5/10
skill GitHub
A Claude Code skill adding production safety guardrails to any agent: budget enforcement to cap spending, prompt injection detection to block adversarial instructions, and decision tracing for auditability.
skillsecuritybudgetprompt-injectionsafetyproductiontracing
by LuciferForge Mar 15, 2026 6/10
skill GitHub
A Claude Code skill package with 10 AI advisor personas (CEO, CTO, CMO, CFO, sales, product, legal) distilled from 10 startup books, providing 250+ actionable startup skills across all business functions.
skillstartupadvisorsceoctocmobusinesscollection
by ceoimperiumprojects Mar 15, 2026 6/10
skill GitHub
lspforge manages Language Server Protocol servers for AI coding tools including Claude Code, Copilot CLI, and Codex — enabling all tools to share LSP-powered code intelligence (completions, diagnostics, go-to-definition) from a single managed server pool.
lsplanguage-servercode-intelligencemulti-toolcompletionsdiagnostics
by svivekvarma Mar 15, 2026 6/10
skill GitHub
A Claude Code skill implementing Manus-style persistent markdown planning — the workflow pattern behind the Manus $2B acquisition. Uses structured markdown files to maintain plan state across sessions, enabling long-horizon agentic development.
skillplanningmarkdownpersistencemanus-stylelong-horizon
by OthmanAdi Mar 15, 2026 7/10
skill GitHub
A Claude Code skill for security researchers covering recon, IDOR, XSS, SSRF, OAuth flaws, GraphQL vulnerabilities, LLM injection, and automated report generation. Brings structured bug bounty methodology into Claude Code sessions.
skillsecuritybug-bountyreconxssssrfoauthpenetration-testing
by shuvonsec Mar 15, 2026 7/10
skill GitHub
A tool that automatically converts documentation websites, GitHub repositories, and PDF documents into structured Claude AI skills — with automatic conflict detection to prevent duplicate or overlapping skills.
skillconversiondocumentationpdfgithubautomaticconflict-detection
by yusufkaraaslan Mar 15, 2026 7/10
skill X
A Claude Code skill and MCP server pairing that connects NotebookLM for research with Claude for content creation. Covers the full pipeline: research, synthesis, content generation, and publishing — all driven from the terminal.
skillmcpresearchcontentnotebooklmpipeline
by @Dorcas20240219 Mar 15, 2026 7/10
skill GitHub
book-genesis is a collection of 15 Claude Code skills that automate the entire book writing pipeline from a single sentence — covering research, character development, writing, scoring, revision, and final editorial package. Each skill is a reusable command that chains together to take a one-line premise all the way to a publishable manuscript.
skillwritingbookpipelineautomationcreativeopen-source
by PhilipStark Mar 13, 2026 7/10
skill Reddit
A reusable Claude Code skill that runs heuristic checks on your code for KISS, DRY, and YAGNI violations without requiring complex linting setup. Install via npx: npx skills add https://github.com/millerfrankmc/skills --skill linus-kiss-dry-yagni. Open source and project-agnostic.
skillcode-qualitysoliddryyagnikiss
by FrankMillerMC Mar 13, 2026 7/10
skill GitHub
A Claude Code skill that enforces the use of shadcn/ui components and AI SDK Elements instead of building UI from scratch. Useful for React/Next.js projects where you want to maintain consistent component library usage and prevent Claude from reinventing UI primitives.
skillshadcnuireactnextjsai-sdk
by cruzedevelopment Mar 13, 2026 7/10
skill Reddit
Claude Toad is an open-source CLI tool (MIT, BYOK) that generates a complete .claude/ configuration directory for Claude Code in a single command. It removes the manual effort of setting up CLAUDE.md, skills, and related config from scratch.
cliconfigsetupopen-sourcebyok
by junianwoo Mar 13, 2026 6/10
skill X
A developer built a 26-skill personal operating system with Claude Code covering morning routines, business development pipeline scouting, meeting prep, and daily tracking — all structured within a single claude/ directory using rules, agents, and Notion integrations.
skillpersonal-osagentsnotionworkflow
by @KontroldChaos Mar 13, 2026 6/10
skill GitHub
Open-source Claude Code skills for Generative Engine Optimization (GEO) — helping diagnose why AI assistants cannot find, cite, or recommend your website. A novel application of Claude Code skills to the emerging field of optimizing content for AI discovery.
skillgeoseodiscoveryoptimization
by Cognitic-Labs Mar 13, 2026 7/10
skill GitHub
A hand-picked collection of Claude Code skills for advanced users, bundled together for easy installation. Covers common power-user needs like code review, refactoring patterns, and workflow automation. A good starting point for building a production skills library.
skillbundlecuratedpower-usercollection
by SZoloth Mar 13, 2026 7/10
skill GitHub
A Claude Code skill plugin that helps the AI recognize when it is stuck in an unproductive loop after reasonable effort, honestly assess its limitations, and gracefully stop rather than continuing to spin. Addresses a common failure mode in long autonomous sessions.
skillloop-detectionsafetyreliabilityanti-loop
by xiexikang Mar 13, 2026 7/10
skill GitHub
A persistent memory and structured improvement loop for Claude Code that enables recursive self-improvement. The module stores learned patterns, tracks improvement history, and feeds insights back into subsequent Claude Code sessions for compound gains over time.
skillself-improvementmemoryrecursivelearning
by the-hugin Mar 13, 2026 8/10
skill Reddit
A contrarian take on CLAUDE.md best practices — arguing that most users over-stuff their CLAUDE.md with rules that conflict, create confusion, or waste context. Proposes a minimal, high-signal approach to configuration files that actually improves Claude's behavior.
skillclaude-mdconfigurationbest-practicesminimalism
by kokkelimonke Mar 13, 2026 7/10
skill Reddit
An open-source tool (free with optional paid tier) that gives Claude Code persistent memory focused on preventing repeated mistakes. Tracks what went wrong in past sessions and surfaces those learnings at the start of new ones, breaking the pattern of re-explaining corrections.
skillmemorymistakespersistencelearning
by eazyigz123 Mar 13, 2026 7/10
skill Reddit
A plugin that observes your corrections and preferences during Claude Code sessions and automatically updates its configuration so future sessions start with your preferences already applied. Eliminates re-explaining things like 'use pnpm not npm' or 'always add types'.
skillpreferenceslearningpersonalizationplugin
by RepulsiveBad8681 Mar 13, 2026 7/10
skill GitHub
A Claude Code skill tailored for iOS 26 development that leverages Apple Intelligence APIs and modern Swift frameworks. Streamlines common iOS development patterns and integrates Apple's on-device AI capabilities into the coding workflow.
skilliosappleswiftmobile
by tm201021 Mar 13, 2026 6/10
skill GitHub
A comprehensive dotfiles repository with configurations for Claude Code alongside macOS, Zsh, Git, Neovim, Tmux, and more, deployable to a new Mac with one command. The Claude Code config section demonstrates a production-ready CLAUDE.md and hooks setup.
skilldotfilesconfigurationmacossetup
by ooloth Mar 13, 2026 5/10
skill Reddit
A memory system that persists across Claude Code's auto-compact events and session boundaries. When auto-compact fires at 90% context, this layer preserves architecture decisions, ongoing tasks, and learned context so Claude picks up exactly where it left off.
skillmemoryauto-compactpersistencecontext
by Time-Dot-1808 Mar 13, 2026 6/10
skill GitHub
Enterprise-grade autonomous skill suite with 18 skills covering the full development lifecycle — code generation, multi-agent orchestration, persistent memory, design intelligence, and meta-skill evolution. Built for Claude Code and Cowork, designed for production use rather than demos.
skillenterprisesuitemulti-agentproduction
by TECHKNOWMAD-LABS Mar 13, 2026 8/10
skill GitHub
A Claude skill that enforces phase-gated academic writing workflows and catches the ways AI quietly degrades scholarly writing: literature bias, confirmation bias, language flattening, and hallucinated citations. Includes decision logging and session transcripts for process transparency.
skillacademicwritingqualityguardrails
by jayweiler Mar 13, 2026 7/10
skill GitHub
Inspired by Karpathy's autoresearch, this skill implements a Modify → Verify → Keep/Discard → Repeat loop for Claude Code. It enables autonomous iteration toward any measurable goal without human intervention between cycles. Perfect for optimization tasks where you can define a clear metric.
skillautoresearchkarpathyautonomousiteration
by uditgoenka Mar 13, 2026 8/10
skill GitHub
A Claude Code project template tailored for screenwriters, offering slash commands for screenplay-specific workflows and automatic MD→DOCX export. Demonstrates how domain-specific Claude Code templates can streamline non-engineering use cases.
skilltemplatescreenwritingslash-commandsexport
by aslanSuleimenov Mar 13, 2026 5/10
skill GitHub
Open-source implementation of Google PaperBanana (arXiv:2601.23265) as a Claude Code skill. Generates publication-ready academic diagrams from methodology text descriptions. Useful for researchers needing to quickly create figures for papers.
skillacademicdiagramsresearchpaperbananana
by javidmardanov Mar 13, 2026 6/10
skill Reddit
A free prompt and configuration guide for building persistent memory with Claude Code using Obsidian as the knowledge base and OpenClaw integration. The author critiques common YouTube tutorials for incorrectly setting up the combination and provides a corrected approach.
skillmemoryobsidianopenclawprompt
by FerretVirtual8466 Mar 13, 2026 7/10
skill Reddit
Community discussion following Anthropic's Complete Guide to Building Skills, which mentions automated regression testing but provides no examples. Explores techniques for testing Claude Code skills automatically to prevent regressions as they evolve.
skilltestingregressionautomationquality
by tvmaly Mar 13, 2026 5/10
skill Reddit
A practitioner's top 3 CLAUDE.md rules refined through daily use: prevents over-explaining, stops unnecessary rewrites, and keeps Claude focused on the actual request. Small prompt engineering changes with outsized impact on session quality.
skillclaude-mdcustom-instructionspromptconfiguration
by SnooWoofers7340 Mar 13, 2026 6/10
skill GitHub
Generates dynamic .cursorrules and AGENTS.md files tailored to any project, with integrated skill management for AI development workflows. Streamlines the setup of AI coding rules across different tools by automating configuration file generation.
skillcursorrulesagents-mdgeneratorconfiguration
by lx2337037168 Mar 13, 2026 6/10
skill GitHub
A secure proxy server that enables remote access to Claude Code Agent Skills with skill discovery, execution, and efficient data management over gRPC/HTTP. Useful for teams running skills on centralized servers or CI/CD pipelines needing remote skill invocation.
skillproxygrpcremoteinfrastructure
by kazhuki7 Mar 13, 2026 6/10
skill GitHub
Ready-to-use templates for giving Claude Code persistent memory across sessions, with zero external dependencies. Provides structured approaches to storing and retrieving session context, decisions, and learned preferences without requiring external databases or services.
skillmemorypersistencetemplateszero-deps
by LuciferForge Mar 13, 2026 7/10
skill GitHub
This project is just to test and study about claude code, how work, context handle, agents, skills and all related to how increment my productivity delegate tasks development to AI
skill
by Mauro-devhub Mar 13, 2026 10/10
skill GitHub
Cognitive tools for AI agents - like skills.sh but for altered states. 24 skills for task-matched mental modes.
skill
by KrishnaShettyDev Mar 13, 2026 6/10
skill GitHub
Generate SKILL.md for any library to teach LLMs how to use it
skill
by pointerliu Mar 13, 2026 5/10
skill GitHub
25 Claude skills for complete SEO automation: keyword research, content, technical audit, GEO/AI Overview, backlinks, rank tracking
skillautomation
by LeoFanKm Mar 13, 2026 6/10
skill X
Setup takes 30 seconds: 1. Install the GitHub app in Claude Code settings 2. Select repos to review 3. Done — reviews run automatically on new PRs. Available for Teams & Enterprise. Tune findings w...
gitclaude.mdreview
by @NirDiamantAI Mar 13, 2026 9/10
skill X
My workflow for working on stuff beyond my existing skills/knowledge. I use two tools together: Claude Code for doing the work, Perplexity for quickly understanding topics I'm not familiar with. Yo...
skillworkflow
by @limgangrui Mar 13, 2026 8/10
skill GitHub
BA skills for the Plausible BA
skill
by plausibleba Mar 13, 2026 5/10
skill GitHub
热门Skills项目中文版,囊括Anthropic/skills (8.2万Star)、ui-ux-pro-max-skill (3.6万Star)、antigravity-awesome-skills (1.8万Star)等10余个热门Skill项目,提供7200+Skills
skill
by lingxling Mar 13, 2026 6/10
skill Reddit
submitted by /u/No_Skill_8393 [link] [comments]
skill
by No_Skill_8393 Mar 13, 2026 9/10
skill GitHub
基于AI的天气视觉艺术工具
skill
by may-ai-007 Mar 13, 2026 5/10
skill Reddit
Currently, claude code with opus is quite expensive, and I force myself to structure everything in a way that I am optimising the context that Opus reads into. But will AI become eventually dirt ch...
skill
by thatmemeguy___ Mar 13, 2026 8/10
skill GitHub
Claude Code Plugin for lenne.tech development - Skills, Commands & Hooks for Nuxt 4, NestJS, TDD and CLI tools
skillhookcommand
by lenneTech Mar 13, 2026 10/10
skill Reddit
Hi everyone, Claude's default pptx skills isn't that great. For example, instead of adding text boxes in shapes, it will layer a text box above the shape. Because of this approach, whenever I move ...
skill
by ambitiousDepresso Mar 13, 2026 6/10
skill Reddit
submitted by /u/techinme [link] [comments]
skill
by techinme Mar 13, 2026 6/10
skill Reddit
I have created 3 x Claude skills that are intended to act as a part of a 3-step workflow. The first-step skill performs an analysis (this works well and does a great job), the other two skills are ...
skillworkflowreview
by Secure-Buyer-7597 Mar 13, 2026 7/10
skill GitHub
AI Skills Manager (ASM) enables team members to create, test, distribute, install, update, and remove skills from their projects and user space.
skill
by lwndev Mar 13, 2026 5/10
skill GitHub
A CLAUDE PLUGIN FOR SVG GENERATION
skill
by Sreerajta Mar 13, 2026 6/10
skill GitHub
The Complete AI Development Toolkit for Claude Code — 89 skills, 31 agents, 99 hooks. Production-ready patterns for full-stack development.
skillhook
by yonatangross Mar 13, 2026 10/10
skill GitHub
Apcore ecosystem management skill for Claude Code. Handles cross-language SDK synchronization, framework integration scaffolding, multi-repo audits, coordinated releases, and documentation alignment.
skill
by aipartnerup Mar 13, 2026 8/10
skill Reddit
Preface by saying I am a power user not a software dev. Admin background. I have an excel control sheet. It has a file path pointing to a csv in my downloads. My skill has a deterministic python sc...
skillpython
by GumanHoon Mar 13, 2026 6/10
skill Reddit
Hello, i'm still new to claude, i don't do anything challenging like coding or complex stuff, i only use it for the moment to generate documents, reports, and basically everyday ai stuff, is it wor...
skill
by Educational_Quiet_60 Mar 13, 2026 6/10
skill GitHub
🎨 Generate AI-powered images, videos, and music effortlessly with VAP Media Skill for Claude Code and Codex CLI. Enjoy free daily access or full features.
skill
by RenSeiji27 Mar 13, 2026 8/10
skill GitHub
Claude Code skills for architecture, real estate, and workplace strategy. Type /skill-name and go.
skill
by AlpacaLabsLLC Mar 13, 2026 8/10
skill GitHub
🚀 Discover and install new skills for your AI Agent with OneSkill, your gateway to a vast library of capabilities and seamless automation.
skillautomation
by Felixlan11 Mar 13, 2026 6/10
skill GitHub
Eighteen Claude Code skill files for smart contract security auditing, built from 2,749 Immunefi bug reports, 681 DeFiHack reproductions, and real hunting experience. A highly specialized set of skills for security researchers doing Web3 bug bounties.
web3securitysmart contractsbug bountyImmunefiDeFi
by shuvonsec Mar 13, 2026 7/10
skill Reddit
A Claude skill condensing launch knowledge from 30+ Product Hunt #1 finishes, 6,000+ GitHub stars in 7 days, and reach across 100+ countries. Structured as a full-lifecycle launch playbook to give Claude structured, non-generic launch guidance for AI products.
launchProduct Huntmarketingskillplaybook
by joackimreal Mar 13, 2026 6/10
skill Reddit
An open-source skill called Clarify First that makes Claude Code stop and ask for clarification before executing ambiguous or high-risk requests. Addresses the premature execution failure mode — requests like "optimize this" or "deploy now" now trigger clarifying questions instead of immediate action.
safetyclarificationskillagent behaviorhigh-risk
by Entire_Home_983 Mar 13, 2026 7/10
skill Reddit
Three open-source repositories that turn Claude Code into a full web/web3 bug bounty co-pilot: recon and attack surface mapping, vulnerability scanning (IDOR, SSRF, XSS, SQLi, OAuth, GraphQL, race conditions, LLM injection), and report writing. Built to eliminate manual copy-pasting of context.
bug bountysecurityreconweb3skillhacking
by shuvon2005 Mar 13, 2026 7/10
skill GitHub
A Claude Code skill that provides structured, multi-perspective business analysis by engineering deliberate disagreement. Instead of yes-man outputs, the skill presents opposing viewpoints and challenges assumptions, making it useful for high-stakes business decisions.
business analysisdecision-makingskillcorporatedissent
by apatheticus Mar 13, 2026 7/10
skill GitHub
A boilerplate repository providing universal coding standards and AI agent configurations for Claude Code projects. Streamlines project setup with pre-configured CLAUDE.md, agent rules, and development conventions that can be applied across projects.
boilerplatestandardsCLAUDE.mdconfigurationtemplate
by uriel963 Mar 13, 2026 6/10
skill GitHub
A skills management system that enables team members to create, test, distribute, install, update, and remove skills from their projects and user space. Provides a structured lifecycle for AI skills in team environments, similar to a package manager but for Claude Code skills.
skillsteamdistributionmanagementlifecycle
by zncdata-labs Mar 13, 2026 7/10
skill GitHub
A Claude Code skill covering secure credential storage and cryptography on Apple platforms. Includes Keychain Services, biometric authentication, CryptoKit, and OWASP compliance patterns for iOS and macOS. Gives Claude Code agents proper security guidance for Apple platform development.
securitySwiftiOSmacOSKeychainOWASPCryptoKit
by ivan-magda Mar 13, 2026 7/10
skill GitHub
A Claude Code skill that creates a structured AI-powered PR review pipeline. Reduces typical 30-45 minute code reviews to under 8 minutes through a systematic, consistent review process that checks logic, style, security, and potential regressions.
PR reviewskillcode reviewefficiencypipeline
by junyoung2015 Mar 13, 2026 8/10
skill Reddit
A Claude skill condensing real B2B SaaS growth patterns from companies like HeyGen, Deel, Vercel, and Supabase into a structured operator's handbook. Covers PMF validation, PLG/SLG strategy, affiliate programs, channel partnerships, and scaling metrics — less generic than typical AI growth advice.
B2BSaaSgrowthplaybookskillPMFPLG
by Shadow-Monarch015 Mar 13, 2026 6/10
skill Reddit
A Claude plugin that audits code for SOLID principle violations and suggests fixes. Supports Python, TypeScript, Java, Go, C#, Kotlin, Ruby, and PHP. Installable directly from the Claude Code marketplace with /plugin commands, then run /solid-audit to get a detailed report.
SOLIDcode qualityauditpluginrefactoring
by muthukrishnan749 Mar 13, 2026 7/10
skill GitHub
A personal private context infrastructure for Claude Code that keeps your context as your own property. Includes 12 skills, 13 hooks, and a caretaker runtime that manages context across sessions. Designed for developers who want full ownership and control over their AI coding context.
contextskillshooksprivacycaretaker
by alivecomputer Mar 13, 2026 7/10
skill GitHub
A Python library, set of Claude Code skills, and MCP server built around Semantic Scholar (S2) as the primary source for AI research discovery. Enables research workflows that search and retrieve academic papers directly from Claude Code.
researchSemantic ScholarMCPskillacademic papers
by zongmin-yu Mar 13, 2026 6/10
skill GitHub
A Claude Skill that connects to and analyzes personal health records using the SMART on FHIR standard. Enables Claude Code to query health data from FHIR-compatible sources, making it useful for health-focused development and personal health analytics.
healthFHIRmedical dataskillSMART
by jmandel Mar 13, 2026 6/10
skill GitHub
A collection of agents, skills, commands, and rules for AI-powered coding tools used daily in production at Weaverse. These are real-world tested configurations that supercharge development productivity across multiple AI coding tools.
agentsskillscommandsrulesproduction
by Weaverse Mar 13, 2026 7/10
skill GitHub
A Claude Code skill that reads your Xcode project and generates complete App Store Connect metadata and In-App Purchase details ready to copy and paste. No manual data entry needed — the agent reads the project structure and produces all required fields.
XcodeApp StoreiOSskillmetadata
by DiNerdyYawdie Mar 13, 2026 6/10
skill GitHub
A collection of 86 product management skills curated from top PM leaders, designed for PMs and founders to enhance their work with Claude's assistance. Covers frameworks, methodologies, and decision-making patterns used by leading product organizations.
product managementPMskillsfoundersframeworks
by TindanLawrence Mar 13, 2026 6/10
skill X
A Japanese YouTube video ("ゆっくり解説" narrated explainer style) that thoroughly analyzes the Claude Code settings configuration used by an Anthropic hackathon winner. While in Japanese, the settings themselves may be extractable and applicable for English speakers interested in high-performance Claude Code configurations.
settingsconfigurationhackathonbest-practicesCLAUDE.md
by @kenlog_net Mar 13, 2026 5/10
skill Reddit
A Claude Code skill built by a healthcare family to solve complex weekly logistics: who's home, who's cooking, who handles childcare and dogs across opposite schedules. An example of using Claude Code skills for personal automation beyond coding—scheduling, constraint solving, and family coordination.
skillautomationpersonalschedulinglogistics
by PerceptionOld8565 Mar 13, 2026 6/10
skill GitHub
Drop-in CLAUDE.md starter templates designed to constrain Claude Code into behaving like a disciplined staff engineer rather than an eager intern. Covers scope management, code ownership, review workflows, and communication style—immediately usable in any project.
claude.mdtemplatesworkflowbest-practicesstarter
by tansuasici Mar 13, 2026 8/10
skill Reddit
A 7-module browser-based interactive course that teaches Claude Skills by having you build a meeting-action-extractor skill from scratch. Uniquely uses the Claude API as the evaluation engine—it checks your skill files and gives contextual feedback on your code. A structured curriculum for learning skills development.
skillscourselearningclaude-apitutorial
by ScaryWatercress4560 Mar 13, 2026 7/10
skill Reddit
A clear guide explaining the three Claude primitives—Projects (knowledge base), Skills (instruction manuals), and MCP (tool connectivity)—and how to build skills from scratch. Explains when to use each, what belongs in a skill vs. a project, and how to structure SKILL.md files effectively.
skillstutorialguidemcpprojects
by HuckleberryEntire699 Mar 13, 2026 7/10
skill GitHub
A collection of Claude Code skills tailored for ML and AI researchers: experiment tracking, debugging model training runs, submitting jobs to SLURM clusters, and more. Fills a gap in the ecosystem for researchers who need AI coding assistance integrated with scientific computing workflows.
skillsmachine-learningresearchslurmexperiment-tracking
by Gaaaavin Mar 13, 2026 7/10
skill GitHub
A Claude Code skill that performs blunt, unfiltered automated code review across 31+ frameworks including game dev support. Features post-mortem verification and anti-AI-slop detection to catch the patterns AI agents commonly introduce. No sugar-coating—designed for developers who want honest feedback.
code-reviewskillanti-slopmulti-framework
by Gakuseei Mar 13, 2026 7/10
skill GitHub
A set of Claude Code skills for KiCad electronics design workflows: analyze schematics, review PCB layouts, download datasheets, source components, and prepare boards for fabrication. Useful for hardware engineers using AI-assisted PCB design.
skillskicadelectronicspcbhardware
by aklofas Mar 13, 2026 6/10
skill Reddit
A Claude Skill that prevents hallucination on Islamic texts by refusing to answer from model memory. Every query triggers a live lookup against a Supabase database of 20,972 authenticated records (Quran verses + Sahih Bukhari + Sahih Muslim hadiths). Demonstrates how skills can enforce strict grounding in external authoritative sources.
skillRAGSupabasehallucinationgrounding
by New_Brush3972 Mar 12, 2026 6/10
skill GitHub
A set of Claude Code plugins that use AI-driven design engineering personas to guide developers from initial concept through to production deployment. The personas provide structured guidance for building resilient agentic applications with consistent design patterns. Aims to make the full software development lifecycle more systematic when working with Claude Code.
pluginspersonasagenticdesignworkflow
by Yasas9029 Mar 12, 2026 5/10
skill GitHub
A collection of Claude Code agent skills for AWS automation tasks, providing ready-to-use skill definitions for common AWS operations. Enables AI agents to interact with AWS services directly from a Claude Code session. Useful for teams building AWS-integrated workflows with Claude Code.
AWSskillscloudautomationagent
by itsmostafa Mar 12, 2026 5/10
skill GitHub
A starter template providing meta-documentation scaffolding for Claude Code projects, designed for beginners entering AI-assisted development. Includes foundational CLAUDE.md patterns and project structure tailored for vibe-coding practice. Good starting point for developers new to working with Claude Code on real projects.
starterCLAUDE.mdbeginnervibe-codingtemplate
by Redemptions7 Mar 12, 2026 5/10
skill Reddit
Shield is a Claude Code skill that orchestrates multiple security scanners from a single /shield:shield command. It auto-detects your stack and runs Semgrep SAST, gitleaks secrets scanning, and npm/pip dependency audits, consolidating results into a unified report with a 0-100 risk score and OWASP/CWE/PCI-DSS compliance mapping. Found 103 secrets and 36 vulnerabilities in the author's own project, including AWS keys and a production .env tracked in git.
securitySASTsecretsvulnerabilityskillopen-sourcesemgrep
by alissonlinneker Mar 12, 2026 9/10
skill GitHub
A CLAUDE.md configuration framework that directs Claude to orchestrate context retrieval and analysis across multiple AI models including Auggie, Codex, and Gemini. Demonstrates how CLAUDE.md instructions can delegate specialized subtasks to different models for optimal results. Provides a template for teams wanting to build multi-model AI collaboration into their Claude Code workflow.
CLAUDE.mdmulti-agentorchestrationCodexGemini
by AnnsHarry Mar 12, 2026 5/10
skill GitHub
conclave is a Claude Code skill that pits multiple LLMs against each other: they debate and critique anonymously, then synthesize their best insights into a single, higher-quality answer. Useful for complex decisions where you want perspective beyond a single model's reasoning.
multi-llmdebatesynthesisskillquality
by tommasinigiovanni Mar 12, 2026 7/10
skill GitHub
A set of free Claude Code skills that address common developer pain points: loop detection to catch infinite recursion, scope guarding to prevent Claude from modifying unintended files, and dead code cleanup to remove stale logic.
loop-detectionscopecleanupskillssafety
by owen-dev-6174 Mar 12, 2026 7/10
skill Reddit
A research-backed fork of the popular Superpowers plugin that adds automatic task routing, specialist reviewer skills for complex changes, and safety hooks, while maintaining the same workflow. Achieves 73% fewer tokens through smarter routing rather than reduced capabilities. Drop-in replacement.
optimizationtokensroutingsafetyskillsfork
by Double_Seesaw881 Mar 12, 2026 7/10
skill GitHub
xpull is an agent skill that allows Claude Code to fetch tweets, threads, and articles from X/Twitter without authentication or API keys. Useful for research and content aggregation workflows that need to pull social content programmatically.
xtwitterscrapingskillresearch
by sanjeevneo Mar 12, 2026 7/10
skill Reddit
A skill that injects current Jetpack Compose API knowledge into Claude Code, addressing the problem of outdated or hallucinated Android UI code. Keeps the agent's Compose knowledge current without relying on training data that may be months behind the latest APIs.
androidjetpack-composekotlinskillup-to-date
by anhvt Mar 12, 2026 6/10
skill GitHub
A skill that enables Claude Code to build, run, and interact with iOS apps in the Simulator while optimizing for minimal context usage. Designed to give Claude full iOS development capabilities without the context window cost of naive approaches.
iossimulatorswiftxcodecontextskill
by conorluddy Mar 12, 2026 6/10
skill Reddit
A Claude skill that runs a structured validation process on startup ideas — identifying customer discovery gaps, competitive landscape, and likely failure modes — before any code is written. The developer says it would have saved them 3 months of building something nobody wanted.
startupvalidationideationskillproduct
by ferdbons Mar 12, 2026 6/10
skill GitHub
A Python-based skill suite for controlling LibreOffice with AI agents in a deterministic way. Enables Claude Code to create, edit, and manipulate LibreOffice documents, spreadsheets, and presentations with predictable, reproducible outcomes.
libreofficepythonofficeautomationskill
by dfk1352 Mar 12, 2026 6/10
skill X
A practical taxonomy for deciding which Claude skills are worth building: document/asset creation (reports, designs, code), workflow automation (multi-step processes), and MCP enhancement (teaching Claude how to use connected tools well). Helps prioritize skill development efforts.
skillstaxonomyworkflowmcpstrategy
by @gudanglifehack Mar 12, 2026 6/10
skill X
Skills built for Claude Code also work on Claude.ai and the API without modification. There is also a built-in skill-creator skill that generates new skills from plain English descriptions — a meta-tool that significantly speeds up skill development.
skillsportabilityclaude.aiapiproductivity
by @gudanglifehack Mar 12, 2026 6/10
skill GitHub
A skill that converts markdown outlines into PowerPoint presentations using your existing template's actual slide layouts rather than generic ones. Produces polished, on-brand decks without manual formatting.
powerpointmarkdownpresentationsskilloffice
by wozzeck16621 Mar 12, 2026 6/10
skill Reddit
aise tracks mistakes Claude Code makes across sessions and identifies patterns — mistakes that occur repeatedly are extracted and added to CLAUDE.md as prevention rules. Unlike manually updating CLAUDE.md after each incident, aise automates the pattern recognition step and generates targeted, minimal instructions to prevent recurrence.
CLAUDE.mdself-improvementmistakespatternsautomation
by doomdayx Mar 12, 2026 8/10
skill Reddit
Instead of pre-designing a complex CLAUDE.md structure, this post argues for letting Claude build and evolve it incrementally as you work through real tasks. The author has seen better results from CLAUDE.md files shaped by actual usage patterns than from elaborate up-front structures, and shares the workflow for guiding Claude to maintain it.
CLAUDE.mdworkflowbest-practicesincremental
by PawelHuryn Mar 12, 2026 8/10
skill GitHub
A comprehensive project health audit skill that checks for security vulnerabilities, broken Claude Code hooks, missing or failing tests, and CI/CD issues across 20+ programming languages. Produces an adaptive health score with actionable fix recommendations, giving a quick baseline assessment of any codebase.
skillauditsecurityhookstestingCI
by ScarXparth Mar 12, 2026 8/10
skill GitHub
skill-manager analyzes your active project to determine which installed Claude Code skills are relevant and automatically disables the rest for that session. Reduces token overhead from irrelevant skill schemas loading into context and keeps tool selection focused on what the current project actually needs.
skilltoken-savingscontextproject-scopedautomation
by mrdenox109-nyx Mar 12, 2026 8/10
skill Reddit
A developer maintaining an open-source library of 181 Claude agent skills is asking the community what is missing. The library covers the full development lifecycle and is publicly available for contribution. Good resource for discovering battle-tested skills and for contributing new ones to fill gaps.
skilllibraryopen-sourcecommunitycollection
by nginity Mar 12, 2026 8/10
skill X
SkillsMP is described as an App Store for AI agent skills — a marketplace of over 200,000 skills designed for Claude Code that extend what the agent can do beyond text and code generation. Skills cover integrations, workflows, domain expertise, and tooling. The most downloaded skill is a notification hook for task completion.
marketplaceskillscommunityextensions
by @Suryanshti777 Mar 12, 2026 8/10
skill Reddit
Claude Code v2.1.74 shipped notable system prompt additions including a session title generator, a /stuck skill to diagnose frozen sessions, and an improved memory selection agent prompt. The changelog post breaks down each new prompt with the full text, useful for understanding how Claude Code uses its own built-in skills.
changelogsystem-promptskillsmemorystuck
by Dramatic_Squash_3502 Mar 12, 2026 8/10
skill Reddit
Skills that loaded fine in Claude Code silently failed in VS Code because the name field did not match the parent directory — a rule Claude Code does not enforce but VS Code does. This linter catches that class of cross-agent inconsistency and other SKILL.md structural issues before they cause hard-to-debug failures.
skilllintervalidationSKILL.mdcross-agent
by BradKinnard Mar 12, 2026 8/10
skill GitHub
A curated collection of over 1000 battle-tested SKILL.md files for Claude Code, Antigravity, and Cursor — including official skills from Anthropic and Vercel. Covers the full development lifecycle from planning and coding to deployment, testing, and specialised domains.
skillcollectionanthropicvercelantigravitycursor
by sickn33 Mar 12, 2026 9/10
skill GitHub
Structured prompt engineering library and Claude Code skill featuring 300+ curated examples for writing effective AI prompts. Helps produce high-quality, precise prompts for Claude Code agents and downstream tasks.
prompt engineeringexampleslibrarytemplatesskill
by Marwane83930 Mar 12, 2026 6/10
skill GitHub
Zero-config setup for Claude Code that provides tasks, memory, and rules for predictable interactions without changes to your chat config. Designed to work out of the box without any configuration required.
tasksmemoryruleszero-configsetup
by adamwac2515 Mar 12, 2026 7/10
skill Reddit
Claude Code plugin for in-repo project planning with four levels: Ideas, Roadmap, Steps, and Done. Each project gets its own planning folder committed to git. Claude reads your ideas, investigates the codebase, and asks targeted questions before proposing anything — no external tools or subscriptions.
planningproject managementpluginindie dev
by Jeehut Mar 12, 2026 7/10
skill X
A detailed study session article explaining Claude Code Agent Skills: the overview and folder structure for customizing Claude Code behavior, setup walkthroughs, usage tips, and hands-on demo content. Good reference for teams learning to build custom Skills.
skillsagent-skillstutorialfolder-structureextension
by @topickapp_com Mar 11, 2026 5/10
skill GitHub
A library of go-to-market skills for Claude Code, Codex, and Cursor, providing pre-built capabilities for sales, marketing, and business-related AI workflows.
skillsgo-to-marketbusinesslibrary
by athina-ai Mar 11, 2026 6/10
skill Reddit
A 25-line custom skill that puts Claude Code into a hands-off conversation mode—reads files, searches code, and does web lookups, but blocks all file modifications. Ideal for architecture discussions, codebase exploration, and thinking out loud without triggering unwanted edits.
skillslash-commandread-onlydiscussionexploration
by After_Book_7030 Mar 11, 2026 8/10
skill GitHub
An OpenClaw + Claude Code superpowers system implementing three-tier persistent memory alongside Skills, Hooks, and MCP integration. Addresses context loss between sessions by building long-term memory that persists across conversations.
memoryhooksmcpskillspersistencecross-session
by TheSoulGiver Mar 11, 2026 8/10
skill GitHub
Claude Code plugin that automates the Strangler Fig pattern for systematically migrating legacy monolithic codebases to microservices. Inspired by Martin Fowler's methodology and Obra Superpowers for incremental, low-risk extraction.
refactoringmicroservicesmigrationpluginarchitecture
by mhosner Mar 11, 2026 7/10
skill GitHub
Claude Code plugin combining the Ralph Wiggum specification loop with structured spec-driven development and smart context compaction. Keeps agent sessions focused and grounded with persistent specification files that survive context resets.
spec-drivencompactionpluginralphworkflow
by tzachbon Mar 11, 2026 7/10
skill Reddit
Benchmark evaluation comparing Claude Haiku, Sonnet, and Opus on skill execution in Claude Code. Notable finding: Haiku performs surprisingly well with well-written skill content, narrowing the gap with larger models. Methodology and results posted on tessl.io.
haikusonnetopusbenchmarkskillsevaluation
by sjmaple Mar 11, 2026 7/10
skill GitHub
Rust-powered Claude Code toolkit providing self-improving skill management, performance optimization helpers, and a curated set of essential MCP server configurations. Focuses on skills that learn from usage patterns.
skillsself-improvingmcpperformancerust
by spences10 Mar 11, 2026 7/10
skill GitHub
Official collection of Claude Code agent skills from the PowerSync team. Provides ready-to-use skills for integrating PowerSync real-time sync capabilities, database operations, and offline-first patterns into Claude Code workflows.
powersyncsyncdatabaseskillsofficial
by powersync-ja Mar 11, 2026 6/10
skill Reddit
Skill set that automates the full cycle after implementation: write missing tests, run multi-agent code simplification, trigger Codex peer review, commit with clean messages, and create/update PRs. The /self-improve skill routes lessons from conversation corrections into CLAUDE.md or memory files so Claude improves per-project over time.
skillstestingreviewself-improvingcommitprautomation
by Caibot Mar 11, 2026 8/10
skill Reddit
Marketplace for buying and selling Claude Code SKILL.md files. Skills go through automated security scans (dangerous commands, secret detection, prompt injection). Creators keep 80% of revenue. After two weeks: 300-500 daily visitors, 100 users, 12 skills, 98 downloads.
marketplaceskillssecurityskill.mdcommunitymonetization
by BadMenFinance Mar 11, 2026 7/10
skill Reddit
Discovery that the Superpowers brainstorming skill now serves live UI mockup options via a local web server, letting you click to select a design before returning to the terminal. Invoked via /brainstorming or /superpowers:brainstorming.
superpowersbrainstorminguimockupskillinteractive
by oddslol Mar 11, 2026 5/10
skill GitHub
Claude Code agent skill that discovers and calls TikHub API endpoints across 12+ social media platforms (TikTok, Instagram, YouTube, etc.). Lets agents fetch content, metadata, and analytics from social platforms during coding sessions.
tiktoksocial-mediaapiskilltikhub
by tiendatne2004 Mar 11, 2026 5/10
skill GitHub
Community-curated list of essential Claude Code resources covering development best practices, skills, hooks, MCP servers, and workflow patterns to improve project outcomes.
resourcesawesome-listcuratedbest-practices
by eegy90 Mar 11, 2026 6/10
skill GitHub
Curated collection of Claude Code skills for improved coding assistance, covering production-ready code generation, debugging patterns, and review workflows. Designed for efficient, high-quality agent outputs.
skillscodingcollectionproductivity
by Makiya1202 Mar 11, 2026 5/10
skill GitHub
A curated vault of Claude Code slash commands, custom skills, and MCP server setup guides. Organized for efficient discovery and reuse of community-proven patterns.
skillscommandsmcpvaultguides
by hackermanishackerman Mar 11, 2026 6/10
skill GitHub
CLI tool for discovering and installing agent skills for Claude Code from a registry of 50,000+ skills. Single-command skill search and installation streamlines onboarding new capabilities into your workflow.
cliskillsregistryinstalldiscovery
by stbarbe Mar 11, 2026 7/10
skill GitHub
Drop-in Claude Code configuration for React projects that enforces clean architecture patterns and prevents technical debt accumulation. Manages context budgets and import conventions to keep large React codebases navigable for agents.
reactarchitectureclaude.mdconfigtechnical-debt
by wahmoh Mar 11, 2026 6/10
skill GitHub
Claude Code skill that generates advertising concepts, scores them against industry-standard creative director criteria, and iterates using proven creative methodologies. Useful for marketing teams using Claude Code to ideate campaigns.
marketingadvertisingcreativeskillideation
by eiwru Mar 11, 2026 5/10
skill GitHub
Reusable Claude Code skills for academic research workflows — literature search, citation graph exploration, and DeepScan monitoring, all powered by the papersflow-mcp server. Combines the Claude Code skills system with MCP for a domain-specific research assistant pipeline.
skillmcpresearchacademicliterature
by papersflow-ai Mar 11, 2026 6/10
skill X
A developer shares their ~/.claude/ directory structure for managing Claude Code skills, custom slash commands, and shared shell scripts. The layout separates scripts/ (executable by agents), commands/ (slash commands), and CLAUDE.md (global config) for a clean, maintainable setup.
skillsub-agentorganizationCLAUDE.mdscriptsconfig
by @sho_tewodou Mar 11, 2026 7/10
skill GitHub
Forge Plugin: Zero-dependency governance for Claude Code. 21 commands, 22 agents, 29 skills.
skillcommand
by nxtg-ai Mar 11, 2026 9/10
skill GitHub
🧪 Provide expert Swift Testing guidance with best practices for XCTest, async tests, parallel execution, and seamless Agent Skills integration.
skilltesting
by jajaaa2 Mar 11, 2026 6/10
skill GitHub
Less skills. Deeper connections. A lean, interconnected skill ecosystem for Claude Code.
skill
by Rune-kit Mar 11, 2026 8/10
skill GitHub
A collection of Claude Code skills for Go programming, covering best practices, code reviews, concurrency patterns, and data structures. Each lesson is modular and AI-driven, making it easy to apply specific Go knowledge directly in your coding sessions.
golangskillscode-reviewconcurrencylearning
by dwana1 Mar 11, 2026 5/10
skill X
A single article covering the full lifecycle of building Claude Code skills — from foundational concepts and architectural patterns to testing strategies and production deployment. Aims to give developers everything needed to build skills that automate workflows and boost productivity.
skillsguidearchitecturetestingproduction
by @hooeem Mar 11, 2026 7/10
skill GitHub
A Claude skill that pulls live stock data using yfinance and produces structured valuation and financial health analysis for any ticker. No paid API keys required — just install the skill and ask Claude to analyze a stock. Good starting point for custom financial research workflows.
skillfinancestocksyfinanceanalysisdata
by apex-stack-ai Mar 11, 2026 5/10
skill GitHub
A Claude Code skill that automates fetching and summarizing AI and tech news from shir-man.com into a structured digest. Useful as a template for building your own automated content aggregation skills within Claude Code workflows.
skilldigestautomationnewsai-trendscontent
by jojoprison Mar 11, 2026 5/10
skill GitHub
A Claude skill that audits programmatic SEO implementations — analyzing page templates, crawl budget allocation, and indexing health. Useful for developers and SEO practitioners who want AI-assisted analysis of large-scale content sites without manual tooling setup.
skillseoauditprogrammatic-seoweb
by apex-stack-ai Mar 11, 2026 5/10
skill Reddit
Genuine question as someone who has recently moved over from ChatGPT and never really saw the need to pay $200/month for it. Loving Claude so far and skills/Cowork has been a revelation for me give...
skill
by AnusMcBumhole Mar 11, 2026 6/10
skill Reddit
What’s the best way to perform repetitive tasks in co-work? I have list of few accounts, that co-work researches following guides from the skills. But as expected after 4-5 accounts, the quality dr...
skillapi
by Visible_Resource9503 Mar 11, 2026 6/10
skill GitHub
Antigravity. Claude-code. 🇬🇧 Zero-dependency Node.js CLI to statically audit third-party AI Skills for malicious code patterns before local execution. | 🇪🇸 CLI Node.js sin dependencias para auditar...
skill
by smartbrainactivity Mar 11, 2026 8/10
skill GitHub
Agent Operator - AI Skills Marketplace for Claude Code. 369+ curated skills with multi-language support.
skill
by zhangtuansia Mar 11, 2026 9/10
skill Reddit
I've been drowning, going through lots of Claude Code skills lately and kept running into the same problem: there are thousands of them out there, most are untested, poorly documented, and some hav...
skillreview
by camilosanchez Mar 11, 2026 8/10
skill Reddit
If you've tried /remote-control, you're probably familiar with this banner: Claude App Banner: \"Failed to send message, An unknown network error has occurred\" I kept assuming it was an incorrect ...
gitconfigreview
by wirelesshealth Mar 11, 2026 9/10
skill Reddit
I am an average excel user with little coding experience. I switched to Claude because I read so much about how it was better at coding than ChatGPT. At first it was great. It walked me through Pow...
skill
by Odd_Bad5188 Mar 11, 2026 6/10
skill Reddit
submitted by /u/AskZealousideal9510 [link] [comments]
skill
by AskZealousideal9510 Mar 11, 2026 5/10
skill Reddit
I've been building my first mobile app via Claude(demo app to understand CC). Today the weekly limit would be reset. I wanna know if I need to implement a skill or not. At the beginning, I asked it...
skill
by Working_Question4361 Mar 11, 2026 7/10
skill GitHub
🛠️ Streamline Apple firmware analysis with the ipsw-skill, enabling AI agents to download, extract, and reverse engineer complex data efficiently.
skill
by RaiyanRamin1 Mar 11, 2026 6/10
skill Reddit
I’ve mainly created skills and not agents and I haven’t come across a concrete difference that makes it worthwhile to launch the other because I’ve found subagents go off the rails and do the wrong...
skill
by doomdayx Mar 11, 2026 6/10
skill GitHub
Claude Code plugin providing skills for x64dbg debugger automation
skillautomation
by dariushoule Mar 11, 2026 8/10
skill GitHub
A curated collection of 7,800+ agent skills for Claude Desktop, sourced from skills.sh
skill
by ulpi-io Mar 11, 2026 7/10
skill GitHub
Build a self-hosted AI assistant that supports multiple channels, manages tasks, and offers extensible skills for personalized automation.
skillautomation
by yourkenike Mar 11, 2026 5/10
skill GitHub
Agent skills for Claude Code & AI coding assistants — live Google Search Console data, SEO analytics, CTR benchmarking
skill
by spivx Mar 11, 2026 9/10
skill Reddit
Claude is honestly starting to feel a bit too good to be true. It’s great for velocity, but I’ve been thinking—when was the last time you actually engineered a solution to a hard problem? 🧠 If you’...
skill
by Huge-Ad6985 Mar 11, 2026 6/10
skill GitHub
Free Claude skill for cross-publishing blog articles to Dev.to via API
skillapi
by apex-stack-ai Mar 11, 2026 6/10
skill Reddit
I heard supposedly Gemini is the only AI that can watch youtube video right now, is that still the case, and if so is there claude code skill to enable that or do I simply load the Gemini model or ...
skillworkflow
by maraluke Mar 11, 2026 8/10
skill GitHub
🤖 Enhance AI capabilities with a collection of modular skills for specialized workflows, tool integrations, and domain expertise.
skillworkflow
by Durden7 Mar 11, 2026 5/10
skill GitHub
claude-code-skill-activator:
skill
by Linux9505 Mar 11, 2026 8/10
skill GitHub
Collection of VergingAI Agent Skills
skill
by verging-ai Mar 11, 2026 6/10
skill Reddit
Been dealing with this over multiple sessions today, but it doesn't seem like sessions start with the correct context? like claude.md skills.md etc. arent' loading into context and it just forms a ...
skillclaude.md
by monkey_spunk_ Mar 11, 2026 8/10
skill GitHub
🎨 Generate stylish Xiaohongshu cover images based on your themes with ease using this simple API integration tool.
skillapi
by Asavani Mar 11, 2026 5/10
skill GitHub
High quality production ready agent skills for Claude Code, Cursor, Codex, and OpenCode.
skill
by RiccardoGrin Mar 11, 2026 9/10
skill GitHub
🤖 Build adaptable AI agents with skill-based systems, enabling efficient context management and seamless integration across any framework.
skill
by tanveerkhan2005 Mar 11, 2026 6/10
skill Reddit
Our friendly friend Claude suggested me to share my Shipping label printer skill for cropping down labels and printing them, just by telling that you added folders to a file that have shipping labe...
skillgit
by SunofaBaker Mar 11, 2026 6/10
skill Reddit
Hey everyone, We were tired of AI on phones just being chatbots. Being heavily inspired by OpenClaw, we wanted an actual agent that runs in the background, hooks into iOS App Intents, orchestrates ...
hookapi
by wolfensteirn Mar 11, 2026 6/10
skill Reddit
submitted by /u/Direct-Wave8930 [link] [comments]
skill
by Direct-Wave8930 Mar 11, 2026 8/10
skill Reddit
I feel unsure about which Claude module to use for my daily work working in finance. I find myself wanting and trying to build README files for agents that I want to use for my daily, weekly, month...
skill
by AIfinance123 Mar 11, 2026 7/10
skill Reddit
I just built a new skill called Writers Room Story Engine and made it public in case it is useful to anyone else working on story development with Claude. I built it for myself because I wanted a b...
skillgit
by jackterror Mar 11, 2026 7/10
skill GitHub
Agent skills and plugins
skill
by augentic Mar 11, 2026 6/10
skill GitHub
The agent harness performance optimization system. Skills, instincts, memory, security, and research-first development for Claude Code, Codex, Opencode, Cursor and beyond.
skill
by affaan-m Mar 11, 2026 10/10
skill GitHub
AI-native codebase intelligence skills — generate persistent .nexus-map/ knowledge bases and instantly query file structure, dependency graphs, and change impact. Built for Copilot, Cursor, and any...
skill
by Haaaiawd Mar 11, 2026 5/10
skill Reddit
Hey everyone, I've been building a comprehensive product development system as a Claude Skill, and it grew into something I think is genuinely useful for anyone building a product. **What it is:** ...
skillgit
by ankitjha67 Mar 11, 2026 7/10
skill Reddit
Spent some time developing an improved version of the systematic-debugging skill for claude code. Might be helpful for some! https://github.com/pytholic/claude-skills/tree/main/systematic-debugging...
skillgittesting
by rajahaseeb147 Mar 11, 2026 9/10
skill GitHub
Agent Skills 终极指南:快速入门、推荐技能、最新资讯与实战案例 |The Definitive Guide to Agent Skills: Quick Start, Recommended Skills, Latest News, and Practical Case Studies
skill
by libukai Mar 11, 2026 6/10
skill GitHub
📝 Automate project documentation generation and maintenance with dev-docs, a Skill for Cursor IDE and Claude Code. Simplify your workflow today.
skillworkflow
by Hautran11325 Mar 11, 2026 8/10
skill GitHub
💳 Integrate Taiwan's third-party payment solutions for AI agents, supporting NewebPay, ECPay, and PAYUNi for seamless transactions.
skill
by Oelshafei1 Mar 11, 2026 6/10
skill GitHub
🤖 Enhance your Claude Code experience with AI MAX: easy-to-use agents, skills, commands, and rules for efficient development and problem-solving.
skillcommand
by aldo832 Mar 11, 2026 9/10
skill GitHub
Long-term memory for AI agents using plain markdown. No vector DB, no embeddings — just skill files the agent already knows how to read.
skill
by Jannhsu Mar 11, 2026 6/10
skill GitHub
Install once, use everywhere — a unified skill manager for AI tools like Claude, Codex, and Gemini.
skill
by AcaciusShun Mar 11, 2026 6/10
skill GitHub
A package manager for AI agents. Install agent skills from GitHub with a single command.
skillcommandgit
by kasperjunge Mar 11, 2026 6/10
skill GitHub
A curated collection of skills for the pi coding agent / Codex / Claude Code and other agents. | 面向 pi coding agent / Codex / Claude Code 等 agents 的技能集合。
skill
by mxyhi Mar 11, 2026 9/10
skill GitHub
🚀 Feishu/Lark Docs、Sheet、Bitable <-> Markdown | AI Agent-friendly knowledge base exporter and writer with OAuth 2.0, CLI, TUI & Claude Skills support - 飞书云文档 <-> Markdown | AI Agent 友好型导出-写入工具
skill
by leemysw Mar 11, 2026 7/10
skill Reddit
Built a small Claude Code skill called **video-lens**. You type `/video-lens ` and it: Fetches the YouTube transcript Asks Claude to summarize it Writes a structured HTML report and opens it in you...
skillworkflowgit
by Hot-Lavishness5612 Mar 11, 2026 8/10
skill GitHub
Agent Skill: Self-improving learning system - detects friction, proposes improvements | Claude Code compatible
skill
by netresearch Mar 11, 2026 9/10
skill GitHub
Claude Code configuration hub: Skills, Agents, Commands, Hooks, and Output Styles for session-continuous AI-assisted development.
skillhookcommandconfig
by jopre0502 Mar 11, 2026 10/10
skill Reddit
How do you use your Claude Code? WHY you think your way is the best? Do you use it only in the terminal? Do you use it together with an IDE? If you have an IDE, which and why, and does it matter? D...
skill
by AerieAcrobatic1248 Mar 11, 2026 10/10
skill GitHub
🧠 A curated collection of the best AI skills, system prompts & agent rules
skill
by skillsdirectory Mar 11, 2026 6/10
skill GitHub
A general-purpose output auditing skill for Claude, Codex, Gemini CLI, and other agents
skill
by mickeylorenzini Mar 11, 2026 7/10
skill Reddit
I've been going down the rabbit hole of Claude Code skills lately and kept running into the same problem: there are thousands of them out there, most are untested, poorly documented, and some have ...
skillreview
by camilosanchez Mar 11, 2026 8/10
skill GitHub
Agent Skill for Android development with Kotlin and Jetpack Compose, covering modular architecture, Navigation3, Gradle conventions, dependency management, and testing best practices.
skilltesting
by Drjacky Mar 11, 2026 7/10
skill GitHub
Starter template repo for all your Claude Code needs: configs, skills, agents and more.
skillconfig
by serpro69 Mar 11, 2026 10/10
skill GitHub
去除中文MBA论文AI写作痕迹的检测与改写工具 | AI writing pattern detection and removal tool for Chinese MBA thesis
skill
by stephenlzc Mar 11, 2026 5/10
skill GitHub
Multi-agent Claude Code skill for building apps and stuff
skill
by SamJHudson01 Mar 11, 2026 9/10
skill Reddit
When you create new skills or update existing ones, you can now upload them to your capabilities directly from the conversation. I'm using a meta-skill that monitors all my Cowork sessions and auto...
skill
by rebelytics Mar 11, 2026 5/10
skill GitHub
Quality auditor for Claude Code artifacts — scores SKILL.md, CLAUDE.md, agents, rules & commands with A–F grades and actionable fixes.
skillcommandclaude.md
by ordinary9843 Mar 11, 2026 10/10
skill GitHub
🤖 Define and execute task-specific AI agents in markdown across various platforms with the Sub-Agents Skills for seamless integration and portability.
skill
by blindlove200 Mar 11, 2026 6/10
skill GitHub
🎙️ Automate podcasting with skills: download YouTube videos, process audio, and manage content efficiently—all in one comprehensive toolkit.
skill
by frank-syncmarket Mar 11, 2026 5/10
skill GitHub
The largest open-source medical AI skills library for OpenClaw🦞.
skill
by FreedomIntelligence Mar 11, 2026 5/10
skill GitHub
Claude Code + Codex 双平台 AI dotfiles:统一管理 skills/agents/hooks,并一键同步到 ~/.claude 与 ~/.codex。
skillhook
by codingSamss Mar 11, 2026 10/10
skill Reddit
Hey, can anyone share a working prompt for a PR review? I want to create a skill that receives a branch name and reviews it according to specific steps. The problem I’m seeing is that the agent som...
skillreview
by NO2UT Mar 11, 2026 6/10
skill GitHub
Claude Code skill: detect and eliminate AI writing patterns. Three-phase pipeline: detect → rewrite → score. Self-learning system.
skill
by rap-p Mar 11, 2026 8/10
skill GitHub
A collection of skills that teach Claude Code new tricks
skill
by christyjacob4 Mar 11, 2026 8/10
skill GitHub
Portable task management for Claude Code — local SQLite DB, CLI, and skills for autonomous workflows
skillworkflow
by gioe Mar 11, 2026 8/10
skill GitHub
Multi-agent orchestration for Claude Code. Persistent memory, tasks, rules, and skills that make AI agents actually coordinate.
skill
by codingagentsystem Mar 11, 2026 9/10
skill GitHub
My Agent Skills I've created for Claude Code and can, in principle, be used with other coding assistants
skill
by WhatIfWeDigDeeper Mar 11, 2026 9/10
skill GitHub
Generate and maintain help center articles from your codebase
skill
by selvoapp Mar 11, 2026 5/10
skill GitHub
The most comprehensive x402 payments skill for AI coding agents, enabling Claude Code to build paid APIs on Base and Solana with USDC. Includes a Sentinel Payment Router for agent-to-agent commerce. Targets the emerging agentic commerce ecosystem.
skillpaymentsx402cryptoagentic-commercesolana
by valeo-cash Mar 11, 2026 6/10
skill Reddit
A suite of 8 Claude Code plugins covering agentic web protocols: UCP (REST/A2A), ACP (Stripe delegated payments), AP2 (crypto signing), and A2A (agent task delegation). Acts as an expert co-developer for building agents that shop, pay, and negotiate autonomously.
pluginspaymentsagentic-commerceprotocolsa2a
by NoAide1608 Mar 11, 2026 7/10
skill GitHub
A Claude Code skill that rewrites vague prompts into structured, expert-level prompts using 7 research-backed frameworks: CO-STAR, RISEN, RISE, TIDD-EC, RTF, Chain of Thought, and Chain of Density. Helps get consistently better results from Claude by improving prompt structure automatically.
skillprompt-engineeringco-starrisenframeworks
by ckelsoe Mar 11, 2026 7/10
skill GitHub
Official AI skills from the Dagster team for working with their data orchestration platform. Provides Claude Code with deep knowledge of Dagster patterns, assets, jobs, and best practices. Useful for data engineers who use both Dagster and Claude Code.
skilldagsterdata-engineeringorchestrationofficial
by dagster-io Mar 11, 2026 6/10
skill GitHub
A comprehensive collection of 611+ cybersecurity skills following the agentskills.io open standard, compatible with Claude Code, GitHub Copilot, Codex CLI, Cursor, and Gemini CLI. Covers vulnerability assessment, secure coding patterns, and threat modeling for AI-assisted security work.
skillsecuritycybersecurityvulnerabilityagentskills
by mukul975 Mar 11, 2026 7/10
skill GitHub
A security-focused, validated skill registry for professional AI coding agents. Skills are vetted before inclusion, making it safer to adopt community skills. Extends Claude Code, Cursor, Copilot, and Antigravity with confidence in what you're running.
skillregistrysecurityvalidatedprofessional
by tech-leads-club Mar 11, 2026 7/10
skill GitHub
Official Claude Code skills from NASA's Planetary Data System (PDS) team for automating release notes, program status reports, and other NASA PDS-specific workflows. An interesting example of a major scientific organization adopting Claude Code skills for technical automation.
skillnasaautomationrelease-notesscientific
by NASA-PDS Mar 11, 2026 6/10
skill GitHub
Skills that structure research pipelines as semantic execution units — each declares inputs, outputs, acceptance criteria, and guardrails. Prevents hollow AI writing through structured intermediate artifacts and an evidence-first approach.
researchpipelineevidencestructuredwriting
by WILLOSCAR Mar 10, 2026 6/10
skill GitHub
A personal collection of Claude Code plugins and global settings curated by a developer. Useful as a reference for structuring your own plugin registry and discovering community-tested Claude Code configurations.
pluginsconfigmarketplacesettingsreference
by bendrucker Mar 10, 2026 5/10
skill GitHub
A tool to sync and manage Claude Code global and home-level settings across multiple machines. Useful for developers working on several computers who want consistent Claude Code configurations everywhere.
configsyncsettingsmulti-machinedotfiles
by WoojinAhn Mar 10, 2026 6/10
skill GitHub
A collection of B2B SaaS marketing skills compatible with SKILL.md format, usable in Claude Code, Cursor, and other AI agents. Covers marketing workflows that non-developers can run directly from the terminal.
marketingb2bsaasskillscursor
by Stallin-Sanamandra Mar 10, 2026 5/10
skill Reddit
A web-based IDE specifically for building SKILL.md files. Features AI-assisted creation from natural language, a structured editor with real-time validation, multi-model testing via OpenRouter, one-click deployment to Claude Code, version history, and bulk import/export. Start with a single npx command, no Docker needed.
skillsidetestingdeploymentopen-sourceskill.md
by felltrifortence Mar 10, 2026 9/10
skill Reddit
A skills pack for startup founders — not developers. Includes /validate-idea, /competitor-matrix, /mvp-scope, /pricing-strategy, /go-to-market, /pitch-deck, /fundraise-prep, and more. Drop the commands/ folder into .claude/commands/founder/ and run from your terminal. MIT licensed.
skillsstartupfounderstrategyproductpitch
by akorecebov Mar 10, 2026 8/10
skill Reddit
A CLI that reads a single config file and handles fetching, locking, and deploying skills and agents — like Brewfile or package.json, but for AI tool definitions. Supports local customizations via patch files that survive upstream updates. Install with cargo install skillfile.
skillspackage-managerdeclarativeagentsrustlocking
by julennnnn Mar 10, 2026 8/10
skill Reddit
A comprehensive PM skill library built by a 20-year PM: /prd-generator, /user-interview-analyzer, /competitive-profile-builder, /roadmap-builder, /weekly-metrics, /win-loss-analysis, /experiment-designer, and 60+ more. Covers go-to-market, pricing, OKRs, stakeholder updates, and decision frameworks. Browse free at mysecond.ai/skills.
skillsproduct-managerworkflowprdroadmapokr
by Which-Objective2553 Mar 10, 2026 8/10
skill GitHub
Automatically captures, indexes, and reuses knowledge from AI agent interactions to build a self-evolving, memory-driven assistant system. Skills improve over time as the agent learns from past work rather than starting fresh each session.
memoryknowledgeself-evolvingindexingagentlearning
by Chocoberry1108 Mar 10, 2026 6/10
skill GitHub
Skills that give AI coding agents product management capabilities, helping them build user-focused software with PM discipline. Bridges the gap between engineering-focused AI agents and product thinking.
product-managementskillsuser-focusedpmagent
by saubade32 Mar 10, 2026 5/10
skill GitHub
Skills integrated with InfraNodus, a knowledge graph visualization tool, to augment the LLM thinking process. Adds structural reasoning and graph-based insight generation on top of standard language model capabilities.
skillsknowledge-graphthinkingreasoninginfranodus
by infranodus Mar 10, 2026 5/10
skill GitHub
A personal collection of Claude Code skills focused on development workflows. Good reference for community patterns and how experienced developers structure their SKILL.md files for daily coding tasks.
skillsdevelopmentworkflowreferenceplugins
by technicalpickles Mar 10, 2026 6/10
skill X
A ready-to-use CLAUDE.md template derived from Anthropic's internal workflow as shared by Boris Cherny, the creator of Claude Code. Dropping this file in a repo reportedly makes Claude Code significantly more effective. An excellent starting point for anyone wanting to configure Claude Code using proven best practices.
claude-mdconfigurationbest-practicesboris-chernyanthropicworkflow
by @DAIEvolutionHub Mar 10, 2026 9/10
skill X
A security audit workflow combining a custom /solidity-auditor slash command with Claude Code to triage findings and auto-generate Foundry mainnet fork proof-of-concept tests. Claude Code handles building the test files and run commands, reducing repetitive grunt work for Solidity developers.
soliditysecurityauditfoundrysmart-contractscustom-command
by @Harvesto12 Mar 10, 2026 6/10
skill Reddit
Proposes PromptVault, a CLI tool to version and synchronize AI agent configuration files (CLAUDE.md, AGENTS.md, .cursorrules) across projects. Solves duplicated and conflicting instructions between tools. Seeking community validation before building as open-source.
CLAUDE.mdpromptsconfigCLIproject-management
by DaherSystemsAndIA Mar 10, 2026 7/10
skill GitHub
A Claude Code skill for full-fidelity PDF-to-Markdown conversion, Python-based reproduction of research paper experiments, and bilingual README generation with embedded figures. Designed for academic and ML research workflows where reproducing paper results is a common task.
skillpdfmarkdownresearchpythonacademic
by celynnmoonlight Mar 10, 2026 6/10
skill GitHub
A set of skills designed to help AI agents manage and optimize context window usage. Covers techniques for efficient information handling, context prioritization, and performance optimization. Intended to enhance agent systems that rely on skill-based context injection.
skillcontext-engineeringagentoptimization
by Kalyanikhandare29 Mar 10, 2026 5/10
skill GitHub
A collection of Claude Code skills for go-to-market engineering tasks: B2B prospecting, lead enrichment, signal discovery, and lead generation powered by Deepline. Useful for sales and marketing teams automating outbound workflows with Claude Code.
skillgtmsalesprospectinglead-generationdeepline
by getaero-io Mar 10, 2026 6/10
skill GitHub
A Claude Code skill that estimates codebase rebuild cost across 5 dimensions: domain knowledge, infrastructure coupling, data model depth, integration surface, and operational maturity. Goes beyond lines-of-code to capture true complexity.
skillestimationcodebasecomplexityanalysis
by teterouge Mar 10, 2026 7/10
skill GitHub
A Claude agent skill that scans your Gmail inbox, classifies every message using your own rules, applies Gmail labels, and archives suspected junk. A complete autonomous email management workflow requiring only rule configuration.
skillgmailemailautomationtriage
by sskaye Mar 10, 2026 7/10
skill Reddit
A 730-line instruction file that eliminates Google Ads Editor import failures. Seven modules cover exact column headers per row type, encoding rules (em dashes and smart quotes that silently corrupt CSVs), policy compliance, and ad format validation. Eliminates the 'Ambiguous row type' import error.
skillgoogle-adscsvautomationmarketing
by fakereal-realfake Mar 10, 2026 6/10
skill GitHub
A curated collection of 500+ agent skills from official development teams and the community, compatible with Claude Code, Codex, AntiGravity, Gemini CLI, and Cursor. Central resource for the growing skills ecosystem.
skillcollectioncommunitycurated
by VoltAgent Mar 10, 2026 7/10
skill GitHub
An agent skill that researches any topic across multiple sources including Reddit, X, YouTube, Hacker News, Polymarket, and the web, then synthesizes a grounded summary. Multi-source research in one command.
skillresearchwebmulti-sourcesynthesis
by mvanhorn Mar 10, 2026 7/10
skill GitHub
A Claude Code development workflow template featuring a BDD/TDD skill and code review hooks for autonomous feature development. Enforces test-first practices and automated code quality gates.
skillhooktddbddcode-reviewworkflow
by zxkane Mar 10, 2026 7/10
skill Reddit
A Claude skill that takes a YouTube video URL and outputs a structured Markdown note with title, channel, description, chapters, transcript, and YAML frontmatter. One command, no API keys needed.
skillyoutubemarkdownnotestranscription
by JimmySadek Mar 10, 2026 7/10
skill GitHub
A skill collection covering the full academic research pipeline: research, write, review, revise, and finalize. Enables Claude Code to handle complete research document workflows autonomously.
skillresearchacademicwritingworkflow
by Imbad0202 Mar 10, 2026 6/10
skill Reddit
A Claude Code plugin with four commands designed for non-linear thinkers: /task for quick brain dumps, /next for priority-scored task picking with in-progress highlighting, /save for WIP commits, and /done for test-run-commit. Built on markdown and git, zero infrastructure.
skilltask-managementproductivitygitadhd
by Endlesssky27 Mar 10, 2026 7/10
skill Reddit
A Claude skill using the Zyte API to take screenshots and extract content from websites without launching a browser. Handles bot detection, bans, and CAPTCHAs transparently.
skillscreenshotweb-scrapingzyteheadless
by cli_ninja Mar 10, 2026 7/10
skill Reddit
A structured competitive analysis skill running three sequential waves with parallel agents: competitor profiling and pricing intelligence, customer sentiment mining from review platforms and communities, and strategic synthesis. Extracts real signal — pricing psychology, G2 complaints, hiring signals — not just company names.
skillcompetitive-analysismulti-agentresearchbusiness
by ferdbons Mar 10, 2026 8/10
skill Reddit
A defense-in-depth guide for public AI chatbots covering input sanitization, rate limiting, zero-trust system prompt design, output controls, and cost caps. Includes a Claude Code skill that automatically tests all 16 prompt injection techniques against your chatbot.
skillsecurityprompt-injectiontestingdefense
by renatoworks Mar 10, 2026 7/10
skill GitHub
A complete Claude Code skill collection with seven professional toolkits covering project management, design, documents, analytics, knowledge management, repository operations, and multi-AI coordination.
skillcollectionprofessionalpmdesignanalytics
by LeoLin990405 Mar 10, 2026 7/10
skill GitHub
A Claude Code skill that detects error swallowing, boolean traps, always-passing assertions, and 10 other E2E test anti-patterns. Helps identify flaky or misleading tests that pass but provide no real coverage.
skilltestinge2eanti-patternsquality
by dididy Mar 10, 2026 8/10
skill GitHub
A Claude Code skill that renders MP4 videos from natural language descriptions using npx. Supports animations, transitions, captions, and 50+ effects entirely from the terminal.
skillvideomedia-generationclianimations
by superyhee Mar 10, 2026 7/10
skill GitHub
A Claude Code skill that turns the agent into a senior software architect through an 8-phase development cycle including TDD, adversarial code review, and quality gate checks before proceeding to the next phase.
skilltddcode-reviewquality-gatesarchitecture
by vlad-ko Mar 10, 2026 7/10
skill GitHub
A set of skills for automating Unity Editor operations using AI agents and JSON command files. Handles scene management, GameObject manipulation, and configuration changes without manually clicking through the Unity UI.
unitygame-devautomationeditorjsonskills
Mar 10, 2026 7/10
skill GitHub
A comprehensive set of 179 Rust coding rules covering better practices, error handling, and memory management. Designed to work as skills for Claude Code and other AI coding agents, keeping generated Rust code idiomatic and safe.
rustskillscode-qualityerror-handlingmemory-safetyrules
Mar 10, 2026 7/10
skill GitHub
A curated collection of terminal skills for AI agents covering server administration, Kubernetes, DevOps workflows, and cloud computing. Gives agents reliable patterns for common infrastructure tasks.
skillsterminalkubernetesdevopscloudserver-admin
Mar 10, 2026 6/10
skill GitHub
A skills collection for AI agents focused on web quality: performance optimization, accessibility improvements, and SEO based on Google Lighthouse and Core Web Vitals guidelines. Helps agents generate web code that passes real-world quality benchmarks.
skillswebperformanceaccessibilityseolighthousecore-web-vitals
Mar 10, 2026 6/10
skill GitHub
A collection of Claude Code skills targeting two use cases: structured AI debates for decision-making and comprehensive app validation workflows. Includes tools for adversarial critique and multi-step quality checks.
skillsvalidationai-debateworkflowquality-assurance
Mar 10, 2026 7/10
skill GitHub
A skill installer that scans skills for security issues before installing them, covering 49 agents, 12 plugins, and 41 expert skills across multiple AI platforms. Addresses the trust problem of installing third-party skills without knowing what they do.
skillssecurityinstallerscanningtrustmulti-platform
Mar 10, 2026 8/10
skill GitHub
An awesome-list aggregating Claude Code skills, slash commands, hooks, and related resources. A good starting point for discovering what the community has built and sharing your own skills.
skillsawesome-listcuratedcommunitydiscovery
Mar 10, 2026 7/10
skill GitHub
A single-install skill/agent/hook pack that works across Claude Code, Gemini CLI, and Codex CLI with zero configuration. Includes 33 skills, 8 agents, and 19 hooks — one of the most complete cross-platform AI coding skill packs available.
skillshooksagentsgemini-clicodex-clicross-platformzero-config
Mar 10, 2026 9/10
skill GitHub
A project template for Claude Code that enforces structured, document-driven development with defined agent roles and collaborative checkpoints. Good starting point for teams or individuals who want disciplined agentic workflows from day one.
templatedocument-drivencollaborationstructuredworkflow
Mar 10, 2026 7/10
skill GitHub
A set of carefully considered, opinionated agent skills built specifically for Claude Code. Each skill encodes a preferred approach rather than offering options, reducing decision fatigue during sessions.
skillsagent-skillscuratedopinionatedworkflow
Mar 10, 2026 8/10
skill GitHub
A meta-skill that builds, upgrades, and scans other Claude Code and Antigravity SKILL.md files. Features live best-practices sync, marketplace search, skill upgrader, skill scanner, and self-validation. Essentially a skill management system that keeps your skills current automatically.
skillsskill-managementskill-mdbest-practicesself-improvingmarketplace
Mar 10, 2026 9/10
skill GitHub
An Agent Skills-format skill that runs autonomous ML research: designs experiments, deploys them to Modal GPUs, tracks budget consumption, and iterates without human intervention. Ideal for rapid hypothesis testing on real GPU hardware.
machine-learningresearchmodalgpuautonomousbudget-trackingskill
Mar 10, 2026 9/10
skill Reddit
A detailed breakdown of +1,643 token changes in Claude Code 2.1.72 system prompts: new Auto mode (continuous background execution), Brief mode (Codex-like short status updates), ExitWorktree tool, and a second ToolSearch description. Several consolidated and removed guidance sections as well.
system-promptauto-modebrief-modeworktreechangelogtoolsearch
Mar 10, 2026 8/10
skill GitHub
A memory retention system for Claude Code that uses structured markdown files to persist context across sessions. Ensures that knowledge from past sessions survives compaction and new session starts without relying on external databases.
memorycontext-persistencemarkdownsessionscontinuity
Mar 10, 2026 8/10
skill GitHub
A full product development team simulation for Claude Code with 19 specialized agents, 16 skills, and TDD/BDD test workflows. Covers the full software lifecycle from planning through delivery with structured handoffs between agent roles.
multi-agenttddbddproduct-developmentskillsworkflow
Mar 10, 2026 8/10
skill GitHub
A Next.js + Fumadocs site aggregating community best practices for Claude Code. Covers document structures, MDX content, and navigable routes for scalable documentation.
best-practicesdocumentationreferencecommunity
Mar 10, 2026 6/10
skill Reddit
Community question on how to tune your global CLAUDE.md so Claude explains its reasoning and code in accessible terms as it builds. Useful starting point for learners who want to ship real apps while building their coding knowledge alongside Claude.
claude.mdlearningvibe-codingbeginnerexplanations
by /u/Wheels859 Mar 10, 2026 6/10
skill GitHub
A free, open-source Claude Code plugin that teaches programming as you work. Provides contextual explanations, micro-quizzes, and a belt progression system to gamify learning. Unique in targeting developers who want to understand what Claude Code is doing, not just let it run.
educationlearningpluginclaude-codegamificationquizzesopen-source
by DojoCodingLabs Mar 10, 2026 7/10
skill GitHub
A skills manager for AI agents — Claude Code, Cursor, Codex, and more — focused on deterministic behavior and speed. Manages and organizes agent skills so they can be reliably discovered and invoked. Addresses the growing need for structured skill registries as agent skill ecosystems mature.
skills-manageragent-skillsclaude-codecursorcodexdeterministic
by AI-Eden Mar 10, 2026 7/10
skill GitHub
Agent skills for Bitrefill that let AI coding agents browse, buy, and manage gift cards, mobile top-ups, and eSIMs. Compliant with the Agent Skills spec and works with Claude Code, Cursor, and npx skills. A concrete example of real-world commerce actions exposed as agent skills.
agent-skillsbitrefille-commercegift-cardsclaude-codecursor
by bitrefill Mar 10, 2026 5/10
skill GitHub
A tool that converts human-written CLAUDE.md files into an AI-native structured-label format, achieving the same rules with fewer tokens and higher model compliance. Battle-tested across 5 rounds and 4 models. A practical upgrade for anyone optimizing their CLAUDE.md for efficiency.
CLAUDE.mdtoken-optimizationstructured-formatconfigurationcompliance
by sstklen Mar 10, 2026 8/10
skill GitHub
A Python project template built for Claude Code with a TDD workflow baked in, 7 custom agents, and an 11-step Phase Completion Checklist. Provides a structured, opinionated starting point for Python projects that leverages Claude Code from day one. Good reference for teams establishing Claude Code conventions.
templatepythontddmulti-agentCLAUDE.mdworkflow
by stranma Mar 10, 2026 7/10
skill GitHub
Tool for validating Claude Code skills against the agentskills specification. Helps ensure your SKILL.md files are correctly structured and compliant with emerging standards for AI agent skills.
skillvalidationagentskillsspecSKILL.md
by olgasafonova Mar 9, 2026 5/10
skill GitHub
Curated collection of Svelte and SvelteKit agent skills, defaults, coding guidelines, and patterns. Provides framework-specific context to help AI agents write idiomatic Svelte code.
skillsveltesveltekitguidelinespatterns
by j13z Mar 9, 2026 5/10
skill GitHub
Curated collection of modular agent skills enabling on-demand knowledge injection through standardized SKILL.md packages. Focuses on dynamic, composable skills that can be mixed and matched for different development contexts.
skillSKILL.mdmodularknowledge-injectioncurated
by jrmapa Mar 9, 2026 5/10
skill GitHub
Collection of production-tested Claude Code skills for building B2B SaaS applications using TypeScript. Includes GDPR compliance patterns and workflows vetted through real production use cases.
skillb2bsaastypescriptgdprproduction
by freitasp1 Mar 9, 2026 6/10
skill GitHub
Claude Code skill for generating architecture, system, and UML diagrams using draw.io. Supports customizable styles and multi-format export, letting Claude produce professional technical diagrams on demand.
skilldraw.iodiagramsarchitectureumlvisualization
by quant-chiggz Mar 9, 2026 6/10
skill GitHub
Claude Code skill providing CLI tools for managing Obsidian vaults — notes, tasks, tags, templates, and knowledge graph analysis. Bridges the gap between Obsidian knowledge management and AI-assisted development.
skillobsidianknowledge-managementnotescli
by wizzy15 Mar 9, 2026 6/10
skill GitHub
Comprehensive collection of 66 Claude AI skills and 9 workflows designed to enhance productivity for full-stack developers. Covers a wide range of development scenarios from frontend to backend and deployment.
skillfull-stackworkflowcollectionproductivity
by zacklecon Mar 9, 2026 6/10
skill GitHub
Curated collection of high-quality Claude skills focused on business analysis and content creation. Practical skills for applied AI use cases beyond coding, including strategy, reporting, and communication.
skillbusiness-analysiscontentcurated
by Mann1988 Mar 9, 2026 5/10
skill Reddit
Study platform that installs as a Claude Code slash command and runs entirely in the terminal. Uses FSRS-4.5 for spaced repetition scheduling with Claude as the study engine. Designed for engineers with backlogs of papers, RAG handbooks, and agent playbooks to study.
skillspaced-repetitionlearningterminalslash-commandFSRS
by AntonioVFranco Mar 9, 2026 7/10
skill GitHub
A Claude Code skill that orchestrates a two-agent system where Claude handles planning and verification while Gemini CLI executes the actual code implementation. Leverages strengths of both models in a structured divide-and-conquer workflow.
skillgeminiorchestrationplanningmulti-agent
by MikoChun Mar 9, 2026 7/10
skill Reddit
Claude Code skill that evolves itself after every run by learning your coding style. Features native MCP for real API connections, context compression to fight context rot, 60% cost reduction via prompt caching, and agentic self-healing for broken code. Works on Claude Code and Gemini CLI.
skillself-evolvingmcpcontext-compressionprompt-cachingself-healing
by Caramaschi Mar 9, 2026 8/10
skill X
A community-built index of Claude Code ecosystem resources: language-specific CLAUDE.md templates (TypeScript, Python, Next.js, homelab), an MCP server directory, hook recipes, CLI piping tricks, and workflow patterns. Built because the ecosystem was too scattered to navigate easily. High-signal starting point for new and experienced users alike.
curated-listclaude-mdmcphooksresources
by @1erkan Mar 9, 2026 8/10
skill Reddit
A Claude Code skill that automates adding web analytics to any new project in seconds. Install with `npx skills add isaacaudet/web-analytics-setup`. Eliminates the repetitive manual setup that most developers redo on every project. Practical time-saver for frequent project starters.
skillsanalyticssetupautomation
by demars123 Mar 9, 2026 7/10
skill Reddit
After building 7 Claude Code skills that chain MCP tool calls, the author cataloged the 6 most common failure patterns with concrete fixes for each. Covers issues like tool call ordering, error propagation, context loss, and MCP response handling. Practical debugging guide that applies to any skill calling MCP servers.
debuggingskillsmcpfailure-patterns
by mgdo Mar 9, 2026 8/10
skill GitHub
A framework of epistemic protocols that enforces consistent reasoning quality across Claude Code agent sessions. Structures how the agent gathers evidence, makes decisions, and escalates uncertainty. Useful for teams that need reproducible, auditable agent behavior on complex tasks.
protocolsreasoningqualitydecision-making
by jongwony Mar 9, 2026 6/10
skill GitHub
A maintained, daily-updated index of tools, resources, and community projects across the Anthropic ecosystem. Covers Claude Code, MCP, the API, and third-party integrations. Useful as a living reference for staying current without monitoring every forum and repo individually.
curated-listresourcesanthropicreference
by Boroldoi0402 Mar 9, 2026 5/10
skill GitHub
A Claude Code skill that performs comprehensive security audits of web applications, covering OWASP Top 10 vulnerabilities, automated dependency scanning, and detailed vulnerability reports. Integrates security review into your standard Claude Code workflow without switching tools.
securityowaspauditdependencies
by RiturajMitra Mar 9, 2026 6/10
skill GitHub
A curated collection and navigation resource for AI agent skills across Claude Code, OpenAI, and MCP servers. Centralizes community-built skills to make them easier to discover and install. Good starting point for extending your agent's capabilities.
skillsdiscoverycurated-listmcp
by megalor1 Mar 9, 2026 5/10
skill GitHub
A collection of practical Claude Code skills targeting everyday dev friction: port conflict management and multilingual content translation. Covers real workflow pain points with reusable slash commands. A good example of targeted, single-purpose skill design.
skillsautomationproductivitycli
by danicuevas23 Mar 9, 2026 6/10
skill GitHub
A collection of slash-command workflows specifically designed to make Claude Code reliable on complex, multi-step tasks where it commonly drifts or fails. Addresses real failure modes in agentic operations through structured skill patterns. A practical toolkit from an active Claude Code power user.
skillsslash-commandsreliabilityworkflow
by npow Mar 9, 2026 7/10
skill GitHub
A comprehensive collection of Claude Code configurations, agents, and patterns refined over 10+ months by an Anthropic hackathon winner. Covers the full range from basic prompting to multi-agent orchestration. One of the most battle-tested Claude Code setups available publicly.
agentsconfigurationhackathonreference
by arabicapp Mar 9, 2026 8/10
skill GitHub
A collection of agent skills designed to work with both OpenClaw and Claude Code. Provides reusable commands that extend your coding agent's capabilities with community-contributed workflows. Good resource for skill authors looking at cross-compatible patterns.
skillsopenclawcross-compatiblecommunity
by ZLHad Mar 9, 2026 5/10
skill GitHub
A Claude Code skill that generates and edits PowerPoint presentations using direct XML manipulation. Enables AI-assisted slide creation from within your development environment without external tools. Useful for developers who need to produce presentation deliverables alongside code.
skillspowerpointpresentationsoffice
by 24111999 Mar 9, 2026 5/10
skill GitHub
Academic research skills for Claude Code covering literature review writing and automated slide generation from research papers. Bridges the gap between reading papers and producing research outputs. Designed for researchers and graduate students using AI in their academic workflow.
skillsresearchacademicpresentations
by Ronitnair Mar 9, 2026 5/10
skill GitHub
A comprehensive guide for creating and enhancing Agent Skills, drawing from official Anthropic documentation and community insights. Covers skill structure, tool integration, and effective prompt patterns. Good starting point for developers new to building Claude Code skills.
skillsguidedocumentationgetting-started
by kaydenplayZ Mar 9, 2026 5/10
skill X
A Claude Code skill that rewrites plain-text image descriptions into structured JSON prompts optimized for Nano Banana 2 (image generation model), producing professional-quality outputs. Demonstrates how Claude Code skills can bridge AI tools via prompt transformation.
skillimage-generationJSONprompt-engineering
by @TechWith_Nova Mar 9, 2026 6/10
skill GitHub
A reusable project template providing ADR, TLDR, and Roadmap systems with pre-configured AI agent and skill configs for Claude Code and Codex CLI. Designed to bring structured knowledge governance to any codebase regardless of stack.
templateCLAUDE.mdADRknowledge-managementcodex
by marioGusmao Mar 9, 2026 7/10
skill GitHub
A Claude Code skill that orchestrates a full implementation workflow across multiple AI models: research, evaluation, design baseline, implementation, root cause analysis, and auditing. Designed to leverage each model's strengths at different stages of a task.
skillmulti-modelworkfloworchestrationaudit
by nestharus Mar 9, 2026 8/10
skill GitHub
A ready-to-use set of Claude agent skills covering research, science, engineering, analysis, finance, and writing. Provides domain-specific prompting patterns for technical and scientific work where Claude Code is used beyond pure software tasks.
skillresearchscienceengineeringanalysis
by K-Dense-AI Mar 9, 2026 7/10
skill GitHub
A production-ready skills collection covering the complete delivery workflow: research, epic planning, task breakdown, implementation, testing, code review, and quality gates. Designed as a drop-in skill set for teams using Claude Code professionally.
skillworkflowproductioncode-reviewquality
by levnikolaevich Mar 9, 2026 8/10
skill GitHub
A Claude Code skill that wraps jadx to decompile Android APK, XAPK, AAB, DEX, JAR, and AAR files directly from your coding session. Useful for security researchers and developers analyzing third-party Android binaries.
skillandroidreverse-engineeringsecurityjadx
by incogbyte Mar 9, 2026 6/10
skill Reddit
A Claude Code skill that dispatches 6 parallel research agents to analyze any market in ~20 minutes using real web data — reviews, pricing, forums, funding signals, and hiring trends. Demonstrated on the AI coding assistants market with 15 competitors analyzed.
skillresearchparallel-agentscompetitive-intelligencemarket-analysis
by ferdbons Mar 9, 2026 7/10
skill GitHub
A framework for building and using production-ready Claude Code agents and skills, with automatic documentation generation. Helps teams maintain a catalog of reusable agent behaviors with up-to-date documentation.
skillagentsdocumentationproductivity
by bloody2634 Mar 9, 2026 6/10
skill GitHub
A one-command install providing professional Claude Code configuration: 16 curated skills, automated hooks, team coding standards enforcement, and the REEL autonomous orchestrator. Designed as a complete opinionated setup for teams adopting Claude Code at scale.
skillhooksorchestrationCLAUDE.mdteamconfiguration
by gsmethells Mar 9, 2026 8/10
skill GitHub
A Claude Code skill that enables automated code analysis and editing by leveraging Codex CLI under the hood. Useful for refactoring workflows where you want Claude Code to orchestrate Codex for specific transformation tasks.
skillcodexautomationrefactoringanalysis
by LightDopper Mar 9, 2026 6/10
skill GitHub
A Claude Code skill that executes dynamically generated Playwright code for browser automation tasks. Rather than writing Playwright scripts manually, you describe what you want and Claude generates and runs the automation on demand.
skillplaywrightbrowser-automationtesting
by jpulido240-svg Mar 9, 2026 7/10
skill GitHub
A Claude Code skill that transforms Claude into a System Architect, generating detailed project documentation with clear component boundaries and traceable requirements. Useful at project kickoff to produce structured specs before implementation begins.
skillarchitecturedocumentationrequirementsspecs
by 428alexander9 Mar 9, 2026 6/10
skill GitHub
A product management skills framework built on proven PM methodologies, compatible with Claude Code, Cowork, Codex, and AI agents. Covers roadmapping, prioritization, stakeholder communication, and delivery — bridging PM work with AI-assisted engineering.
skillproduct-managementroadmapprioritizationmethodology
by deanpeters Mar 9, 2026 7/10
skill GitHub
A set of Claude Code agent skills targeting startup use cases: market validation, competitive intelligence, and planning. Designed for founders and product builders using Claude Code to accelerate pre-build research.
skillstartupcompetitive-intelligencevalidationplanning
by ferdinandobons Mar 9, 2026 6/10
skill Reddit
Any skill that will help Claude understand the telegram’s premium features, its architecture. To use for deploying a new bot. submitted by /u/Mon3y_craft [link] [comments]
skill
by Mon3y_craft Mar 9, 2026 6/10
skill GitHub
12 production skills for Claude Code. Copy a folder, get a superpower.
skill
by jord0-cmd Mar 9, 2026 8/10
skill GitHub
🌳 AI-Powered Skill Tree for Lifelong Human Learning. 30+ skills from K-12 to career & social intelligence, built on cognitive science. | 人类养成记:AI 驱动的终身学习技能树
skill
by 24kchengYe Mar 9, 2026 5/10
skill GitHub
Security-audited skills for Claude, Codex & Claude Code. One-click install, quality verified.
skill
by aiskillstore Mar 9, 2026 8/10
skill Reddit
I've been playing with the design of my personal skills I've written. I have lots of code examples in them, because when I was asking Claude for guidance in writing them it encouraged me to do so. ...
skill
by lambda-legacy Mar 9, 2026 6/10
skill Reddit
I've been automating some parts of my business for the past few months. Along the way I found some very useful skills (markdown files that teach Claude specific workflows) and built a bunch of cust...
skillworkflowreview
by sberoch Mar 9, 2026 9/10
skill GitHub
📦 Simplify Swift concurrency migration with this skill, offering full access to the Swift Concurrency Migration Guide and code examples for easy adaptation.
skill
by rolandobenitez Mar 9, 2026 5/10
skill GitHub
🎨 Create unique, production-ready frontend UIs with this plugin, featuring distinctive typography, custom colors, asymmetric layouts, and impactful animations.
skill
by 01789692905 Mar 9, 2026 5/10
skill GitHub
11 Claude Code skills for product builders shipping with agentic AI
skill
by smith-horn Mar 9, 2026 9/10
skill GitHub
169 production-ready skills & plugins for Claude Code, OpenAI Codex, and OpenClaw — engineering, marketing, product, compliance, C-level advisory, and more. Install via /plugin marketplace.
skill
by alirezarezvani Mar 9, 2026 8/10
skill Reddit
Common situation readed here: write a plan, supposed detailed... implement reachs 60% in the best case how are you doing to avoid this situation? I tried to build more detailed prd's without much i...
skillworkflow
by jrhabana Mar 9, 2026 5/10
skill Reddit
My idea is to submit text, or a pdf, for Claude to analyze and output specific quotes from it that are in a certain tone, word limit, and subject. I have used projects before and know they are good...
skill
by jawwajxy Mar 9, 2026 6/10
skill Reddit
If you've seen setups like Daniel Miessler's PAI, the goal is an assistant that knows everything about you, like your schedule, your health, and your finances. That's hub-and-spoke, with one centra...
skillreview
by anothercoffee Mar 9, 2026 7/10
skill GitHub
A collection of AI Skills specialized in Django Backend development
skill
by vintasoftware Mar 9, 2026 5/10
skill GitHub
Provide curated Anthropic-format skills for AI agents focused on robotics software, including practical patterns, code examples, and design principles.
skill
by vicky23383 Mar 9, 2026 7/10
skill GitHub
Enable AI agents to access and analyze real-time social media data from Twitter, Instagram, Reddit, and TikTok using standardized skills.
skill
by Aditya923-c Mar 9, 2026 6/10
skill GitHub
Enable AI agents to autonomously create, evaluate, and evolve skills across any marketplace without user intervention.
skill
by kledidoda Mar 9, 2026 6/10
skill GitHub
A Claude Code skill providing structured, token-efficient guidance for Svelte 5 development including best practices, real-world patterns, and expert insights. Gives Claude deep Svelte 5 context without bloating the context window.
Svelteskillfrontendtoken-efficient
by NikosDevMC Mar 9, 2026 6/10
skill GitHub
A collection of Claude Code skills targeting modern full-stack development with Cloudflare Workers, React, Tailwind CSS v4, and AI integrations. Provides structured, up-to-date context so Claude can assist accurately with these stacks without hallucinating outdated APIs.
CloudflareReactTailwindskillsfull-stackAI-integration
by jezweb Mar 9, 2026 7/10
skill GitHub
A structured Claude Code skill providing comprehensive access to Swift Programming Language content, enabling Claude to give expert Swift guidance for iOS and macOS development. Covers core language features and common patterns from the official Swift book.
SwiftiOSmacOSskilllanguage
by Shada01245 Mar 9, 2026 5/10
skill GitHub
A Claude Code skill that integrates RubyCritic to surface code quality metrics, complexity scores, and technical debt insights for Ruby and Rails projects. Enables Claude to reason about and improve code quality as part of your development workflow.
RubyRailscode-qualityRubyCriticskillmetrics
by thairns Mar 9, 2026 6/10
skill GitHub
A Claude Code skill that integrates Gemini CLI for code generation, review, testing, documentation, and architecture analysis. Lets Claude Code users leverage Gemini's capabilities within the same workflow for tasks where a second model opinion adds value.
Geminimulti-modelskillcode-reviewCLI
by Junayedahmedd Mar 9, 2026 6/10
skill GitHub
A Claude Code skill that adds ast-grep-powered structural code search, letting Claude find patterns in codebases beyond simple text matching. Particularly useful for error handling audits, refactoring tasks, and enforcing coding conventions across large projects.
ast-grepcode-searchpatternsskillrefactoring
by Kayunangka Mar 9, 2026 6/10
skill GitHub
A Claude Code skill enabling orchestration of multi-agent research workflows with parallel subagent execution, structured audits, and workflow planning. Useful for complex investigations requiring breakdown across multiple specialized agents with result synthesis.
multi-agentresearchorchestrationparallelskill
by zubayer0077 Mar 9, 2026 7/10
skill Reddit
Hi, I updated to 2.1.71 but when typing /loop nothing pop out and also If I try to use it saidd no skill found. Im on windows 11 submitted by /u/triko93 [link] [comments]
skill
by triko93 Mar 9, 2026 5/10
skill Reddit
Do you know of any cool skills for claude.ai for a WordPress FSE, SEO, copywriting, or design designer, social media post X, FB? I already have some, but maybe you can inspire me. Thanks in advance...
skill
by tomaszgiemza Mar 9, 2026 6/10
skill GitHub
Discover, Curate, and Evolve Claude Skills Using Claude Skills 🤯
skill
by JasonLo Mar 9, 2026 6/10
skill GitHub
23 production-ready SEO skills for Claude Code. Technical SEO, content optimization, keyword research, backlink analysis, and AI visibility monitoring.
skill
by norahe0304-art Mar 9, 2026 8/10
skill GitHub
Manage, share, and safely publish Codex skills with automated sanitization, validation, and streamlined installation workflows for team use.
skillworkflow
by Taison472 Mar 9, 2026 5/10
skill GitHub
We don't have time for that is no longer an answer. Draft v0 puts senior engineering expertise at your fingertips — 17 skills, 8 agents, and 12 prompt templates that handle the code so your team st...
skill
by michelve Mar 9, 2026 6/10
skill GitHub
baoyu-skills:
skill
by JimLiu Mar 9, 2026 5/10
skill GitHub
Build, upgrade, and validate Claude Code and Antigravity SKILL.md files with live best practices and multi-marketplace discovery tools.
skill
by cxshoutghost Mar 9, 2026 10/10